F478138

General Info

Members Datasets Scaffolds Average Seq Length
734 541 465 465

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10004443|Ga0105239_1000444317
Length 527
Sequence MISPKHSVKRTNKMQMVRVPPYQAKSYLSARTSQTSPETELMLKPIIERPDKTEAGRMKAAPSIRWALASLSLSMLMPSLDTSIANVGLPTLAEAFGASFQQVQWIVLAYLLAITALIVSVGRLGDIVGRRRLLLAGIALFTLASLFCGIAPTLWLLIAARALQGLGAAMMMALTVAMVGETVPKERTGSAMGLLGTMSAIGTTLGPSLGGVLIAGFGWETLFLVNVPLGIANFLLAARFLPVDRPNRKAGQGRPDAIGTLLLALTLAAYALAMTMGHGSFGVLNIGLLLAAAFGTALFAFTEAKVKSPLVRLTMFRDSALSVGLAMSTLVSTVMMATLVVGPFYLSRALGLDAAHVGAVMSAGPLVAALTGVPAGRIVDRFGAHRMTITGLVAMIIGLFLVAAMQGRFGVVGYIGPLALVTANYALFQAANNTTIMTNIRPDQRGVISGMLSLSRNLGLITGASVMGAVFTLASGTTGITTARPEAIATGMQVTFAIAALLIVAALVVALTGFAIAKRTALSEQAS

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231016 Pseudomonas sp. GM50 Isolate Nodule
8 2511231018 Pseudomonas sp. GM60 Isolate Nodule
9 2511231022 Pseudomonas sp. GM79 Isolate Nodule
10 2511231023 Pseudomonas sp. GM80 Isolate Nodule
11 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
12 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
13 2512875024 Mesorhizobium loti R88b Isolate Nodule
14 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
15 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
16 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
17 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
18 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
19 2516143018 Ensifer sp. BR816 Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
22 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
23 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
24 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
25 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
26 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
27 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
28 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
29 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
30 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
31 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
32 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
33 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
34 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
35 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
36 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
37 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
38 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
39 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
40 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
41 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
42 2643221585 Pelomonas sp. Root662 Isolate Unclassified
43 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
44 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
45 2643221610 Ensifer sp. Root74 Isolate Unclassified
46 2643221613 Oerskovia sp. Root22 Isolate Unclassified
47 2643221618 Ensifer sp. Root231 Isolate Unclassified
48 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
49 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
50 2643221655 Ensifer sp. Root1252 Isolate Unclassified
51 2643221656 Pelomonas sp. Root405 Isolate Unclassified
52 2643221659 Ensifer sp. Root127 Isolate Unclassified
53 2643221675 Ensifer sp. Root1298 Isolate Unclassified
54 2643221680 Ensifer sp. Root1312 Isolate Unclassified
55 2643221698 Ensifer sp. Root142 Isolate Unclassified
56 2643221712 Ensifer sp. Root258 Isolate Unclassified
57 2643221721 Oerskovia sp. Root918 Isolate Unclassified
58 2643221726 Ensifer sp. Root954 Isolate Unclassified
59 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
60 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
61 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
62 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
63 2721755523 Delftia sp. HK171 Isolate Unclassified
64 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
65 2738543030 Massilia sp. GV097 Isolate Unclassified
66 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
67 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
68 2773857925 Microvirga vignae BR3299 Isolate Unclassified
69 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
70 2784132072 Pseudomonas sp. 460 Isolate Unclassified
71 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
72 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
73 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
74 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
75 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
76 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
77 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
78 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
79 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
80 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
81 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
82 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
83 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
84 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
85 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
86 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
87 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
88 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
89 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
90 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
91 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
92 2844163670 Ensifer sp. 1H6 Isolate Unclassified
93 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
94 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
95 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
96 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
97 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
98 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
99 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
100 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
101 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
102 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
103 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
104 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
105 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
106 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
107 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
108 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
109 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
110 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
111 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
112 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
113 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
114 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
115 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
116 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
117 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
118 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
119 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
120 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
121 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
122 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
123 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
124 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
125 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
126 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
