F478236

General Info

Members Datasets Scaffolds Average Seq Length
735 386 1471 155

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862290372|2862294501
Length 158
Sequence IASNTRVDLAELLDFVRPRHRAVLLTRRTDGGPQASPLTLGVDDSGRLVMSTYPERAKTRNAKRDEQVSVLVLSGGTSRTESGGEWNGPWVQVDGTAEVLDVPDSVEPLVEYFRNISGEHPDWDEYRAAMVKQGKSLIRVTPERWGPIATGGFPARLA

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
46 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
48 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
78 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
79 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
84 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
85 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
86 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
87 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
100 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
101 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
102 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
103 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
104 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
107 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
108 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
109 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
110 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
117 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
118 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
119 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
122 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
123 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
124 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
125 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
145 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
170 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
175 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
192 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
233 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
271 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
272 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
273 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
274 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
275 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
276 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
277 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
278 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
279 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
280 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
281 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
282 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
283 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
284 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
285 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
286 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
287 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
290 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
291 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
292 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
293 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
294 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
297 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
303 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
304 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
305 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
306 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
307 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
308 2643221548 Streptomyces sp. Root55 Isolate Unclassified
309 2643221578 Streptomyces sp. Root63 Isolate Unclassified
310 2643221647 Streptomyces sp. Root369 Isolate Unclassified
311 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
312 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
313 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
314 2643221714 Streptomyces sp. Root264 Isolate Unclassified
315 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
316 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
317 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
318 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
319 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
320 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
321 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
322 2808606448 Streptomyces sp. 193411 Isolate Unclassified
323 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
324 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
325 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
326 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
327 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
328 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
329 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
330 2862574272 Streptomyces sp. AcE210 Isolate Nodule
331 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
332 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
333 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
334 2867369537 Streptomyces sp. Z26 Isolate Unclassified
335 2867428634 Streptomyces sp. RP5T Isolate Unclassified
336 2867475112 Streptomyces sp. TM32 Isolate Unclassified
337 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
338 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
339 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
340 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
341 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
342 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
343 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
344 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
345 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
346 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
347 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
348 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
349 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
350 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
351 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
352 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
353 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
354 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
355 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
356 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
357 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
358 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
359 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
360 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
361 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
362 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
363 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
364 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
365 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
366 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
367 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
368 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
369 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
370 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
371 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
372 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
373 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