127 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
128 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
129 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
130 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
131 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
132 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
133 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
134 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
135 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
136 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
137 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
138 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
139 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
140 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
141 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
142 2904424332 Duganella sp. 1411 Isolate Rhizosphere
143 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
144 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
145 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
146 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
147 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
148 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
149 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
150 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
151 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
152 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
153 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
154 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
155 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
156 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
157 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
158 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
159 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
160 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
161 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
162 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
163 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
164 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
165 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
166 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
167 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
168 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
169 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
170 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
171 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
172 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
173 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
174 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
175 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
176 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
177 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
178 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
179 2941479691
180 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
181 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
182 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
183 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
184 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
185 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
186 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
187 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
188 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
189 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
190 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
191 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
192 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
193 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
194 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
195 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
196 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
197 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
198 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
199 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
200 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
201 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
202 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
203 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
204 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
205 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
206 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
207 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
208 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
209 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
210 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
211 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
212 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
213 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
214 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
215 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
216 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
217 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
218 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
219 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
220 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
221 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
222 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
223 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
224 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
225 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
226 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
227 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
228 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
229 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
230 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
231 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
232 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
233 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
234 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
235 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
236 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
237 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
238 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
239 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
240 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
241 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
242 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
243 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
244 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
245 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
246 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
247 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
248 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
249 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
250 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
251 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
252 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
253 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
254 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
255 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
256 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