374 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
375 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
376 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
377 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
378 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
379 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
380 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
381 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
382 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
383 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
384 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
385 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
386 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.76
Metatranscriptomes 0.68
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 7.62
Nodule 0.82
Rhizoplane 1.36
Rhizosphere 77.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022997 3300001989 Bacteria 2207
2 JGI24737J22298_10070152 3300001990 Bacteria 1047
3 JGI24735J21928_10045118 3300002067 Bacteria 1280
4 JGI24738J21930_10047408 3300002075 Bacteria 874
5 JGI25153J46596_10049885 3300003215 Bacteria 1211
6 rootH1_10033732 3300003316 Bacteria 1987
7 rootH1_10033732 3300003323 Bacteria 1356
8 rootH1_10033733 3300003316 Bacteria 4211
9 rootL2_10041240 3300003322 Bacteria 3617
10 rootL2_10210732 3300003322 Bacteria 2074
11 rootH1_10123303 3300003323 Bacteria 2946
12 rootH1_10152422 3300003323 Bacteria 2197
13 JGI25160J50197_1047075 3300003354 Bacteria 941
14 Ga0006562J51391_1050546 3300003578 Bacteria 5140
15 Ga0006562J51391_1050549 3300003578 Bacteria 900
16 Ga0006562J51391_1061896 3300003578 Bacteria 2485
17 Ga0070659_100618232 3300005366 Bacteria 932
18 Ga0070678_100978085 3300005456 Bacteria 777
19 Ga0070681_10359612 3300005458 Bacteria 1366
20 Ga0068853_100104923 3300005539 Bacteria 2503
21 Ga0068853_101139383 3300005539 Bacteria 752
22 Ga0070665_100304078 3300005548 Bacteria 1598
23 Ga0070665_100330676 3300005548 Bacteria 1528
24 Ga0068855_100023062 3300005563 Bacteria 7459
25 Ga0070664_100072581 3300005564 Bacteria 2952
26 Ga0068857_100269982 3300005577 Bacteria 1563
27 Ga0068856_100010663 3300005614 Bacteria 8929
28 Ga0068856_100415826 3300005614 Bacteria 1365
29 Ga0070702_100991800 3300005615 Bacteria 664
30 Ga0068852_100001014 3300005616 Bacteria 18540
31 Ga0081455_10365355 3300005937 Bacteria 1013
32 Ga0075363_100076247 3300006048 Bacteria 1828
33 Ga0075363_100087882 3300006048 Bacteria 1708
34 Ga0075363_100201209 3300006048 Bacteria 1138
35 Ga0075370_10084253 3300006353 Bacteria 1830
36 Ga0099826_10388104 3300006948 Bacteria 682
37 Ga0105250_10175887 3300009092 Bacteria 897
38 Ga0105240_10076356 3300009093 Bacteria 4130
39 Ga0105240_10907819 3300009093 Bacteria 947
40 Ga0105245_10241199 3300009098 Bacteria 1752
41 Ga0105245_10328955 3300009098 Bacteria 1508
42 Ga0105243_10956558 3300009148 Bacteria 856
43 Ga0105243_12657826 3300009148 Bacteria 541
44 Ga0105241_10001341 3300009174 Bacteria 18679
45 Ga0105242_10517223 3300009176 Bacteria 1138
46 Ga0105248_10106466 3300009177 Bacteria 3162
47 Ga0105238_10709397 3300009551 Bacteria 1018
48 Ga0105249_11659376 3300009553 Bacteria 712
49 Ga0105239_10014936 3300010375 Bacteria 8608
50 Ga0105239_11253092 3300010375 Bacteria 855
51 Ga0105239_11323169 3300010375 Bacteria 831
52 Ga0105239_11665290 3300010375 Bacteria 738
53 Ga0105239_12481449 3300010375 Bacteria 604
54 Ga0105246_10000030 3300011119 Bacteria 52202
55 Ga0105246_10135778 3300011119 Bacteria 1843
56 Ga0105246_10476239 3300011119 Bacteria 1055
57 Ga0157369_10065387 3300013105 Bacteria 3913
58 Ga0157374_10365857 3300013296 Bacteria 1435
59 Ga0157372_10102885 3300013307 Bacteria 3263
60 Ga0157375_12561578 3300013308 Bacteria 609
61 Ga0157380_10600838 3300014326 Bacteria 1088
62 Ga0182008_10002267 3300014497 Bacteria 12145
63 Ga0157376_10944088 3300014969 Bacteria 883
64 Ga0182007_10004465 3300015262 Bacteria 6339
65 Ga0183367_1008 3300015688 Bacteria 490626
66 Ga0224712_10045281 3300022467 Bacteria 1682
67 Ga0224712_10241416 3300022467 Bacteria 832
68 Ga0209758_1008765 3300025297 Bacteria 6450
69 Ga0207426_1001637 3300025302 Bacteria 17519
70 Ga0207426_1003477 3300025302 Bacteria 8511
71 Ga0207426_1004228 3300025302 Bacteria 7135
72 Ga0207426_1010421 3300025302 Bacteria 3605
73 Ga0207426_1018541 3300025302 Bacteria 2450
74 Ga0207680_10540608 3300025903 Bacteria 831
75 Ga0207647_10015752 3300025904 Bacteria 5175
76 Ga0207654_10009813 3300025911 Bacteria 4869
77 Ga0207695_10004099 3300025913 Bacteria 20031
78 Ga0207671_10000128 3300025914 Bacteria 117836
79 Ga0207694_10207057 3300025924 Bacteria 1597
80 Ga0207687_10049131 3300025927 Bacteria 2932
81 Ga0207687_10076420 3300025927 Bacteria 2405
82 Ga0207706_10090638 3300025933 Bacteria 2688
83 Ga0207709_10962978 3300025935 Bacteria 696
84 Ga0207711_10279927 3300025941 Bacteria 1536
85 Ga0207679_10025198 3300025945 Bacteria 4088
86 Ga0207667_10055281 3300025949 Bacteria 4173
87 Ga0207640_10379866 3300025981 Bacteria 1144
88 Ga0207703_10277085 3300026035 Bacteria 1522
89 Ga0207639_10085880 3300026041 Bacteria 2504
90 Ga0207639_10176724 3300026041 Bacteria 1813
91 Ga0207678_10023248 3300026067 Bacteria 5421
92 Ga0207708_10312671 3300026075 Bacteria 1280
93 Ga0207702_10249966 3300026078 Bacteria 1665
94 Ga0207702_10269079 3300026078 Bacteria 1607
95 Ga0207674_10947892 3300026116 Bacteria 829
96 Ga0207675_100068085 3300026118 Bacteria 3328
97 Ga0207683_11356060 3300026121 Bacteria 658
98 Ga0207698_10349870 3300026142 Bacteria 1395
99 Ga0209371_1013135 3300027312 Bacteria 2348
100 Ga0209282_1270904 3300027666 Bacteria 738
101 Ga0209813_10024039 3300027866 Bacteria 1738
102 Ga0268266_10179042 3300028379 Bacteria 1929
103 Ga0268266_10279799 3300028379 Bacteria 1551
104 Ga0268266_11488576 3300028379 Bacteria 652
105 Ga0307515_10000928 3300028794 Bacteria 67239
106 Ga0307515_10437980 3300028794 Bacteria 924
107 Ga0307515_10581538 3300028794 Bacteria 730
108 Ga0268256_1014405 3300030500 Bacteria 2348
109 Ga0307511_10000945 3300030521 Bacteria 30807
110 Ga0307511_10057234 3300030521 Bacteria 3035
111 Ga0307511_10205780 3300030521 Bacteria 1013
112 Ga0307511_10248197 3300030521 Bacteria 859
113 Ga0307512_10012951 3300030522 Bacteria 7840
114 Ga0307512_10240452 3300030522 Bacteria 917
115 Ga0316181_1127688 3300030744 Bacteria 630
116 Ga0307513_10003927 3300031456 Bacteria 19997
117 Ga0307513_10072221 3300031456 Bacteria 3598
118 Ga0307513_10116156 3300031456 Bacteria 2656
119 Ga0307509_10022630 3300031507 Bacteria 7079
120 Ga0307509_10076738 3300031507 Bacteria 3466
121 Ga0307509_10252668 3300031507 Bacteria 1545
122 Ga0307509_10605991 3300031507 Bacteria 767
123 Ga0307408_102085221 3300031548 Bacteria 546
124 Ga0307508_10002378 3300031616 Bacteria 19910
125 Ga0307508_10022735 3300031616 Bacteria 5699
126 Ga0307508_10047622 3300031616 Bacteria 3821
127 Ga0307508_10077737 3300031616 Bacteria 2897
128 Ga0307508_10079919 3300031616 Bacteria 2851
129 Ga0307508_10198007 3300031616 Bacteria 1610
130 Ga0307508_10724499 3300031616 Bacteria 606
131 Ga0307514_10018627 3300031649 Bacteria 5691
132 Ga0307514_10208235 3300031649 Bacteria 1218
133 Ga0307514_10238643 3300031649 Bacteria 1092
134 Ga0307514_10345239 3300031649 Bacteria 798
135 Ga0307514_10349345 3300031649 Bacteria 789
136 Ga0307514_10356189 3300031649 Bacteria 776
137 Ga0316575_10051119 3300031665 Bacteria 1646
138 Ga0307516_10006477 3300031730 Bacteria 13711
139 Ga0307516_10144310 3300031730 Bacteria 2147
140 Ga0307516_10240442 3300031730 Bacteria 1509