257 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
258 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
259 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
260 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
261 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
262 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
263 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
264 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
265 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
266 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
267 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
268 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
269 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
270 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
271 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
272 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
273 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
274 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
275 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
276 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
277 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
278 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
279 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
280 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
281 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
282 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
283 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
284 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
285 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
286 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
287 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
288 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
289 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
290 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
291 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
292 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
293 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
294 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
295 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
296 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
297 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
298 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
299 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
300 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
301 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
302 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
303 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
304 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
305 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
306 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
307 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
308 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
309 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
310 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
313 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
314 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
315 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
316 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
317 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
318 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
319 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
320 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
321 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
322 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
323 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
324 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
325 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
326 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
327 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
328 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
329 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
330 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
331 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
332 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
333 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
334 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
335 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
336 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
337 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
338 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
341 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
342 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
343 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
346 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
347 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
372 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
373 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
374 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
376 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
377 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
378 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
379 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
380 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
381 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
382 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
383 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
384 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
385 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
386 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
387 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
388 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
389 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
390 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
391 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
392 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
393 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
394 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
395 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
396 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
397 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
398 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
399 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
400 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
401 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
402 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
403 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
404 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
405 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
406 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
407 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
408 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
409 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
410 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
411 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
412 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
413 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
414 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
415 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
416 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
417 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
418 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
419 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
420 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
421 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
422 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
423 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
424 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
425 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
426 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
427 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
428 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
429 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
430 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
431 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
432 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
433 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
434 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
435 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
436 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
437 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
438 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
439 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
440 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
441 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
442 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
443 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
444 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
447 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
448 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
449 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
450 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
451 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
452 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
453 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
454 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
455 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
456 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
457 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
458 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
459 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
460 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
461 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
462 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
463 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
464 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
465 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
466 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
467 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
468 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
469 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
470 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
471 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
472 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
473 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
474 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
475 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
476 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
477 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
478 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
479 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
480 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
481 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
482 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
483 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
484 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
485 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
486 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
487 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
488 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
489 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
490 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
491 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
492 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
493 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
494 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
498 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
499 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
500 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
501 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
502 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
503 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
505 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
506 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
507 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
508 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
509 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
510 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
511 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
512 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
513 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
514 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
515 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
516 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
517 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
518 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
519 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
520 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
521 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
522 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
523 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
524 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
525 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
526 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
527 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
528 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
529 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
530 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
531 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
532 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
533 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
534 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
535 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
536 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
537 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
538 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
539 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
540 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
541 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.35
Metatranscriptomes 0
Isolates 36.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 25.61
Rhizoplane 4.63
Rhizosphere 48.09
Stem 0
Stem Tuber 0
Unclassified 15.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_222 2124908027 Bacteria 16053
2 JGI24740J21852_10000004 3300001979 Bacteria 91019
3 JGI24737J22298_10004055 3300001990 Bacteria 5122
4 JGI25155J39150_1000004 3300002704 Bacteria 269098
5 JGI25156J39149_1000014 3300002705 Bacteria 189257
6 JGI25162J39368_1000670 3300002737 Bacteria 24190
7 JGI25162J39368_1001910 3300002737 Bacteria 9544