141 Ga0307516_10356750 3300031730 Bacteria 1127
142 Ga0307518_10058932 3300031838 Bacteria 2788
143 Ga0307518_10175432 3300031838 Bacteria 1455
144 Ga0307518_10271488 3300031838 Bacteria 1058
145 Ga0307410_10067358 3300031852 Bacteria 2470
146 Ga0307410_10275437 3300031852 Bacteria 1318
147 Ga0307409_100037687 3300031995 Bacteria 3567
148 Ga0307409_100119570 3300031995 Bacteria 2228
149 Ga0307416_101709543 3300032002 Bacteria 734
150 Ga0307411_10634545 3300032005 Bacteria 923
151 Ga0307507_10017128 3300033179 Bacteria 8353
152 Ga0307507_10028020 3300033179 Bacteria 6016
153 Ga0307510_10041179 3300033180 Bacteria 5056
154 Ga0307510_10085353 3300033180 Bacteria 3034
155 Ga0307510_10121601 3300033180 Bacteria 2313
156 Ga0307510_10219680 3300033180 Bacteria 1413
157 Ga0307510_10494631 3300033180 Bacteria 665
158 Ga0395899_0261655 3300037312 Bacteria 1183
159 Ga0395899_0580091 3300037312 Bacteria 717
160 Ga0395900_0179671 3300037418 Bacteria 2151
161 Ga0395900_0424277 3300037418 Bacteria 1290
162 Ga0395898_0001397 3300037466 Bacteria 34434
163 Ga0395898_0003880 3300037466 Bacteria 16509
164 Ga0395898_0073658 3300037466 Bacteria 3299
165 Ga0395905_0365510 3300037471 Bacteria 1336
166 Ga0395901_0078391 3300038443 Bacteria 3449
167 Ga0395901_0096424 3300038443 Bacteria 3099
168 Ga0395901_0105186 3300038443 Bacteria 2962
169 Ga0439436_0003058 3300041404 Bacteria 5077
170 Ga0439436_0004048 3300041404 Bacteria 4493
171 Ga0439439_0008564 3300041406 Bacteria 2419
172 Ga0439439_0066166 3300041406 Bacteria 964
173 Ga0451789_1138150 3300041443 Bacteria 658
174 Ga0451797_0889241 3300041453 Bacteria 791
175 Ga0451807_2473932 3300041486 Bacteria 740
176 Ga0451837_0989560 3300041494 Bacteria 1198
177 Ga0451841_0983366 3300041498 Bacteria 509
178 Ga0451847_0832006 3300041503 Bacteria 705
179 Ga0451851_0290026 3300041507 Bacteria 911
180 Ga0451851_1377664 3300041507 Bacteria 847
181 Ga0451853_0777276 3300041512 Bacteria 2380
182 Ga0451853_2561483 3300041512 Bacteria 2314
183 Ga0439433_0000565 3300041999 Bacteria 7019
184 Ga0439433_0023848 3300041999 Bacteria 1377
185 Ga0439442_009075 3300042002 Bacteria 2011
186 Ga0439442_011672 3300042002 Bacteria 1791
187 Ga0439448_0002231 3300042005 Bacteria 5235
188 Ga0439432_021300 3300042006 Bacteria 2151
189 Ga0439449_0000841 3300042007 Bacteria 11909
190 Ga0439449_0084120 3300042007 Bacteria 1174
191 Ga0439457_001497 3300042014 Bacteria 7001
192 Ga0439462_0000959 3300042015 Bacteria 6127
193 Ga0450890_010016 3300042127 Bacteria 1218
194 Ga0450894_000065 3300042131 Bacteria 16610
195 Ga0450895_005044 3300042132 Bacteria 1057
196 Ga0450896_001817 3300042133 Bacteria 2696
197 Ga0450898_005535 3300042134 Bacteria 1912
198 Ga0450899_000511 3300042135 Bacteria 4391
199 Ga0450900_004000 3300042136 Bacteria 1672
200 Ga0450903_000670 3300042138 Bacteria 6896
201 Ga0450904_013758 3300042139 Bacteria 806
202 Ga0450906_000844 3300042145 Bacteria 6751
203 Ga0439458_0000517 3300042157 Bacteria 9922
204 Ga0450908_032289 3300042184 Bacteria 908
205 Ga0439464_0012340 3300042439 Bacteria 2275
206 Ga0466969_0005631 3300044656 Bacteria 6661
207 Ga0466969_0073532 3300044656 Bacteria 1640
208 Ga0466972_0001060 3300044658 Bacteria 13194
209 Ga0466972_0069299 3300044658 Bacteria 1684
210 Ga0466972_0081032 3300044658 Bacteria 1545
211 Ga0466972_0295908 3300044658 Bacteria 756
212 Ga0466965_0000312 3300044683 Bacteria 16288
213 Ga0466965_0014405 3300044683 Bacteria 3742
214 Ga0466965_0241500 3300044683 Bacteria 967
215 Ga0466966_0001162 3300044684 Bacteria 16927
216 Ga0466966_0002783 3300044684 Bacteria 11495
217 Ga0466961_0002591 3300044693 Bacteria 11217
218 Ga0466961_0005840 3300044693 Bacteria 7798
219 Ga0466961_0034399 3300044693 Bacteria 3253
220 Ga0466961_0035125 3300044693 Bacteria 3219
221 Ga0466961_0062799 3300044693 Bacteria 2360
222 Ga0466963_0003115 3300044694 Bacteria 9398
223 Ga0466963_0165305 3300044694 Bacteria 1541
224 Ga0466964_0008956 3300044706 Bacteria 3765
225 Ga0466964_0039907 3300044706 Bacteria 1893
226 Ga0466964_0392880 3300044706 Bacteria 723
227 Ga0466971_0000277 3300044719 Bacteria 19725
228 Ga0466971_0015939 3300044719 Bacteria 3312
229 Ga0466968_0087204 3300044735 Bacteria 1378
230 Ga0466970_0000443 3300044765 Bacteria 20304
231 Ga0466970_0006602 3300044765 Bacteria 5804
232 Ga0466970_0016652 3300044765 Bacteria 3793
233 Ga0466970_0057196 3300044765 Bacteria 2085
234 Ga0466957_0001357 3300044842 Bacteria 12776
235 Ga0466960_0266483 3300044901 Bacteria 956
236 Ga0466959_0019009 3300045049 Bacteria 5049
237 Ga0466958_0118783 3300045836 Bacteria 1654
238 Ga0466958_0136775 3300045836 Bacteria 1541
239 Ga0466967_0004534 3300045976 Bacteria 9396
240 Ga0466967_0006993 3300045976 Bacteria 8074
241 Ga0466967_0016389 3300045976 Bacteria 5843
242 Ga0466967_0030987 3300045976 Bacteria 4496
243 Ga0466967_0210293 3300045976 Bacteria 1845
244 Ga0466967_0883424 3300045976 Bacteria 889
245 Ga0495617_007941 3300046452 Bacteria 3669
246 Ga0495627_099664 3300046453 Bacteria 830
247 Ga0495592_0009032 3300046454 Bacteria 7491
248 Ga0495592_0086204 3300046454 Bacteria 2262
249 Ga0495592_0159822 3300046454 Bacteria 1551
250 Ga0495603_0000701 3300046455 Bacteria 18948
251 Ga0495603_0002941 3300046455 Bacteria 10074
252 Ga0495603_0004561 3300046455 Bacteria 8266
253 Ga0495603_0007883 3300046455 Bacteria 6422
254 Ga0495603_0025037 3300046455 Bacteria 3609
255 Ga0495603_0046323 3300046455 Bacteria 2591
256 Ga0495603_0627013 3300046455 Bacteria 615
257 Ga0495629_0000808 3300046459 Bacteria 25349
258 Ga0495629_0008474 3300046459 Bacteria 7569
259 Ga0495629_0013998 3300046459 Bacteria 5781
260 Ga0495629_0015401 3300046459 Bacteria 5492
261 Ga0495629_0016632 3300046459 Bacteria 5279
262 Ga0495629_0030931 3300046459 Bacteria 3792
263 Ga0495629_0085598 3300046459 Bacteria 2199
264 Ga0495629_0137419 3300046459 Bacteria 1701
265 Ga0495629_0317301 3300046459 Bacteria 1066
266 Ga0495638_0110084 3300046460 Bacteria 1637
267 Ga0495638_0175704 3300046460 Bacteria 1225
268 Ga0495638_0249774 3300046460 Bacteria 978
269 Ga0495641_0186225 3300046461 Bacteria 930
270 Ga0495641_0314772 3300046461 Bacteria 706
271 Ga0495651_0001478 3300046462 Bacteria 18178
272 Ga0495651_0101094 3300046462 Bacteria 2146
273 Ga0495605_0005776 3300046474 Bacteria 7163
274 Ga0495605_0028277 3300046474 Bacteria 2895
275 Ga0495662_0000395 3300046476 Bacteria 19477
276 Ga0495662_0009266 3300046476 Bacteria 4829
277 Ga0495662_0049855 3300046476 Bacteria 2020
278 Ga0495664_0004484 3300046477 Bacteria 7641
279 Ga0495664_0061773 3300046477 Bacteria 2230
280 Ga0495585_0007936 3300046492 Bacteria 6453
281 Ga0495585_0088060 3300046492 Bacteria 1675
282 Ga0495585_0164620 3300046492 Bacteria 1149
283 Ga0495585_0281423 3300046492 Bacteria 822
284 Ga0495594_0005254 3300046499 Bacteria 6657
285 Ga0495594_0012424 3300046499 Bacteria 4435
286 Ga0495594_0016252 3300046499 Bacteria 3919
287 Ga0495594_0033179 3300046499 Bacteria 2805
288 Ga0495594_0069923 3300046499 Bacteria 1950
289 Ga0495594_0132329 3300046499 Bacteria 1413
290 Ga0495594_0231446 3300046499 Bacteria 1053
291 Ga0495594_0284825 3300046499 Bacteria 941
292 Ga0495596_0049344 3300046500 Bacteria 1650
293 Ga0495607_0069566 3300046501 Bacteria 1969
294 Ga0495607_0095114 3300046501 Bacteria 1606
295 Ga0495583_0060370 3300046506 Bacteria 1695
296 Ga0495583_0095732 3300046506 Bacteria 1273
297 Ga0495583_0171396 3300046506 Bacteria 891
298 Ga0495606_0013342 3300046507 Bacteria 6502
299 Ga0495608_0528453 3300046511 Bacteria 712
300 Ga0495610_0012935 3300046512 Bacteria 4988
301 Ga0495616_0002920 3300046513 Bacteria 11131