8 JGI25154J39366_1000096 3300002738 Bacteria 79168
9 JGI25157J39369_1000005 3300002741 Bacteria 269089
10 JGI25151J46595_10015201 3300003187 Bacteria 3404
11 JGI25165J46597_1001403 3300003214 Bacteria 13115
12 JGI25165J46597_1001922 3300003214 Bacteria 8293
13 JGI25153J46596_10001939 3300003215 Bacteria 12282
14 JGI25153J46596_10006633 3300003215 Bacteria 5825
15 rootH1_10083839 3300003316 Bacteria 2851
16 rootH2_10033048 3300003320 Bacteria 10091
17 rootL2_10123289 3300003322 Bacteria 2261
18 rootH1_10063462 3300003323 Bacteria 6542
19 Ga0055542_1000839 3300003762 Bacteria 21795
20 Ga0065165_1007717 3300005262 Bacteria 5209
21 Ga0065714_10000305 3300005288 Bacteria 11964
22 Ga0065714_10006583 3300005288 Bacteria 7426
23 Ga0065714_10076125 3300005288 Bacteria 2826
24 Ga0065714_10088436 3300005288 Bacteria 2017
25 Ga0065715_10002056 3300005293 Bacteria 5661
26 Ga0070658_10011003 3300005327 Bacteria 7252
27 Ga0070658_10041052 3300005327 Bacteria 3733
28 Ga0070658_10114001 3300005327 Bacteria 2241
29 Ga0070683_100042696 3300005329 Bacteria 4176
30 Ga0070670_100060006 3300005331 Bacteria 3265
31 Ga0070660_100046034 3300005339 Bacteria 3343
32 Ga0070687_100006936 3300005343 Bacteria 4682
33 Ga0070661_100015245 3300005344 Bacteria 5425
34 Ga0070661_100093086 3300005344 Bacteria 2233
35 Ga0070671_100035995 3300005355 Bacteria 4103
36 Ga0070714_100034145 3300005435 Bacteria 4258
37 Ga0070714_100060880 3300005435 Bacteria 3241
38 Ga0070663_100010866 3300005455 Bacteria 5687
39 Ga0070663_100045377 3300005455 Bacteria 3104
40 Ga0070681_10090096 3300005458 Bacteria 3018
41 Ga0070679_100066453 3300005530 Bacteria 3594
42 Ga0070684_100017827 3300005535 Bacteria 5836
43 Ga0068853_100000769 3300005539 Bacteria 22243
44 Ga0068853_100025427 3300005539 Bacteria 4967
45 Ga0068853_100030296 3300005539 Bacteria 4569
46 Ga0068853_100037371 3300005539 Bacteria 4131
47 Ga0068853_100117831 3300005539 Bacteria 2366
48 Ga0070672_100000700 3300005543 Bacteria 19849
49 Ga0070665_100010800 3300005548 Bacteria 9235
50 Ga0070665_100104702 3300005548 Bacteria 2831
51 Ga0068855_100003263 3300005563 Bacteria 19852
52 Ga0068855_100010532 3300005563 Bacteria 11152
53 Ga0068855_100013519 3300005563 Bacteria 9842
54 Ga0068855_100018293 3300005563 Bacteria 8417
55 Ga0068855_100085765 3300005563 Bacteria 3643
56 Ga0068855_100119141 3300005563 Bacteria 3022
57 Ga0068855_100194899 3300005563 Bacteria 2283
58 Ga0070664_100045925 3300005564 Bacteria 3689
59 Ga0068857_100000436 3300005577 Bacteria 29551
60 Ga0068857_100053343 3300005577 Bacteria 3587
61 Ga0068857_100060748 3300005577 Bacteria 3357
62 Ga0068854_100000056 3300005578 Bacteria 82924
63 Ga0068854_100014066 3300005578 Bacteria 5269
64 Ga0068854_100097767 3300005578 Bacteria 2195
65 Ga0068856_100304891 3300005614 Bacteria 1610
66 Ga0068852_100139096 3300005616 Bacteria 2245
67 Ga0068859_100208336 3300005617 Bacteria 2041
68 Ga0068859_100284352 3300005617 Bacteria 1747
69 Ga0068864_100065800 3300005618 Bacteria 3144
70 Ga0068861_100180889 3300005719 Bacteria 1755
71 Ga0068851_10001004 3300005834 Bacteria 12245
72 Ga0068851_10004431 3300005834 Bacteria 6331
73 Ga0068863_100010114 3300005841 Bacteria 9174
74 Ga0068863_100226920 3300005841 Bacteria 1801
75 Ga0081539_10005268 3300005985 Bacteria 13337
76 Ga0075365_10008710 3300006038 Bacteria 5781
77 Ga0075365_10016144 3300006038 Bacteria 4534
78 Ga0075363_100005206 3300006048 Bacteria 5761
79 Ga0075362_10000003 3300006177 Bacteria 171099
80 Ga0075367_10002906 3300006178 Bacteria 7980
81 Ga0075369_10001406 3300006186 Bacteria 8191
82 Ga0075369_10004715 3300006186 Bacteria 5059
83 Ga0097621_100033411 3300006237 Bacteria 4097
84 Ga0075370_10001512 3300006353 Bacteria 10167
85 Ga0068865_100022643 3300006881 Bacteria 4102
86 Ga0097620_100208335 3300006931 Bacteria 2041
87 Ga0097620_100284355 3300006931 Bacteria 1747
88 Ga0079104_1000007 3300006946 Bacteria 390531
89 Ga0079104_1003920 3300006946 Bacteria 6646
90 Ga0105244_10007446 3300009036 Bacteria 6959
91 Ga0105240_10000013 3300009093 Bacteria 483458
92 Ga0105240_10065614 3300009093 Bacteria 4506
93 Ga0111539_10000100 3300009094 Bacteria 91427
94 Ga0111539_10041691 3300009094 Bacteria 5517
95 Ga0114129_10037370 3300009147 Bacteria 6856
96 Ga0105243_10001488 3300009148 Bacteria 20504
97 Ga0105241_10010112 3300009174 Bacteria 6927
98 Ga0105237_10000023 3300009545 Bacteria 226144
99 Ga0105237_10005220 3300009545 Bacteria 14694
100 Ga0105237_10130343 3300009545 Bacteria 2509
101 Ga0105237_10177669 3300009545 Bacteria 2129
102 Ga0105238_10049578 3300009551 Bacteria 4227
103 Ga0105238_10176236 3300009551 Bacteria 2115
104 Ga0105249_10055894 3300009553 Bacteria 3613
105 Ga0123342_1000455 3300009766 Bacteria 64500
106 Ga0099796_10006581 3300010159 Bacteria 2985
107 Ga0105239_10003240 3300010375 Bacteria 20106
108 Ga0105239_10004443 3300010375 Bacteria 16762
109 Ga0105239_10045237 3300010375 Bacteria 4824
110 Ga0105239_10205152 3300010375 Bacteria 2209
111 Ga0157314_1000522 3300012500 Bacteria 3627
112 Ga0157373_10016254 3300013100 Bacteria 5431
113 Ga0157373_10021379 3300013100 Bacteria 4700
114 Ga0157371_10001861 3300013102 Bacteria 21161
115 Ga0157371_10078920 3300013102 Bacteria 2332
116 Ga0157370_10003433 3300013104 Bacteria 18605
117 Ga0157370_10006851 3300013104 Bacteria 12477
118 Ga0157370_10111199 3300013104 Bacteria 2561
119 Ga0163162_10307152 3300013306 Bacteria 1718
120 Ga0157375_10000034 3300013308 Bacteria 184385
121 Ga0163163_10069987 3300014325 Bacteria 3494
122 Ga0182008_10015402 3300014497 Bacteria 3989
123 Ga0182006_1001162 3300015261 Bacteria 16594
124 Ga0182007_10000898 3300015262 Bacteria 16505
125 Ga0182007_10002371 3300015262 Bacteria 9423
126 Ga0163161_10025204 3300017792 Bacteria 4208
127 Ga0214542_1010266 3300021321 Bacteria 13792
128 Ga0214543_1000156 3300021327 Bacteria 96889
129 Ga0213876_10003348 3300021384 Bacteria 9178
130 Ga0228711_1000006 3300022739 Bacteria 202437
131 Ga0228710_1000004 3300022740 Bacteria 250560
132 Ga0209435_100009 3300025206 Bacteria 476614
133 Ga0209760_100936 3300025207 Bacteria 3586
134 Ga0209437_100057 3300025233 Bacteria 362922
135 Ga0209437_100107 3300025233 Bacteria 218656
136 Ga0209646_1000018 3300025246 Bacteria 476716
137 Ga0209646_1004842 3300025246 Bacteria 2414
138 Ga0209026_1000043 3300025250 Bacteria 269142
139 Ga0209677_100382 3300025253 Bacteria 27101
140 Ga0209148_1000050 3300025254 Bacteria 413178
141 Ga0209148_1006050 3300025254 Bacteria 2669
142 Ga0209759_1000007 3300025256 Bacteria 476614
143 Ga0209759_1008451 3300025256 Bacteria 3202
144 Ga0209129_1010251 3300025258 Bacteria 2362
145 Ga0209233_1000130 3300025261 Bacteria 205687
146 Ga0209233_1000178 3300025261 Bacteria 140956
147 Ga0209233_1000358 3300025261 Bacteria 41919
148 Ga0209455_1000183 3300025272 Bacteria 99952
149 Ga0209676_1000065 3300025292 Bacteria 318605
150 Ga0209025_1000216 3300025294 Bacteria 138307
151 Ga0209025_1011346 3300025294 Bacteria 5886
152 Ga0209758_1000188 3300025297 Bacteria 138749
153 Ga0209758_1000537 3300025297 Bacteria 60204
154 Ga0209050_1014585 3300025298 Bacteria 3370
155 Ga0207655_1001260 3300025728 Bacteria 24152
156 Ga0207705_10005324 3300025909 Bacteria 9625
157 Ga0207705_10011361 3300025909 Bacteria 6448
158 Ga0207707_10025476 3300025912 Bacteria 5173
159 Ga0207695_10000044 3300025913 Bacteria 440819
160 Ga0207695_10012305 3300025913 Bacteria 10280
161 Ga0207695_10013689 3300025913 Bacteria 9655
162 Ga0207695_10033043 3300025913 Bacteria 5652
163 Ga0207695_10119767 3300025913 Bacteria 2602