302 Ga0495616_0334252 3300046513 Bacteria 634
303 Ga0495618_0041048 3300046514 Bacteria 2913
304 Ga0495618_0118360 3300046514 Bacteria 1696
305 Ga0495620_0005708 3300046515 Bacteria 6928
306 Ga0495620_0021552 3300046515 Bacteria 3127
307 Ga0495620_0057291 3300046515 Bacteria 1636
308 Ga0495628_0006091 3300046516 Bacteria 10548
309 Ga0495628_0037203 3300046516 Bacteria 3902
310 Ga0495628_0287576 3300046516 Bacteria 1219
311 Ga0495630_0076146 3300046517 Bacteria 2528
312 Ga0495630_0140144 3300046517 Bacteria 1839
313 Ga0495631_0005953 3300046518 Bacteria 6343
314 Ga0495631_0150477 3300046518 Bacteria 999
315 Ga0495632_0025647 3300046519 Bacteria 3115
316 Ga0495632_0169047 3300046519 Bacteria 1005
317 Ga0495637_0131564 3300046520 Bacteria 955
318 Ga0495643_0008008 3300046522 Bacteria 6738
319 Ga0495643_0008270 3300046522 Bacteria 6606
320 Ga0495644_0114281 3300046523 Bacteria 1025
321 Ga0495648_0104392 3300046524 Bacteria 1556
322 Ga0495648_0219270 3300046524 Bacteria 939
323 Ga0495648_0267686 3300046524 Bacteria 816
324 Ga0495666_0086076 3300046526 Bacteria 1484
325 Ga0495666_0488619 3300046526 Bacteria 550
326 Ga0495642_0076710 3300046528 Bacteria 1403
327 Ga0495642_0204514 3300046528 Bacteria 861
328 Ga0495652_0002292 3300046529 Bacteria 19970
329 Ga0495652_0018776 3300046529 Bacteria 6162
330 Ga0495652_0226270 3300046529 Bacteria 1402
331 Ga0495652_0690736 3300046529 Bacteria 687
332 Ga0495654_0039808 3300046530 Bacteria 2345
333 Ga0495640_0005132 3300046533 Bacteria 10410
334 Ga0495640_0170785 3300046533 Bacteria 1389
335 Ga0495586_0041897 3300046535 Bacteria 2466
336 Ga0495586_0114791 3300046535 Bacteria 1501
337 Ga0495609_0014264 3300046538 Bacteria 3740
338 Ga0495609_0037075 3300046538 Bacteria 2200
339 Ga0495597_0065595 3300046542 Bacteria 1574
340 Ga0495645_0017508 3300046543 Bacteria 5133
341 Ga0495645_0156268 3300046543 Bacteria 1580
342 Ga0495622_0007310 3300046557 Bacteria 5127
343 Ga0495622_0024271 3300046557 Bacteria 2831
344 Ga0495633_0033065 3300046558 Bacteria 2495
345 Ga0495667_0144260 3300046559 Bacteria 1534
346 Ga0495667_0229274 3300046559 Bacteria 1184
347 Ga0495656_0553821 3300046615 Bacteria 613
348 Ga0495668_0017571 3300046616 Bacteria 4145
349 Ga0495668_0024591 3300046616 Bacteria 3425
350 Ga0495634_0027789 3300046642 Bacteria 3933
351 Ga0495634_0036930 3300046642 Bacteria 3339
352 Ga0495611_0047056 3300046648 Bacteria 1935
353 Ga0495611_0228764 3300046648 Bacteria 864
354 Ga0495625_0027694 3300046660 Bacteria 4259
355 Ga0495625_0043869 3300046660 Bacteria 3240
356 Ga0495625_0139786 3300046660 Bacteria 1634
357 Ga0495625_0174059 3300046660 Bacteria 1435
358 Ga0495625_0411778 3300046660 Bacteria 842
359 Ga0495635_0000602 3300046663 Bacteria 23157
360 Ga0495635_0205053 3300046663 Bacteria 1337
361 Ga0495635_0224614 3300046663 Bacteria 1269
362 Ga0495661_0012661 3300046665 Bacteria 5693
363 Ga0495661_0123762 3300046665 Bacteria 1425
364 Ga0495588_0001017 3300046674 Bacteria 12195
365 Ga0495588_0001932 3300046674 Bacteria 8853
366 Ga0495588_0080786 3300046674 Bacteria 1697
367 Ga0495588_0393200 3300046674 Bacteria 728
368 Ga0495657_0002328 3300046675 Bacteria 15995
369 Ga0495657_0029544 3300046675 Bacteria 3844
370 Ga0495657_0072892 3300046675 Bacteria 2238
371 Ga0495657_0289018 3300046675 Bacteria 979
372 Ga0495623_0513047 3300046679 Bacteria 631
373 Ga0495646_0000580 3300046680 Bacteria 19850
374 Ga0495646_0063836 3300046680 Bacteria 2185
375 Ga0495658_0087961 3300046683 Bacteria 1835
376 Ga0495658_0103622 3300046683 Bacteria 1702
377 Ga0495613_0001160 3300046689 Bacteria 20120
378 Ga0495613_0004327 3300046689 Bacteria 10633
379 Ga0495613_0017915 3300046689 Bacteria 5280
380 Ga0495613_0208155 3300046689 Bacteria 1376
381 Ga0495613_0254240 3300046689 Bacteria 1225
382 Ga0495613_0391034 3300046689 Bacteria 950
383 Ga0495613_0452794 3300046689 Bacteria 869
384 Ga0495613_0644312 3300046689 Bacteria 701
385 Ga0495624_0124203 3300046690 Bacteria 1584
386 Ga0495624_0432879 3300046690 Bacteria 788
387 Ga0495670_0000768 3300046691 Bacteria 15390
388 Ga0495670_0066409 3300046691 Bacteria 1820
389 Ga0495670_0106878 3300046691 Bacteria 1446
390 Ga0495670_0452614 3300046691 Bacteria 695
391 Ga0495671_0007931 3300046692 Bacteria 6007
392 Ga0495671_0058976 3300046692 Bacteria 1898
393 Ga0495671_0178769 3300046692 Bacteria 1031
394 Ga0495649_0024808 3300046694 Bacteria 3343
395 Ga0495649_0041202 3300046694 Bacteria 2526
396 Ga0495649_0174306 3300046694 Bacteria 1124
397 Ga0495589_0010936 3300046794 Bacteria 4714
398 Ga0495589_0015889 3300046794 Bacteria 3870
399 Ga0495589_0072839 3300046794 Bacteria 1677
400 Ga0495589_0110063 3300046794 Bacteria 1330
401 Ga0495589_0119531 3300046794 Bacteria 1269
402 Ga0495589_0121734 3300046794 Bacteria 1256
403 Ga0495600_0004676 3300046809 Bacteria 8205
404 Ga0495600_0191492 3300046809 Bacteria 1315
405 Ga0495600_0268036 3300046809 Bacteria 1083
406 Ga0495660_0025579 3300046810 Bacteria 3351
407 Ga0495660_0116713 3300046810 Bacteria 1355
408 Ga0495660_0123697 3300046810 Bacteria 1305
409 Ga0495581_0017554 3300047315 Bacteria 4156
410 Ga0495581_0038486 3300047315 Bacteria 2768
411 Ga0495581_0340649 3300047315 Bacteria 875
412 Ga0495581_0387340 3300047315 Bacteria 816
413 Ga0495581_0389546 3300047315 Bacteria 813
414 Ga0495604_0000226 3300047317 Bacteria 50983
415 Ga0495604_0002227 3300047317 Bacteria 15528
416 Ga0495604_0017363 3300047317 Bacteria 5760
417 Ga0495604_0073508 3300047317 Bacteria 2580
418 Ga0495604_0206185 3300047317 Bacteria 1360
419 Ga0495604_0409596 3300047317 Bacteria 892
420 Ga0495636_0004207 3300047318 Bacteria 5653
421 Ga0495636_0036488 3300047318 Bacteria 2028
422 Ga0495636_0041026 3300047318 Bacteria 1920
423 Ga0495636_0063937 3300047318 Bacteria 1560
424 Ga0495636_0296473 3300047318 Bacteria 756
425 Ga0495674_0041092 3300047319 Bacteria 4133
426 Ga0495674_0296435 3300047319 Bacteria 1321
427 Ga0495676_0002383 3300047321 Bacteria 16681
428 Ga0495676_0010778 3300047321 Bacteria 8272
429 Ga0495676_0016617 3300047321 Bacteria 6521
430 Ga0495676_0018192 3300047321 Bacteria 6198
431 Ga0495676_0024429 3300047321 Bacteria 5231
432 Ga0495676_0060795 3300047321 Bacteria 2958
433 Ga0495676_0114621 3300047321 Bacteria 1971
434 Ga0495676_0337533 3300047321 Bacteria 1009
435 Ga0495676_0950478 3300047321 Bacteria 549
436 Ga0495676_0991646 3300047321 Bacteria 536
437 Ga0495680_0014470 3300047322 Bacteria 6831
438 Ga0495683_0012497 3300047323 Bacteria 4456
439 Ga0495683_0069893 3300047323 Bacteria 1725
440 Ga0495683_0162249 3300047323 Bacteria 1033
441 Ga0495683_0428736 3300047323 Bacteria 545
442 Ga0495687_004621 3300047443 Bacteria 9199
443 Ga0495687_009644 3300047443 Bacteria 5375
444 Ga0495687_019701 3300047443 Bacteria 3302
445 Ga0495687_028005 3300047443 Bacteria 2627
446 Ga0495687_029674 3300047443 Bacteria 2526
447 Ga0495687_059001 3300047443 Bacteria 1590
448 Ga0495687_097942 3300047443 Bacteria 1107
449 Ga0495675_0031721 3300047444 Bacteria 3373
450 Ga0495675_0043171 3300047444 Bacteria 2873
451 Ga0495675_0044461 3300047444 Bacteria 2829
452 Ga0495675_0101791 3300047444 Bacteria 1797
453 Ga0495677_0040808 3300047445 Bacteria 1697
454 Ga0495677_0319884 3300047445 Bacteria 611
455 Ga0495679_116447 3300047446 Bacteria 733
456 Ga0495685_000778 3300047447 Bacteria 9737
457 Ga0495685_004500 3300047447 Bacteria 4509
458 Ga0495685_008344 3300047447 Bacteria 3438
459 Ga0495685_014206 3300047447 Bacteria 2705
460 Ga0495685_017916 3300047447 Bacteria 2427
461 Ga0495685_033159 3300047447 Bacteria 1774
462 Ga0495685_081222 3300047447 Bacteria 1079
463 Ga0495673_0158595 3300047469 Bacteria 870
464 Ga0495681_0004063 3300047470 Bacteria 10066
465 Ga0495681_0009575 3300047470 Bacteria 5951
466 Ga0495681_0049976 3300047470 Bacteria 1974
467 Ga0495681_0074063 3300047470 Bacteria 1536
468 Ga0495681_0123531 3300047470 Bacteria 1108
469 Ga0495684_0101024 3300047471 Bacteria 2181
470 Ga0495686_0014932 3300047472 Bacteria 5327
471 Ga0495686_0054549 3300047472 Bacteria 2502
472 Ga0495686_0124692 3300047472 Bacteria 1532
473 Ga0495593_0003706 3300047673 Bacteria 9125
474 Ga0495593_0034713 3300047673 Bacteria 2741
475 Ga0495593_0275466 3300047673 Bacteria 842
476 Ga0495602_0018549 3300048088 Bacteria 6943
477 Ga0495602_0632923 3300048088 Bacteria 732
478 Ga0495614_0000762 3300048089 Bacteria 13654
479 Ga0495614_0032643 3300048089 Bacteria 2240
480 Ga0495614_0052465 3300048089 Bacteria 1747
481 Ga0495614_0113128 3300048089 Bacteria 1192
482 Ga0495614_0131186 3300048089 Bacteria 1109
483 Ga0495626_0013046 3300048091 Bacteria 4333
484 Ga0496100_0551341 3300048903 Bacteria 892
485 Ga0496102_0258527 3300048905 Bacteria 1642
486 Ga0496109_0027221 3300048912 Bacteria 5103
487 Ga0496110_0187678 3300048913 Bacteria 1877
488 Ga0496113_0813276 3300048916 Bacteria 742
489 Ga0496113_0886114 3300048916 Bacteria 706
490 Ga0496124_0798252 3300048927 Bacteria 585
491 Ga0495678_043912 3300049459 Bacteria 1771
492 Ga0495682_0140059 3300049460 Bacteria 864
493 Ga0501031_0028807 3300049568 Bacteria 3619
494 Ga0501031_0047522 3300049568 Bacteria 2798
495 Ga0501031_0048382 3300049568 Bacteria 2771
496 Ga0501031_0100282 3300049568 Bacteria 1889
497 Ga0501031_0162913 3300049568 Bacteria 1458
498 Ga0501031_0591754 3300049568 Bacteria 714
499 Ga0501031_0663043 3300049568 Bacteria 670
500 Ga0501032_0004893 3300049569 Bacteria 10026
501 Ga0501032_0019445 3300049569 Bacteria 4752
502 Ga0501032_0019559 3300049569 Bacteria 4735
503 Ga0501032_0031825 3300049569 Bacteria 3616
504 Ga0501032_0046785 3300049569 Bacteria 2923
505 Ga0501033_0002071 3300049570 Bacteria 17426
506 Ga0501033_0012983 3300049570 Bacteria 6353
507 Ga0501033_0140986 3300049570 Bacteria 1742
508 Ga0501033_0203535 3300049570 Bacteria 1413
509 Ga0501033_0454388 3300049570 Bacteria 889
510 Ga0501033_0630213 3300049570 Bacteria 733
511 Ga0501034_0007488 3300049571 Bacteria 11611
512 Ga0501034_0027409 3300049571 Bacteria 5794
513 Ga0501034_0027444 3300049571 Bacteria 5791
514 Ga0501034_0104840 3300049571 Bacteria 2820
515 Ga0501034_0160144 3300049571 Bacteria 2222
516 Ga0501034_0240338 3300049571 Bacteria 1757
517 Ga0501034_1252451 3300049571 Bacteria 619
518 Ga0501036_0029018 3300049572 Bacteria 4676
519 Ga0501036_0071114 3300049572 Bacteria 2941
520 Ga0501036_0110506 3300049572 Bacteria 2322
521 Ga0501036_0152940 3300049572 Bacteria 1946
522 Ga0501037_0008710 3300049573 Bacteria 7436
523 Ga0501037_0037533 3300049573 Bacteria 3572
524 Ga0501037_0041679 3300049573 Bacteria 3376
525 Ga0501037_0051209 3300049573 Bacteria 3020
526 Ga0501037_0261434 3300049573 Bacteria 1209
527 Ga0501037_0304226 3300049573 Bacteria 1106
528 Ga0501038_0004798 3300049574 Bacteria 12563
529 Ga0501038_0010841 3300049574 Bacteria 8328
530 Ga0501038_0054508 3300049574 Bacteria 3439
531 Ga0501038_0068534 3300049574 Bacteria 3015
532 Ga0501038_0270448 3300049574 Bacteria 1340
533 Ga0501038_0554041 3300049574 Bacteria 874
534 Ga0501038_0752872 3300049574 Bacteria 726
535 Ga0501039_0008768 3300049575 Bacteria 7705
536 Ga0501039_0123269 3300049575 Bacteria 2031
537 Ga0501039_0512505 3300049575 Bacteria 942
538 Ga0501039_0515784 3300049575 Bacteria 938
539 Ga0501040_0032809 3300049576 Bacteria 3514
540 Ga0501041_0016821 3300049577 Bacteria 4352
541 Ga0501042_0046275 3300049578 Bacteria 3101
542 Ga0501042_0437498 3300049578 Bacteria 948
543 Ga0501042_0734049 3300049578 Bacteria 718
544 Ga0501043_0006511 3300049579 Bacteria 9370
545 Ga0501043_0008928 3300049579 Bacteria 7890
546 Ga0501043_0027864 3300049579 Bacteria 4434
547 Ga0501043_0065798 3300049579 Bacteria 2846
548 Ga0501043_0142473 3300049579 Bacteria 1876
549 Ga0501043_0190454 3300049579 Bacteria 1595
550 Ga0501043_0475831 3300049579 Bacteria 936
551 Ga0501046_0111282 3300049580 Bacteria 2091
552 Ga0501046_0134751 3300049580 Bacteria 1871
553 Ga0501047_0002783 3300049581 Bacteria 16617
554 Ga0501047_0011970 3300049581 Bacteria 8209
555 Ga0501047_0030243 3300049581 Bacteria 5221
556 Ga0501047_0033911 3300049581 Bacteria 4927
557 Ga0501047_0118676 3300049581 Bacteria 2527
558 Ga0501047_0169834 3300049581 Bacteria 2050
559 Ga0501047_0189979 3300049581 Bacteria 1917
560 Ga0501047_0255805 3300049581 Bacteria 1599
561 Ga0501047_0490974 3300049581 Bacteria 1055
562 Ga0501048_0035095 3300049582 Bacteria 3612
563 Ga0501048_0037511 3300049582 Bacteria 3480
564 Ga0501067_0010603 3300049583 Bacteria 5099
565 Ga0501068_0074920 3300049584 Bacteria 2069
566 Ga0501069_0004549 3300049585 Bacteria 7170
567 Ga0501070_0049737 3300049586 Bacteria 3480
568 Ga0501070_0183686 3300049586 Bacteria 1720
569 Ga0501070_0213894 3300049586 Bacteria 1582
570 Ga0501070_1324685 3300049586 Bacteria 549
571 Ga0501071_0013450 3300049587 Bacteria 5577
572 Ga0501072_0005819 3300049588 Bacteria 9390
573 Ga0501073_0009815 3300049589 Bacteria 7045
574 Ga0501073_0125795 3300049589 Bacteria 1777
575 Ga0501074_0325926 3300049590 Bacteria 1090
576 Ga0501077_0054792 3300049593 Bacteria 2532
577 Ga0501079_0008914 3300049741 Bacteria 7595
578 Ga0501080_0043441 3300049742 Bacteria 4185
579 Ga0501080_0046620 3300049742 Bacteria 4034
580 Ga0501083_0007078 3300049744 Bacteria 7962
581 Ga0501035_0035114 3300049822 Bacteria 4551
582 Ga0501035_0048356 3300049822 Bacteria 3815
583 Ga0501035_0179042 3300049822 Bacteria 1827
584 Ga0501035_0227105 3300049822 Bacteria 1592
585 Ga0501035_0250020 3300049822 Bacteria 1506
586 Ga0501035_0334895 3300049822 Bacteria 1269
587 Ga0501035_0602242 3300049822 Bacteria 895
588 Ga0501044_0010468 3300049823 Bacteria 10063
589 Ga0501044_0011729 3300049823 Bacteria 9492
590 Ga0501044_0011825 3300049823 Bacteria 9456
591 Ga0501044_0045099 3300049823 Bacteria 4571
592 Ga0501044_0064552 3300049823 Bacteria 3737
593 Ga0501044_0078050 3300049823 Bacteria 3356
594 Ga0501044_0122272 3300049823 Bacteria 2602
595 Ga0501044_0174836 3300049823 Bacteria 2117
596 Ga0501044_0186816 3300049823 Bacteria 2036
597 Ga0501044_0448254 3300049823 Bacteria 1197
598 Ga0501044_0509651 3300049823 Bacteria 1103
599 Ga0501045_0017787 3300049824 Bacteria 5048
600 Ga0501045_0118231 3300049824 Bacteria 1967
601 Ga0501045_0174387 3300049824 Bacteria 1602
602 nmdc:mga03n38_14218_c1 3300050490 Bacteria 3044
603 nmdc:mga03n38_166880_c1 3300050490 Bacteria 1118
604 nmdc:mga06z11_12423_c1 3300050494 Bacteria 3704
605 nmdc:mga07m45_152927_c1 3300050496 Bacteria 1338
606 Ga0495601_0190628 3300053077 Bacteria 1340
607 Ga0500578_0074757 3300053086 Bacteria 2158
608 Ga0500578_0101155 3300053086 Bacteria 1824
609 Ga0500643_157121 3300053087 Bacteria 610
610 Ga0500583_0138571 3300053092 Bacteria 1208
611 Ga0500566_0186833 3300053094 Bacteria 1058
612 Ga0500640_020336 3300053095 Bacteria 2852
613 Ga0500641_0203838 3300053096 Bacteria 843
614 Ga0500641_0313674 3300053096 Bacteria 640
615 Ga0500654_129155 3300053099 Bacteria 963
616 Ga0500660_144907 3300053100 Bacteria 935
617 Ga0500553_214185 3300053101 Bacteria 638
618 Ga0500556_0180274 3300053104 Bacteria 835
619 Ga0500557_178373 3300053105 Bacteria 691
620 Ga0500560_003059 3300053107 Bacteria 3317
621 Ga0500560_004466 3300053107 Bacteria 2981
622 Ga0500560_035928 3300053107 Bacteria 1528