164 Ga0207671_10000020 3300025914 Bacteria 309636
165 Ga0207671_10000033 3300025914 Bacteria 245869
166 Ga0207671_10000400 3300025914 Bacteria 60604
167 Ga0207660_10011068 3300025917 Bacteria 5867
168 Ga0207662_10013471 3300025918 Bacteria 4573
169 Ga0207657_10007495 3300025919 Bacteria 11184
170 Ga0207657_10019888 3300025919 Bacteria 6361
171 Ga0207649_10069631 3300025920 Bacteria 2241
172 Ga0207652_10020020 3300025921 Bacteria 5509
173 Ga0207694_10180774 3300025924 Bacteria 1710
174 Ga0207650_10037522 3300025925 Bacteria 3532
175 Ga0207664_10079101 3300025929 Bacteria 2668
176 Ga0207709_10000172 3300025935 Bacteria 86654
177 Ga0207691_10002020 3300025940 Bacteria 19862
178 Ga0207679_10040382 3300025945 Bacteria 3340
179 Ga0207667_10000094 3300025949 Bacteria 145771
180 Ga0207667_10000238 3300025949 Bacteria 76840
181 Ga0207667_10003694 3300025949 Bacteria 18862
182 Ga0207667_10020552 3300025949 Bacteria 7338
183 Ga0207640_10000043 3300025981 Bacteria 102669
184 Ga0207640_10000277 3300025981 Bacteria 34453
185 Ga0207639_10001206 3300026041 Bacteria 17558
186 Ga0207639_10050301 3300026041 Bacteria 3165
187 Ga0207678_10008151 3300026067 Bacteria 9239
188 Ga0207678_10031845 3300026067 Bacteria 4598
189 Ga0207702_10086814 3300026078 Bacteria 2729
190 Ga0207641_10062147 3300026088 Bacteria 3186
191 Ga0207641_10117943 3300026088 Bacteria 2364
192 Ga0207674_10000074 3300026116 Bacteria 105369
193 Ga0207674_10002846 3300026116 Bacteria 21521
194 Ga0207674_10021913 3300026116 Bacteria 6873
195 Ga0207674_10064094 3300026116 Bacteria 3707
196 Ga0209281_1000020 3300027111 Bacteria 575972
197 Ga0209281_1000102 3300027111 Bacteria 221665
198 Ga0209282_1000013 3300027666 Bacteria 215053
199 Ga0207428_10000096 3300027907 Bacteria 123081
200 Ga0207428_10092959 3300027907 Bacteria 2340
201 Ga0268266_10019839 3300028379 Bacteria 5730
202 Ga0268266_10044597 3300028379 Bacteria 3791
203 Ga0307515_10000011 3300028794 Bacteria 633903
204 Ga0307515_10001041 3300028794 Bacteria 63402
205 Ga0307515_10001245 3300028794 Bacteria 58063
206 Ga0307515_10014858 3300028794 Bacteria 14393
207 Ga0307515_10099050 3300028794 Bacteria 3543
208 Ga0268256_1011759 3300030500 Bacteria 2747
209 Ga0307513_10000004 3300031456 Bacteria 558931
210 Ga0307513_10000011 3300031456 Bacteria 354929
211 Ga0307513_10021757 3300031456 Bacteria 7564
212 Ga0307508_10001284 3300031616 Bacteria 28530
213 Ga0307514_10000722 3300031649 Bacteria 57107
214 Ga0307514_10002190 3300031649 Bacteria 20986
215 Ga0307516_10000046 3300031730 Bacteria 130851
216 Ga0307413_10057325 3300031824 Bacteria 2381
217 Ga0307407_10000948 3300031903 Bacteria 9860
218 Ga0315914_1000004 3300031967 Bacteria 288534
219 Ga0307414_10001606 3300032004 Bacteria 11747
220 Ga0307415_100007608 3300032126 Bacteria 5938
221 Ga0307507_10116268 3300033179 Bacteria 2161
222 Ga0315913_1000011 3300033430 Bacteria 140532
223 Ga0315915_1000003 3300033464 Bacteria 407996
224 Ga0316574_0016352 3300035398 Bacteria 4322
225 Ga0373935_0061307 3300035692 Bacteria 2408
226 Ga0373927_0000048 3300035695 Bacteria 86106
227 Ga0373925_0001567 3300037068 Bacteria 19370
228 Ga0395900_0012611 3300037418 Bacteria 8643
229 Ga0395905_0001527 3300037471 Bacteria 27687
230 Ga0395905_0002046 3300037471 Bacteria 23048
231 Ga0395905_0007463 3300037471 Bacteria 10872
232 Ga0395905_0189005 3300037471 Bacteria 1932
233 Ga0395901_0001188 3300038443 Bacteria 27720
234 Ga0436365_0120529 3300039437 Bacteria 8359
235 Ga0439438_003703 3300041405 Bacteria 6082
236 Ga0439447_000014 3300041407 Bacteria 72178
237 Ga0439466_0002142 3300041411 Bacteria 7738
238 Ga0439451_000635 3300042009 Bacteria 6668
239 Ga0439451_001281 3300042009 Bacteria 4958
240 Ga0439451_007886 3300042009 Bacteria 2161
241 Ga0439452_004214 3300042010 Bacteria 4872
242 Ga0439452_006400 3300042010 Bacteria 3689
243 Ga0439463_004121 3300042016 Bacteria 3651
244 Ga0450919_003654 3300042121 Bacteria 1909
245 Ga0450905_000726 3300042142 Bacteria 4029
246 Ga0450907_000146 3300042146 Bacteria 26937
247 Ga0450909_000154 3300042185 Bacteria 7356
248 Ga0450909_006941 3300042185 Bacteria 1633
249 Ga0439434_0000153 3300042435 Bacteria 18390
250 Ga0439464_0000460 3300042439 Bacteria 8157
251 Ga0439460_0002759 3300042461 Bacteria 4226
252 Ga0450918_000060 3300042531 Bacteria 21957
253 Ga0439440_0011138 3300042993 Bacteria 1892
254 Ga0466961_0006453 3300044693 Bacteria 7447
255 Ga0466959_0066038 3300045049 Bacteria 2624
256 Ga0451576_0147559 3300045051 Bacteria 2453
257 Ga0495617_002636 3300046452 Bacteria 7008
258 Ga0495603_0000930 3300046455 Bacteria 16822
259 Ga0495590_0015385 3300046457 Bacteria 2777
260 Ga0495638_0035873 3300046460 Bacteria 3159
261 Ga0495638_0053280 3300046460 Bacteria 2518
262 Ga0495651_0106528 3300046462 Bacteria 2078
263 Ga0495650_0001441 3300046471 Bacteria 22950
264 Ga0495650_0012043 3300046471 Bacteria 4680
265 Ga0495650_0018092 3300046471 Bacteria 3513
266 Ga0495605_0000114 3300046474 Bacteria 103834
267 Ga0495605_0003571 3300046474 Bacteria 9216
268 Ga0495605_0026142 3300046474 Bacteria 3036
269 Ga0495639_0000001 3300046475 Bacteria 204442
270 Ga0495584_0000086 3300046491 Bacteria 64500
271 Ga0495584_0001610 3300046491 Bacteria 13285
272 Ga0495584_0004386 3300046491 Bacteria 7599
273 Ga0495585_0000756 3300046492 Bacteria 28639
274 Ga0495585_0000811 3300046492 Bacteria 27233
275 Ga0495585_0001747 3300046492 Bacteria 16555
276 Ga0495585_0001985 3300046492 Bacteria 15206
277 Ga0495594_0004250 3300046499 Bacteria 7356
278 Ga0495607_0002550 3300046501 Bacteria 14728
279 Ga0495607_0007673 3300046501 Bacteria 7434
280 Ga0495607_0053905 3300046501 Bacteria 2320
281 Ga0495607_0087746 3300046501 Bacteria 1692
282 Ga0495583_0000959 3300046506 Bacteria 33478
283 Ga0495583_0007862 3300046506 Bacteria 6620
284 Ga0495583_0011682 3300046506 Bacteria 5029
285 Ga0495583_0038363 3300046506 Bacteria 2263
286 Ga0495606_0004670 3300046507 Bacteria 13535
287 Ga0495606_0013066 3300046507 Bacteria 6596
288 Ga0495606_0075194 3300046507 Bacteria 2114
289 Ga0495610_0000813 3300046512 Bacteria 29272
290 Ga0495610_0008005 3300046512 Bacteria 6926
291 Ga0495616_0000480 3300046513 Bacteria 30368
292 Ga0495616_0009080 3300046513 Bacteria 5832
293 Ga0495616_0025257 3300046513 Bacteria 3176
294 Ga0495631_0008437 3300046518 Bacteria 5192
295 Ga0495632_0000455 3300046519 Bacteria 38969
296 Ga0495632_0001698 3300046519 Bacteria 17954
297 Ga0495632_0007967 3300046519 Bacteria 6579
298 Ga0495637_0001301 3300046520 Bacteria 14990
299 Ga0495637_0010096 3300046520 Bacteria 4580
300 Ga0495643_0005726 3300046522 Bacteria 8315
301 Ga0495643_0012472 3300046522 Bacteria 5127
302 Ga0495643_0028814 3300046522 Bacteria 3110
303 Ga0495643_0046678 3300046522 Bacteria 2347
304 Ga0495648_0009876 3300046524 Bacteria 7333
305 Ga0495648_0022911 3300046524 Bacteria 4287
306 Ga0495663_0001725 3300046525 Bacteria 6785
307 Ga0495642_0000162 3300046528 Bacteria 38956
308 Ga0495654_0001192 3300046530 Bacteria 18488
309 Ga0495654_0016938 3300046530 Bacteria 3838
310 Ga0495609_0003974 3300046538 Bacteria 8270
311 Ga0495609_0033289 3300046538 Bacteria 2339
312 Ga0495597_0002955 3300046542 Bacteria 10301
313 Ga0495597_0017925 3300046542 Bacteria 3325
314 Ga0495597_0018415 3300046542 Bacteria 3277
315 Ga0495622_0000181 3300046557 Bacteria 51031
316 Ga0495622_0000202 3300046557 Bacteria 47328
317 Ga0495622_0058521 3300046557 Bacteria 1785
318 Ga0495633_0000031 3300046558 Bacteria 196727
319 Ga0495656_0000403 3300046615 Bacteria 14328