623 Ga0500569_084559 3300053109 Bacteria 1019
624 Ga0500572_046699 3300053111 Bacteria 1277
625 Ga0500614_066134 3300053123 Bacteria 982
626 Ga0500614_100091 3300053123 Bacteria 835
627 Ga0500628_091356 3300053129 Bacteria 793
628 Ga0500652_050659 3300053131 Bacteria 1694
629 Ga0500658_0014745 3300053134 Bacteria 2894
630 Ga0500561_0102750 3300053137 Bacteria 857
631 Ga0500568_0267803 3300053139 Bacteria 621
632 Ga0500573_0033239 3300053140 Bacteria 2977
633 Ga0500573_0052189 3300053140 Bacteria 2351
634 Ga0500573_0306925 3300053140 Bacteria 790
635 Ga0500588_0080447 3300053146 Bacteria 1089
636 Ga0500589_325700 3300053147 Bacteria 535
637 Ga0500600_0004613 3300053149 Bacteria 8101
638 Ga0500600_0122439 3300053149 Bacteria 1338
639 Ga0500616_0012533 3300053153 Bacteria 4958
640 Ga0500633_0019571 3300053160 Bacteria 2026
641 Ga0500633_0118032 3300053160 Bacteria 986
642 Ga0500634_0096496 3300053161 Bacteria 1488
643 Ga0500636_0304403 3300053177 Bacteria 783
644 Ga0500656_008315 3300053732 Bacteria 1098
645 Ga0500587_012775 3300053739 Bacteria 1058
646 Ga0501084_0006017 3300054114 Bacteria 9975
647 Ga0501082_0174901 3300060353 Bacteria 1867
648 Ga0466962_0000163 3300061719 Bacteria 28323
649 Ga0466962_0011589 3300061719 Bacteria 4246
650 Ga0466962_0249241 3300061719 Bacteria 872
651 Ga0530510_0296286 3300061734 Bacteria 1210
652 2862294501 2862290372 Bacteria 7471434
653 2547405984 2547132111 Bacteria 8013147
654 2585300259 2582581312 Bacteria 7308206
655 2585311016 2582581313 Bacteria 10042643
656 2585314449 2582581314 Bacteria 11452267
657 2616700252 2616644814 Bacteria 11555299
658 2643763057 2643221548 Bacteria 8053412
659 2643900037 2643221578 Bacteria 9213798
660 2644262970 2643221647 Bacteria 10741251
661 2644405739 2643221673 Bacteria 9196637
662 2644443193 2643221678 Bacteria 9540101
663 2644464085 2643221682 Bacteria 6743283
664 2644626992 2643221714 Bacteria 9015452
665 2768646205 2767802112 Bacteria 6465194
666 2784588922 2784132148 Bacteria 8627943
667 2785369872 2784746768 Bacteria 10036182
668 2786670952 2786546132 Bacteria 10419719
669 2793980905 2791355406 Bacteria 11364898
670 2808842366 2808606359 Bacteria 9866990
671 2808920890 2808606375 Bacteria 9466072
672 2809232541 2808606448 Bacteria 8656184
673 2812357736 2811994879 Bacteria 9313447
674 2812480223 2811994917 Bacteria 7761064
675 2819697219 2818991463 Bacteria 7948711
676 2852637141 2852635781 Bacteria 8251373
677 2862285988 2862281513 Bacteria 9621493
678 2862389625 2862382967 Bacteria 10317375
679 2862508027 2862507626 Bacteria 9425308
680 2862578925 2862574272 Bacteria 10567477
681 2862709410 2862705112 Bacteria 6563286
682 2863404226 2863404153 Bacteria 9672205
683 2867350585 2867346516 Bacteria 7608576
684 2867370525 2867369537 Bacteria 6501581
685 2867433671 2867428634 Bacteria 9590268
686 2867481258 2867475112 Bacteria 6909112
687 2875395277 2875391855 Bacteria 7600475
688 2877680759 2877676314 Bacteria 9512378
689 2912719496 2912715099 Bacteria 9460473
690 2912731346 2912723979 Bacteria 8557534
691 2912761186 2912757875 Bacteria 7940295
692 2919450529 2919446982 Bacteria 3994487
693 2919471957 2919468124 Bacteria 9133025
694 2946049612 2946045630 Bacteria 8527308
695 2946068135 2946064051 Bacteria 8957905
696 2946076225 2946072368 Bacteria 8999607
697 2947228804 2947224130 Bacteria 9938529
698 2954006731 2954002825 Bacteria 9173742
699 2954385865 2954380949 Bacteria 10050426
700 2954677278 2954673503 Bacteria 9685905
701 2954686874 2954682443 Bacteria 9862841
702 2954696524 2954691527 Bacteria 10720516
703 2954705762 2954701450 Bacteria 10834262
704 2954715886 2954711539 Bacteria 10867210
705 2954725808 2954721474 Bacteria 10456478
706 2954735994 2954731030 Bacteria 10243860
707 2954744763 2954740390 Bacteria 10229294
708 2954754836 2954749733 Bacteria 10366972
709 2954763725 2954759201 Bacteria 9358192
710 2966602031 2966598605 Bacteria 7676064
711 2984576915 2984576629 Bacteria 4248407
712 2990049137 2990044586 Bacteria 6603797
713 2990064994 2990059506 Bacteria 9321252
714 2990092272 2990088156 Bacteria 6657676
715 2990258662 2990256926 Bacteria 4252839
716 2997606688 2997600082 Bacteria 9896405
717 3006325610 3006321560 Bacteria 8247479
718 3006397422 3006393351 Bacteria 6615579
719 3006499308 3006493962 Bacteria 8825450
720 8008489956 8008485437 Bacteria 7198341
721 8008566921 8008558824 Bacteria 10610750
722 8008578592 8008574985 Bacteria 7815457
723 8023624051 8023623736 Bacteria 8593882
724 8025529311 8025524527 Bacteria 7197316
725 8025534277 8025530807 Bacteria 8495698
726 8033689086 8033684223 Bacteria 6906479
727 8047899714 8047893842 Bacteria 11723082
728 8048129004 8048127548 Bacteria 11053136
729 8048359217 8048356638 Bacteria 11044339
730 8048376662 8048369669 Bacteria 11666822
731 8048385715 8048379754 Bacteria 11877923
732 8048409467 8048406513 Bacteria 8936924
733 8054163569 8054160619 Bacteria 7783213
734 8054610322 8054609563 Bacteria 5170090
735 8056210357 8056207758 Bacteria 8639239
736 8056833347 8056829672 Bacteria 9045328
737 JGI24739J22299_10022997
738 JGI24737J22298_10070152
739 JGI24735J21928_10045118
740 JGI24738J21930_10047408
741 JGI25153J46596_10049885
742 rootH1_10033732
743 rootH1_10033733
744 rootL2_10041240
745 rootL2_10210732
746 rootH1_10123303
747 rootH1_10152422
748 JGI25160J50197_1047075
749 Ga0006562J51391_1050546
750 Ga0006562J51391_1050549
751 Ga0006562J51391_1061896
752 Ga0070659_100618232
753 Ga0070678_100978085
754 Ga0070681_10359612
755 Ga0068853_100104923
756 Ga0068853_101139383
757 Ga0070665_100304078
758 Ga0070665_100330676
759 Ga0068855_100023062
760 Ga0070664_100072581
761 Ga0068857_100269982
762 Ga0068856_100010663
763 Ga0068856_100415826
764 Ga0070702_100991800
765 Ga0068852_100001014
766 Ga0081455_10365355
767 Ga0075363_100076247
768 Ga0075363_100087882
769 Ga0075363_100201209
770 Ga0075370_10084253
771 Ga0099826_10388104
772 Ga0105250_10175887
773 Ga0105240_10076356
774 Ga0105240_10907819
775 Ga0105245_10241199
776 Ga0105245_10328955
777 Ga0105243_10956558
778 Ga0105243_12657826
779 Ga0105241_10001341
780 Ga0105242_10517223
781 Ga0105248_10106466
782 Ga0105238_10709397
783 Ga0105249_11659376
784 Ga0105239_10014936
785 Ga0105239_11253092
786 Ga0105239_11323169
787 Ga0105239_11665290
788 Ga0105239_12481449
789 Ga0105246_10000030
790 Ga0105246_10135778
791 Ga0105246_10476239
792 Ga0157369_10065387
793 Ga0157374_10365857
794 Ga0157372_10102885
795 Ga0157375_12561578
796 Ga0157380_10600838
797 Ga0182008_10002267
798 Ga0157376_10944088
799 Ga0182007_10004465
800 Ga0183367_1008
801 Ga0224712_10045281
802 Ga0224712_10241416
803 Ga0209758_1008765
804 Ga0207426_1001637
805 Ga0207426_1003477
806 Ga0207426_1004228
807 Ga0207426_1010421
808 Ga0207426_1018541
809 Ga0207680_10540608
810 Ga0207647_10015752
811 Ga0207654_10009813
812 Ga0207695_10004099
813 Ga0207671_10000128
814 Ga0207694_10207057
815 Ga0207687_10049131
816 Ga0207687_10076420
817 Ga0207706_10090638
818 Ga0207709_10962978
819 Ga0207711_10279927
820 Ga0207679_10025198
821 Ga0207667_10055281
822 Ga0207640_10379866
823 Ga0207703_10277085
824 Ga0207639_10085880
825 Ga0207639_10176724
826 Ga0207678_10023248
827 Ga0207708_10312671
828 Ga0207702_10249966
829 Ga0207702_10269079
830 Ga0207674_10947892
831 Ga0207675_100068085
832 Ga0207683_11356060
833 Ga0207698_10349870
834 Ga0209371_1013135
835 Ga0209282_1270904
836 Ga0209813_10024039
837 Ga0268266_10179042
838 Ga0268266_10279799
839 Ga0268266_11488576
840 Ga0307515_10000928
841 Ga0307515_10437980
842 Ga0307515_10581538
843 Ga0268256_1014405
844 Ga0307511_10000945
845 Ga0307511_10057234
846 Ga0307511_10205780
847 Ga0307511_10248197
848 Ga0307512_10012951
849 Ga0307512_10240452
850 Ga0316181_1127688
851 Ga0307513_10003927
852 Ga0307513_10072221
853 Ga0307513_10116156
854 Ga0307509_10022630
855 Ga0307509_10076738
856 Ga0307509_10252668
857 Ga0307509_10605991
858 Ga0307408_102085221
859 Ga0307508_10002378
860 Ga0307508_10022735
861 Ga0307508_10047622
862 Ga0307508_10077737
863 Ga0307508_10079919
864 Ga0307508_10198007
865 Ga0307508_10724499
866 Ga0307514_10018627
867 Ga0307514_10208235
868 Ga0307514_10238643
869 Ga0307514_10345239
870 Ga0307514_10349345
871 Ga0307514_10356189
872 Ga0316575_10051119
873 Ga0307516_10006477
874 Ga0307516_10144310
875 Ga0307516_10240442
876 Ga0307516_10356750
877 Ga0307518_10058932
878 Ga0307518_10175432
879 Ga0307518_10271488
880 Ga0307410_10067358
881 Ga0307410_10275437
882 Ga0307409_100037687
883 Ga0307409_100119570
884 Ga0307416_101709543
885 Ga0307411_10634545
886 Ga0307507_10017128
887 Ga0307507_10028020
888 Ga0307510_10041179
889 Ga0307510_10085353
890 Ga0307510_10121601
891 Ga0307510_10219680
892 Ga0307510_10494631
893 Ga0395899_0261655
894 Ga0395899_0580091
895 Ga0395900_0179671
896 Ga0395900_0424277
897 Ga0395898_0001397
898 Ga0395898_0003880
899 Ga0395898_0073658
900 Ga0395905_0365510
901 Ga0395901_0078391
902 Ga0395901_0096424
903 Ga0395901_0105186
904 Ga0439436_0003058
905 Ga0439436_0004048
906 Ga0439439_0008564
907 Ga0439439_0066166
908 Ga0451789_1138150
909 Ga0451797_0889241
910 Ga0451807_2473932
911 Ga0451837_0989560
912 Ga0451841_0983366
913 Ga0451847_0832006
914 Ga0451851_0290026
915 Ga0451851_1377664
916 Ga0451853_0777276
917 Ga0451853_2561483
918 Ga0439433_0000565
919 Ga0439433_0023848
920 Ga0439442_009075
921 Ga0439442_011672
922 Ga0439448_0002231
923 Ga0439432_021300
924 Ga0439449_0000841
925 Ga0439449_0084120
926 Ga0439457_001497
927 Ga0439462_0000959
928 Ga0450890_010016
929 Ga0450894_000065
930 Ga0450895_005044
931 Ga0450896_001817
932 Ga0450898_005535
933 Ga0450899_000511
934 Ga0450900_004000
935 Ga0450903_000670
936 Ga0450904_013758
937 Ga0450906_000844
938 Ga0439458_0000517
939 Ga0450908_032289
940 Ga0439464_0012340
941 Ga0466969_0005631
942 Ga0466969_0073532
943 Ga0466972_0001060
944 Ga0466972_0069299
945 Ga0466972_0081032
946 Ga0466972_0295908
947 Ga0466965_0000312
948 Ga0466965_0014405
949 Ga0466965_0241500
950 Ga0466966_0001162
951 Ga0466966_0002783
952 Ga0466961_0002591
953 Ga0466961_0005840
954 Ga0466961_0034399
955 Ga0466961_0035125
956 Ga0466961_0062799
957 Ga0466963_0003115
958 Ga0466963_0165305
959 Ga0466964_0008956
960 Ga0466964_0039907
961 Ga0466964_0392880
962 Ga0466971_0000277
963 Ga0466971_0015939
964 Ga0466968_0087204
965 Ga0466970_0000443
966 Ga0466970_0006602
967 Ga0466970_0016652
968 Ga0466970_0057196
969 Ga0466957_0001357
970 Ga0466960_0266483
971 Ga0466959_0019009
972 Ga0466958_0118783
973 Ga0466958_0136775
974 Ga0466967_0004534
975 Ga0466967_0006993
976 Ga0466967_0016389
977 Ga0466967_0030987
978 Ga0466967_0210293
979 Ga0466967_0883424
980 Ga0495617_007941
981 Ga0495627_099664
982 Ga0495592_0009032
983 Ga0495592_0086204
984 Ga0495592_0159822
985 Ga0495603_0000701
986 Ga0495603_0002941
987 Ga0495603_0004561
988 Ga0495603_0007883
989 Ga0495603_0025037
990 Ga0495603_0046323
991 Ga0495603_0627013
992 Ga0495629_0000808
993 Ga0495629_0008474
994 Ga0495629_0013998
995 Ga0495629_0015401
996 Ga0495629_0016632
997 Ga0495629_0030931
998 Ga0495629_0085598
999 Ga0495629_0137419
1000 Ga0495629_0317301
1001 Ga0495638_0110084
1002 Ga0495638_0175704
1003 Ga0495638_0249774
1004 Ga0495641_0186225
1005 Ga0495641_0314772
1006 Ga0495651_0001478
1007 Ga0495651_0101094
1008 Ga0495605_0005776
1009 Ga0495605_0028277
1010 Ga0495662_0000395
1011 Ga0495662_0009266
1012 Ga0495662_0049855
1013 Ga0495664_0004484
1014 Ga0495664_0061773
1015 Ga0495585_0007936
1016 Ga0495585_0088060
1017 Ga0495585_0164620
1018 Ga0495585_0281423
1019 Ga0495594_0005254
1020 Ga0495594_0012424
1021 Ga0495594_0016252
1022 Ga0495594_0033179
1023 Ga0495594_0069923
1024 Ga0495594_0132329
1025 Ga0495594_0231446
1026 Ga0495594_0284825
1027 Ga0495596_0049344
1028 Ga0495607_0069566
1029 Ga0495607_0095114
1030 Ga0495583_0060370
1031 Ga0495583_0095732
1032 Ga0495583_0171396
1033 Ga0495606_0013342
1034 Ga0495608_0528453
1035 Ga0495610_0012935
1036 Ga0495616_0002920
1037 Ga0495616_0334252
1038 Ga0495618_0041048
1039 Ga0495618_0118360
1040 Ga0495620_0005708
1041 Ga0495620_0021552
1042 Ga0495620_0057291
1043 Ga0495628_0006091
1044 Ga0495628_0037203
1045 Ga0495628_0287576
1046 Ga0495630_0076146
1047 Ga0495630_0140144
1048 Ga0495631_0005953
1049 Ga0495631_0150477
1050 Ga0495632_0025647
1051 Ga0495632_0169047
1052 Ga0495637_0131564
1053 Ga0495643_0008008
1054 Ga0495643_0008270
1055 Ga0495644_0114281
1056 Ga0495648_0104392
1057 Ga0495648_0219270
1058 Ga0495648_0267686
1059 Ga0495666_0086076
1060 Ga0495666_0488619
1061 Ga0495642_0076710
1062 Ga0495642_0204514
1063 Ga0495652_0002292
1064 Ga0495652_0018776
1065 Ga0495652_0226270
1066 Ga0495652_0690736
1067 Ga0495654_0039808
1068 Ga0495640_0005132
1069 Ga0495640_0170785
1070 Ga0495586_0041897
1071 Ga0495586_0114791
1072 Ga0495609_0014264
1073 Ga0495609_0037075
1074 Ga0495597_0065595
1075 Ga0495645_0017508
1076 Ga0495645_0156268
1077 Ga0495622_0007310
1078 Ga0495622_0024271
1079 Ga0495633_0033065
1080 Ga0495667_0144260
1081 Ga0495667_0229274
1082 Ga0495656_0553821
1083 Ga0495668_0017571
1084 Ga0495668_0024591
1085 Ga0495634_0027789
1086 Ga0495634_0036930
1087 Ga0495611_0047056
1088 Ga0495611_0228764
1089 Ga0495625_0027694
1090 Ga0495625_0043869
1091 Ga0495625_0139786
1092 Ga0495625_0174059
1093 Ga0495625_0411778
1094 Ga0495635_0000602
1095 Ga0495635_0205053
1096 Ga0495635_0224614
1097 Ga0495661_0012661
1098 Ga0495661_0123762
1099 Ga0495588_0001017
1100 Ga0495588_0001932
1101 Ga0495588_0080786
1102 Ga0495588_0393200
1103 Ga0495657_0002328
1104 Ga0495657_0029544
1105 Ga0495657_0072892
1106 Ga0495657_0289018
1107 Ga0495623_0513047
1108 Ga0495646_0000580
1109 Ga0495646_0063836
1110 Ga0495658_0087961
1111 Ga0495658_0103622
1112 Ga0495613_0001160
1113 Ga0495613_0004327
1114 Ga0495613_0017915
1115 Ga0495613_0208155
1116 Ga0495613_0254240
1117 Ga0495613_0391034
1118 Ga0495613_0452794
1119 Ga0495613_0644312
1120 Ga0495624_0124203
1121 Ga0495624_0432879
1122 Ga0495670_0000768
1123 Ga0495670_0066409
1124 Ga0495670_0106878
1125 Ga0495670_0452614
1126 Ga0495671_0007931
1127 Ga0495671_0058976
1128 Ga0495671_0178769
1129 Ga0495649_0024808
1130 Ga0495649_0041202
1131 Ga0495649_0174306
1132 Ga0495589_0010936
1133 Ga0495589_0015889
1134 Ga0495589_0072839
1135 Ga0495589_0110063
1136 Ga0495589_0119531
1137 Ga0495589_0121734
1138 Ga0495600_0004676
1139 Ga0495600_0191492
1140 Ga0495600_0268036
1141 Ga0495660_0025579
1142 Ga0495660_0116713
1143 Ga0495660_0123697
1144 Ga0495581_0017554
1145 Ga0495581_0038486
1146 Ga0495581_0340649
1147 Ga0495581_0387340
1148 Ga0495581_0389546
1149 Ga0495604_0000226
1150 Ga0495604_0002227
1151 Ga0495604_0017363
1152 Ga0495604_0073508
1153 Ga0495604_0206185
1154 Ga0495604_0409596
1155 Ga0495636_0004207
1156 Ga0495636_0036488
1157 Ga0495636_0041026
1158 Ga0495636_0063937
1159 Ga0495636_0296473
1160 Ga0495674_0041092
1161 Ga0495674_0296435
1162 Ga0495676_0002383
1163 Ga0495676_0010778
1164 Ga0495676_0016617
1165 Ga0495676_0018192
1166 Ga0495676_0024429
1167 Ga0495676_0060795
1168 Ga0495676_0114621
1169 Ga0495676_0337533
1170 Ga0495676_0950478
1171 Ga0495676_0991646
1172 Ga0495680_0014470
1173 Ga0495683_0012497
1174 Ga0495683_0069893
1175 Ga0495683_0162249
1176 Ga0495683_0428736
1177 Ga0495687_004621
1178 Ga0495687_009644