320 Ga0495656_0001604 3300046615 Bacteria 7402
321 Ga0495611_0001155 3300046648 Bacteria 13789
322 Ga0495625_0001903 3300046660 Bacteria 23588
323 Ga0495625_0016365 3300046660 Bacteria 5839
324 Ga0495659_0000507 3300046664 Bacteria 14341
325 Ga0495659_0035210 3300046664 Bacteria 1763
326 Ga0495661_0008104 3300046665 Bacteria 7288
327 Ga0495588_0002907 3300046674 Bacteria 7388
328 Ga0495669_0003306 3300046684 Bacteria 6633
329 Ga0495669_0028623 3300046684 Bacteria 2440
330 Ga0495670_0022507 3300046691 Bacteria 3111
331 Ga0495670_0033998 3300046691 Bacteria 2537
332 Ga0495670_0037742 3300046691 Bacteria 2408
333 Ga0495671_0000138 3300046692 Bacteria 64535
334 Ga0495671_0010358 3300046692 Bacteria 5168
335 Ga0495671_0013321 3300046692 Bacteria 4457
336 Ga0495649_0000013 3300046694 Bacteria 316013
337 Ga0495649_0000890 3300046694 Bacteria 23784
338 Ga0495649_0003006 3300046694 Bacteria 11575
339 Ga0495649_0014706 3300046694 Bacteria 4474
340 Ga0495649_0014886 3300046694 Bacteria 4445
341 Ga0495589_0000141 3300046794 Bacteria 66457
342 Ga0495589_0004061 3300046794 Bacteria 7843
343 Ga0495589_0015712 3300046794 Bacteria 3891
344 Ga0495660_0011537 3300046810 Bacteria 5126
345 Ga0495660_0020219 3300046810 Bacteria 3816
346 Ga0495660_0046209 3300046810 Bacteria 2388
347 Ga0495660_0061135 3300046810 Bacteria 2022
348 Ga0495636_0004061 3300047318 Bacteria 5724
349 Ga0495636_0073822 3300047318 Bacteria 1460
350 Ga0495672_0000419 3300047320 Bacteria 51114
351 Ga0495672_0006208 3300047320 Bacteria 9319
352 Ga0495672_0052794 3300047320 Bacteria 2385
353 Ga0495683_0043601 3300047323 Bacteria 2258
354 Ga0495683_0049957 3300047323 Bacteria 2093
355 Ga0495677_0000322 3300047445 Bacteria 20705
356 Ga0495679_000793 3300047446 Bacteria 20055
357 Ga0495679_015906 3300047446 Bacteria 2735
358 Ga0495673_0003032 3300047469 Bacteria 11314
359 Ga0495673_0003114 3300047469 Bacteria 11110
360 Ga0495673_0006252 3300047469 Bacteria 7036
361 Ga0495673_0013855 3300047469 Bacteria 4213
362 Ga0495673_0053931 3300047469 Bacteria 1750
363 Ga0495684_0021634 3300047471 Bacteria 4952
364 Ga0495593_0014775 3300047673 Bacteria 4436
365 Ga0495615_0001492 3300048090 Bacteria 3504
366 Ga0495626_0000329 3300048091 Bacteria 50091
367 Ga0495626_0000849 3300048091 Bacteria 27275
368 Ga0495626_0001572 3300048091 Bacteria 17894
369 Ga0495626_0009783 3300048091 Bacteria 5161
370 Ga0496100_0006646 3300048903 Bacteria 6322
371 Ga0496102_0014331 3300048905 Bacteria 6887
372 Ga0496102_0041392 3300048905 Bacteria 4171
373 Ga0496102_0245150 3300048905 Bacteria 1689
374 Ga0496103_0012713 3300048906 Bacteria 4993
375 Ga0496104_0002324 3300048907 Bacteria 16426
376 Ga0496104_0005274 3300048907 Bacteria 11296
377 Ga0496105_0038760 3300048908 Bacteria 3926
378 Ga0496106_0003149 3300048909 Bacteria 12312
379 Ga0496106_0040336 3300048909 Bacteria 3496
380 Ga0496108_0001103 3300048911 Bacteria 21100
381 Ga0496108_0003172 3300048911 Bacteria 13232
382 Ga0496109_0003718 3300048912 Bacteria 12748
383 Ga0496109_0051857 3300048912 Bacteria 3737
384 Ga0496110_0001272 3300048913 Bacteria 18044
385 Ga0496110_0095428 3300048913 Bacteria 2663
386 Ga0496111_0001613 3300048914 Bacteria 13053
387 Ga0496112_0004257 3300048915 Bacteria 12078
388 Ga0496112_0052446 3300048915 Bacteria 4003
389 Ga0496113_0000394 3300048916 Bacteria 21064
390 Ga0496113_0003078 3300048916 Bacteria 9903
391 Ga0496113_0059542 3300048916 Bacteria 2877
392 Ga0496114_0167313 3300048917 Bacteria 1915
393 Ga0496115_0016207 3300048918 Bacteria 5671
394 Ga0496115_0075286 3300048918 Bacteria 2742
395 Ga0496115_0240525 3300048918 Bacteria 1492
396 Ga0496116_0026740 3300048919 Bacteria 4209
397 Ga0496117_0011833 3300048920 Bacteria 7766
398 Ga0496118_0013506 3300048921 Bacteria 7716
399 Ga0496119_0026392 3300048922 Bacteria 4029
400 Ga0496120_0011566 3300048923 Bacteria 6060
401 Ga0496121_0000396 3300048924 Bacteria 87716
402 Ga0496121_0004070 3300048924 Bacteria 20079
403 Ga0496121_0006347 3300048924 Bacteria 14733
404 Ga0496121_0049280 3300048924 Bacteria 3572
405 Ga0496121_0050746 3300048924 Bacteria 3501
406 Ga0496122_0003392 3300048925 Bacteria 20972
407 Ga0496122_0016932 3300048925 Bacteria 6849
408 Ga0496122_0045378 3300048925 Bacteria 3416
409 Ga0496123_0014523 3300048926 Bacteria 6520
410 Ga0496123_0030307 3300048926 Bacteria 3962
411 Ga0496123_0032039 3300048926 Bacteria 3814
412 Ga0496124_0018862 3300048927 Bacteria 6442
413 Ga0496124_0133766 3300048927 Bacteria 1966
414 Ga0496125_0002729 3300048928 Bacteria 22402
415 Ga0496125_0019592 3300048928 Bacteria 6375
416 Ga0496125_0036060 3300048928 Bacteria 4325
417 Ga0496125_0041900 3300048928 Bacteria 3908
418 Ga0495678_000358 3300049459 Bacteria 46919
419 Ga0495678_000495 3300049459 Bacteria 38920
420 Ga0495678_011653 3300049459 Bacteria 4200
421 Ga0495682_0003805 3300049460 Bacteria 6632
422 Ga0495682_0010167 3300049460 Bacteria 3654
423 Ga0501033_0002268 3300049570 Bacteria 16450
424 Ga0501034_0010327 3300049571 Bacteria 9732
425 Ga0501034_0035051 3300049571 Bacteria 5089
426 Ga0501037_0031652 3300049573 Bacteria 3906
427 Ga0501043_0065552 3300049579 Bacteria 2852
428 Ga0501046_0000761 3300049580 Bacteria 31142
429 Ga0501046_0003012 3300049580 Bacteria 15574
430 Ga0501047_0006739 3300049581 Bacteria 10797
431 Ga0501047_0028558 3300049581 Bacteria 5380
432 Ga0501047_0043333 3300049581 Bacteria 4347
433 Ga0501047_0071315 3300049581 Bacteria 3344
434 Ga0501067_0044324 3300049583 Bacteria 2471
435 Ga0501070_0054546 3300049586 Bacteria 3315
436 Ga0501073_0099650 3300049589 Bacteria 2017
437 Ga0501074_0109341 3300049590 Bacteria 1978
438 Ga0501080_0088672 3300049742 Bacteria 2874
439 Ga0501080_0136870 3300049742 Bacteria 2266
440 Ga0501083_0037613 3300049744 Bacteria 3295
441 Ga0501083_0041093 3300049744 Bacteria 3137
442 Ga0501035_0106758 3300049822 Bacteria 2455
443 Ga0501044_0000764 3300049823 Bacteria 38944
444 Ga0501044_0002447 3300049823 Bacteria 21166
445 nmdc:mga03683_22_c1 3300050489 Bacteria 82016
446 nmdc:mga03n38_2422_c1 3300050490 Bacteria 5760
447 nmdc:mga0yw44_1058_c1 3300050492 Bacteria 5879
448 nmdc:mga0yw44_14127_c1 3300050492 Bacteria 4228
449 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
450 nmdc:mga08y16_248024_c1 3300050511 Bacteria 1840
451 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
452 nmdc:mga0rr50_115952_c1 3300050513 Bacteria 2126
453 nmdc:mga0sz30_2314_c2 3300050516 Bacteria 6485
454 nmdc:mga0sz30_39_c1 3300050516 Bacteria 12429
455 Ga0500610_0005577 3300053079 Bacteria 5176
456 Ga0500578_0000309 3300053086 Bacteria 59973
457 Ga0500593_021410 3300053117 Bacteria 2846
458 Ga0500594_0000141 3300053118 Bacteria 19985
459 Ga0500618_005740 3300053125 Bacteria 3740
460 Ga0500616_0002438 3300053153 Bacteria 15481
461 Ga0500627_0014604 3300053158 Bacteria 3013
462 Ga0501084_0095059 3300054114 Bacteria 2502
463 Ga0501082_0000027 3300060353 Bacteria 100915
464 Ga0501082_0000143 3300060353 Bacteria 59481
465 Ga0501082_0142097 3300060353 Bacteria 2083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046506 Ga0495583_0000959 Ga0495583_0000959_26998_28407 372
2 3300050511 nmdc:mga08y16_248024_c1 nmdc:mga08y16_248024_c1_392_1804 374
3 iso_pu_bacteria 2965062239 2965067217 379
4 3300048915 Ga0496112_0052446 Ga0496112_0052446_1669_2931 381
5 3300009551 Ga0105238_10049578 Ga0105238_100495785 388
6 iso_pu_bacteria 2881845957 2881851177 388
7 3300046507 Ga0495606_0013066 Ga0495606_0013066_5163_6572 390
8 3300046513 Ga0495616_0025257 Ga0495616_0025257_901_2265 391