1179 Ga0495687_019701
1180 Ga0495687_028005
1181 Ga0495687_029674
1182 Ga0495687_059001
1183 Ga0495687_097942
1184 Ga0495675_0031721
1185 Ga0495675_0043171
1186 Ga0495675_0044461
1187 Ga0495675_0101791
1188 Ga0495677_0040808
1189 Ga0495677_0319884
1190 Ga0495679_116447
1191 Ga0495685_000778
1192 Ga0495685_004500
1193 Ga0495685_008344
1194 Ga0495685_014206
1195 Ga0495685_017916
1196 Ga0495685_033159
1197 Ga0495685_081222
1198 Ga0495673_0158595
1199 Ga0495681_0004063
1200 Ga0495681_0009575
1201 Ga0495681_0049976
1202 Ga0495681_0074063
1203 Ga0495681_0123531
1204 Ga0495684_0101024
1205 Ga0495686_0014932
1206 Ga0495686_0054549
1207 Ga0495686_0124692
1208 Ga0495593_0003706
1209 Ga0495593_0034713
1210 Ga0495593_0275466
1211 Ga0495602_0018549
1212 Ga0495602_0632923
1213 Ga0495614_0000762
1214 Ga0495614_0032643
1215 Ga0495614_0052465
1216 Ga0495614_0113128
1217 Ga0495614_0131186
1218 Ga0495626_0013046
1219 Ga0496100_0551341
1220 Ga0496102_0258527
1221 Ga0496109_0027221
1222 Ga0496110_0187678
1223 Ga0496113_0813276
1224 Ga0496113_0886114
1225 Ga0496124_0798252
1226 Ga0495678_043912
1227 Ga0495682_0140059
1228 Ga0501031_0028807
1229 Ga0501031_0047522
1230 Ga0501031_0048382
1231 Ga0501031_0100282
1232 Ga0501031_0162913
1233 Ga0501031_0591754
1234 Ga0501031_0663043
1235 Ga0501032_0004893
1236 Ga0501032_0019445
1237 Ga0501032_0019559
1238 Ga0501032_0031825
1239 Ga0501032_0046785
1240 Ga0501033_0002071
1241 Ga0501033_0012983
1242 Ga0501033_0140986
1243 Ga0501033_0203535
1244 Ga0501033_0454388
1245 Ga0501033_0630213
1246 Ga0501034_0007488
1247 Ga0501034_0027409
1248 Ga0501034_0027444
1249 Ga0501034_0104840
1250 Ga0501034_0160144
1251 Ga0501034_0240338
1252 Ga0501034_1252451
1253 Ga0501036_0029018
1254 Ga0501036_0071114
1255 Ga0501036_0110506
1256 Ga0501036_0152940
1257 Ga0501037_0008710
1258 Ga0501037_0037533
1259 Ga0501037_0041679
1260 Ga0501037_0051209
1261 Ga0501037_0261434
1262 Ga0501037_0304226
1263 Ga0501038_0004798
1264 Ga0501038_0010841
1265 Ga0501038_0054508
1266 Ga0501038_0068534
1267 Ga0501038_0270448
1268 Ga0501038_0554041
1269 Ga0501038_0752872
1270 Ga0501039_0008768
1271 Ga0501039_0123269
1272 Ga0501039_0512505
1273 Ga0501039_0515784
1274 Ga0501040_0032809
1275 Ga0501041_0016821
1276 Ga0501042_0046275
1277 Ga0501042_0437498
1278 Ga0501042_0734049
1279 Ga0501043_0006511
1280 Ga0501043_0008928
1281 Ga0501043_0027864
1282 Ga0501043_0065798
1283 Ga0501043_0142473
1284 Ga0501043_0190454
1285 Ga0501043_0475831
1286 Ga0501046_0111282
1287 Ga0501046_0134751
1288 Ga0501047_0002783
1289 Ga0501047_0011970
1290 Ga0501047_0030243
1291 Ga0501047_0033911
1292 Ga0501047_0118676
1293 Ga0501047_0169834
1294 Ga0501047_0189979
1295 Ga0501047_0255805
1296 Ga0501047_0490974
1297 Ga0501048_0035095
1298 Ga0501048_0037511
1299 Ga0501067_0010603
1300 Ga0501068_0074920
1301 Ga0501069_0004549
1302 Ga0501070_0049737
1303 Ga0501070_0183686
1304 Ga0501070_0213894
1305 Ga0501070_1324685
1306 Ga0501071_0013450
1307 Ga0501072_0005819
1308 Ga0501073_0009815
1309 Ga0501073_0125795
1310 Ga0501074_0325926
1311 Ga0501077_0054792
1312 Ga0501079_0008914
1313 Ga0501080_0043441
1314 Ga0501080_0046620
1315 Ga0501083_0007078
1316 Ga0501035_0035114
1317 Ga0501035_0048356
1318 Ga0501035_0179042
1319 Ga0501035_0227105
1320 Ga0501035_0250020
1321 Ga0501035_0334895
1322 Ga0501035_0602242
1323 Ga0501044_0010468
1324 Ga0501044_0011729
1325 Ga0501044_0011825
1326 Ga0501044_0045099
1327 Ga0501044_0064552
1328 Ga0501044_0078050
1329 Ga0501044_0122272
1330 Ga0501044_0174836
1331 Ga0501044_0186816
1332 Ga0501044_0448254
1333 Ga0501044_0509651
1334 Ga0501045_0017787
1335 Ga0501045_0118231
1336 Ga0501045_0174387
1337 nmdc:mga03n38_14218_c1
1338 nmdc:mga03n38_166880_c1
1339 nmdc:mga06z11_12423_c1
1340 nmdc:mga07m45_152927_c1
1341 Ga0495601_0190628
1342 Ga0500578_0074757
1343 Ga0500578_0101155
1344 Ga0500643_157121
1345 Ga0500583_0138571
1346 Ga0500566_0186833
1347 Ga0500640_020336
1348 Ga0500641_0203838
1349 Ga0500641_0313674
1350 Ga0500654_129155
1351 Ga0500660_144907
1352 Ga0500553_214185
1353 Ga0500556_0180274
1354 Ga0500557_178373
1355 Ga0500560_003059
1356 Ga0500560_004466
1357 Ga0500560_035928
1358 Ga0500569_084559
1359 Ga0500572_046699
1360 Ga0500614_066134
1361 Ga0500614_100091
1362 Ga0500628_091356
1363 Ga0500652_050659
1364 Ga0500658_0014745
1365 Ga0500561_0102750
1366 Ga0500568_0267803
1367 Ga0500573_0033239
1368 Ga0500573_0052189
1369 Ga0500573_0306925
1370 Ga0500588_0080447
1371 Ga0500589_325700
1372 Ga0500600_0004613
1373 Ga0500600_0122439
1374 Ga0500616_0012533
1375 Ga0500633_0019571
1376 Ga0500633_0118032
1377 Ga0500634_0096496
1378 Ga0500636_0304403
1379 Ga0500656_008315
1380 Ga0500587_012775
1381 Ga0501084_0006017
1382 Ga0501082_0174901
1383 Ga0466962_0000163
1384 Ga0466962_0011589
1385 Ga0466962_0249241
1386 Ga0530510_0296286
1387 2862294501
1388 2547405984
1389 2585300259
1390 2585311016
1391 2585314449
1392 2616700252
1393 2643763057
1394 2643900037
1395 2644262970
1396 2644405739
1397 2644443193
1398 2644464085
1399 2644626992
1400 2768646205
1401 2784588922
1402 2785369872
1403 2786670952
1404 2793980905
1405 2808842366
1406 2808920890
1407 2809232541
1408 2812357736
1409 2812480223
1410 2819697219
1411 2852637141
1412 2862285988
1413 2862389625
1414 2862508027
1415 2862578925
1416 2862709410
1417 2863404226
1418 2867350585
1419 2867370525
1420 2867433671
1421 2867481258
1422 2875395277
1423 2877680759
1424 2912719496
1425 2912731346
1426 2912761186
1427 2919450529
1428 2919471957
1429 2946049612
1430 2946068135
1431 2946076225
1432 2947228804
1433 2954006731
1434 2954385865
1435 2954677278
1436 2954686874
1437 2954696524
1438 2954705762
1439 2954715886
1440 2954725808
1441 2954735994
1442 2954744763
1443 2954754836
1444 2954763725
1445 2966602031
1446 2984576915
1447 2990049137
1448 2990064994
1449 2990092272
1450 2990258662
1451 2997606688
1452 3006325610
1453 3006397422
1454 3006499308
1455 8008489956
1456 8008566921
1457 8008578592
1458 8023624051
1459 8025529311
1460 8025534277
1461 8033689086
1462 8047899714
1463 8048129004
1464 8048359217
1465 8048376662
1466 8048385715
1467 8048409467
1468 8054163569
1469 8054610322
1470 8056210357
1471 8056833347

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

9

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8275 24 140
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.7854 14 140
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7843 10 146
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.7834 4 143
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7778 15 140
ID Description Score Start End Superfamily
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8275 24 140 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.798 6 146 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.785 6 146 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7809 14 146 2.30.110.10
af_O07754_2_147_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7804 11 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1G9ERN7-F1-model_v4 PPOX class probable F420-dependent enzyme 0.997 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A495L8T1-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9949 1 151 GO:0005829
GO:0016627
GO:0070967
AF-A0A1I1ZE95-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9915 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A4Y3KWS0-F1-model_v4 PPOX class F420-dependent enzyme 0.9912 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A1G9ERN7-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9905 1 153 GO:0005829
GO:0016627
GO:0070967

Map