9 3300046694 Ga0495649_0003006 Ga0495649_0003006_5000_6409 391
10 3300047469 Ga0495673_0013855 Ga0495673_0013855_270_1634 391
11 3300017792 Ga0163161_10025204 Ga0163161_100252043 392
12 3300037471 Ga0395905_0007463 Ga0395905_0007463_5234_6613 393
13 3300003316 rootH1_10083839 rootH1_100838392 394
14 3300003322 rootL2_10123289 rootL2_101232892 394
15 iso_pu_bacteria 2924741084 2924746220 397
16 3300048918 Ga0496115_0016207 Ga0496115_0016207_3429_4844 398
17 3300005548 Ga0070665_100104702 Ga0070665_1001047023 400
18 3300046471 Ga0495650_0018092 Ga0495650_0018092_539_1903 400
19 3300046491 Ga0495584_0004386 Ga0495584_0004386_4762_6126 400
20 3300046501 Ga0495607_0053905 Ga0495607_0053905_229_1593 400
21 3300046507 Ga0495606_0004670 Ga0495606_0004670_4572_5936 400
22 3300046512 Ga0495610_0008005 Ga0495610_0008005_2272_3636 400
23 3300046520 Ga0495637_0010096 Ga0495637_0010096_1551_2915 400
24 3300046522 Ga0495643_0046678 Ga0495643_0046678_726_2090 400
25 3300046524 Ga0495648_0022911 Ga0495648_0022911_1035_2399 400
26 3300046530 Ga0495654_0016938 Ga0495654_0016938_920_2284 400
27 3300046665 Ga0495661_0008104 Ga0495661_0008104_5471_6835 400
28 3300046691 Ga0495670_0037742 Ga0495670_0037742_181_1545 400
29 3300046692 Ga0495671_0010358 Ga0495671_0010358_2697_4061 400
30 3300046694 Ga0495649_0014886 Ga0495649_0014886_1022_2386 400
31 3300047446 Ga0495679_015906 Ga0495679_015906_476_1840 400
32 3300048091 Ga0495626_0000329 Ga0495626_0000329_44926_46290 400
33 3300005344 Ga0070661_100015245 Ga0070661_1000152453 401
34 3300005563 Ga0068855_100018293 Ga0068855_1000182938 401
35 3300025945 Ga0207679_10040382 Ga0207679_100403824 401
36 3300003187 JGI25151J46595_10015201 JGI25151J46595_100152012 402
37 3300025294 Ga0209025_1000216 Ga0209025_1000216110 402
38 3300026116 Ga0207674_10002846 Ga0207674_1000284619 402
39 3300046684 Ga0495669_0003306 Ga0495669_0003306_4607_6109 403
40 3300025254 Ga0209148_1006050 Ga0209148_10060501 405
41 3300031456 Ga0307513_10000011 Ga0307513_10000011169 405
42 3300047469 Ga0495673_0006252 Ga0495673_0006252_2617_3981 405
43 iso_pu_bacteria 2922158528 2922162984 405
44 3300005614 Ga0068856_100304891 Ga0068856_1003048911 406
45 3300013104 Ga0157370_10111199 Ga0157370_101111992 406
46 3300048917 Ga0496114_0167313 Ga0496114_0167313_105_1388 406
47 3300047323 Ga0495683_0043601 Ga0495683_0043601_235_1644 407
48 3300005327 Ga0070658_10041052 Ga0070658_100410523 408
49 3300005329 Ga0070683_100042696 Ga0070683_1000426963 408
50 3300005563 Ga0068855_100085765 Ga0068855_1000857652 408
51 3300005577 Ga0068857_100060748 Ga0068857_1000607482 408
52 3300006038 Ga0075365_10016144 Ga0075365_100161444 408
53 3300006178 Ga0075367_10002906 Ga0075367_100029065 408
54 3300009551 Ga0105238_10176236 Ga0105238_101762362 408
55 3300025924 Ga0207694_10180774 Ga0207694_101807742 408
56 3300031649 Ga0307514_10000722 Ga0307514_1000072248 408
57 3300042142 Ga0450905_000726 Ga0450905_000726_2527_3930 408
58 3300046810 Ga0495660_0061135 Ga0495660_0061135_488_1960 408
59 3300048928 Ga0496125_0036060 Ga0496125_0036060_1195_2538 409
60 3300005543 Ga0070672_100000700 Ga0070672_10000070017 410
61 3300013102 Ga0157371_10078920 Ga0157371_100789202 410
62 3300014497 Ga0182008_10015402 Ga0182008_100154023 410
63 3300025940 Ga0207691_10002020 Ga0207691_100020204 410
64 3300048924 Ga0496121_0000396 Ga0496121_0000396_17916_19238 410
65 iso_pu_bacteria 2996341866 2996344928 410
66 3300046694 Ga0495649_0014706 Ga0495649_0014706_3061_4413 411
67 3300049590 Ga0501074_0109341 Ga0501074_0109341_571_1929 411
68 3300049744 Ga0501083_0037613 Ga0501083_0037613_115_1551 412
69 3300060353 Ga0501082_0000027 Ga0501082_0000027_15038_16474 412
70 iso_pu_bacteria 2643221585 2643935837 412
71 iso_pu_bacteria 2643221656 2644317620 412
72 3300005327 Ga0070658_10114001 Ga0070658_101140012 413
73 3300005344 Ga0070661_100093086 Ga0070661_1000930862 413
74 3300005455 Ga0070663_100010866 Ga0070663_1000108662 413
75 3300005539 Ga0068853_100037371 Ga0068853_1000373711 413
76 3300005616 Ga0068852_100139096 Ga0068852_1001390963 413
77 3300005617 Ga0068859_100284352 Ga0068859_1002843522 413
78 3300006931 Ga0097620_100284355 Ga0097620_1002843552 413
79 3300025909 Ga0207705_10005324 Ga0207705_1000532411 413
80 3300025920 Ga0207649_10069631 Ga0207649_100696312 413
81 3300026067 Ga0207678_10008151 Ga0207678_100081518 413
82 3300028794 Ga0307515_10001245 Ga0307515_1000124531 413
83 3300048908 Ga0496105_0038760 Ga0496105_0038760_1767_3191 413
84 3300053118 Ga0500594_0000141 Ga0500594_0000141_16823_18307 413
85 3300005458 Ga0070681_10090096 Ga0070681_100900963 414
86 3300048905 Ga0496102_0245150 Ga0496102_0245150_263_1648 414
87 3300049580 Ga0501046_0003012 Ga0501046_0003012_3079_4551 414
88 3300049581 Ga0501047_0071315 Ga0501047_0071315_177_1487 414
89 3300005618 Ga0068864_100065800 Ga0068864_1000658002 415
90 3300005841 Ga0068863_100226920 Ga0068863_1002269202 415
91 3300028794 Ga0307515_10099050 Ga0307515_100990502 415
92 3300037471 Ga0395905_0002046 Ga0395905_0002046_7472_8932 416
93 3300046810 Ga0495660_0046209 Ga0495660_0046209_932_2356 416
94 3300048907 Ga0496104_0005274 Ga0496104_0005274_2300_3724 416
95 3300048911 Ga0496108_0003172 Ga0496108_0003172_4561_5985 416
96 3300048912 Ga0496109_0003718 Ga0496109_0003718_2191_3615 416
97 3300048913 Ga0496110_0001272 Ga0496110_0001272_7448_8872 416
98 3300048916 Ga0496113_0003078 Ga0496113_0003078_4702_6126 416
99 3300003762 Ga0055542_1000839 Ga0055542_100083916 418
100 3300025254 Ga0209148_1000050 Ga0209148_1000050196 418
101 3300025272 Ga0209455_1000183 Ga0209455_100018399 418
102 3300035695 Ga0373927_0000048 Ga0373927_0000048_35486_37039 418
103 3300037068 Ga0373925_0001567 Ga0373925_0001567_16696_18249 418
104 3300005563 Ga0068855_100119141 Ga0068855_1001191411 419
105 3300005985 Ga0081539_10005268 Ga0081539_1000526813 419
106 3300006038 Ga0075365_10008710 Ga0075365_100087104 419
107 3300006881 Ga0068865_100022643 Ga0068865_1000226432 419
108 3300050492 nmdc:mga0yw44_1058_c1 nmdc:mga0yw44_1058_c1_1077_2576 419
109 3300005539 Ga0068853_100117831 Ga0068853_1001178311 420
110 3300025294 Ga0209025_1011346 Ga0209025_10113465 420
111 3300025913 Ga0207695_10013689 Ga0207695_100136899 420
112 3300046471 Ga0495650_0012043 Ga0495650_0012043_2371_3741 420
113 3300046474 Ga0495605_0026142 Ga0495605_0026142_473_1843 420
114 3300046519 Ga0495632_0007967 Ga0495632_0007967_3783_5153 420
115 3300005435 Ga0070714_100034145 Ga0070714_1000341453 421
116 3300005455 Ga0070663_100045377 Ga0070663_1000453772 421
117 3300005535 Ga0070684_100017827 Ga0070684_1000178272 421
118 3300005539 Ga0068853_100030296 Ga0068853_1000302963 421
119 3300009174 Ga0105241_10010112 Ga0105241_100101122 421
120 3300013100 Ga0157373_10021379 Ga0157373_100213793 421
121 3300041405 Ga0439438_003703 Ga0439438_003703_3802_5223 421
122 3300042016 Ga0439463_004121 Ga0439463_004121_834_2255 421
123 3300042185 Ga0450909_006941 Ga0450909_006941_118_1539 421
124 3300042993 Ga0439440_0011138 Ga0439440_0011138_228_1649 421
125 3300046491 Ga0495584_0000086 Ga0495584_0000086_30243_31664 421
126 3300046492 Ga0495585_0000756 Ga0495585_0000756_9793_11217 421
127 3300046524 Ga0495648_0009876 Ga0495648_0009876_3755_5176 421
128 3300046692 Ga0495671_0000138 Ga0495671_0000138_32837_34258 421
129 3300048091 Ga0495626_0009783 Ga0495626_0009783_2124_3545 421
130 3300050489 nmdc:mga03683_22_c1 nmdc:mga03683_22_c1_41181_42545 421
131 3300050490 nmdc:mga03n38_2422_c1 nmdc:mga03n38_2422_c1_2699_4063 421
132 3300050516 nmdc:mga0sz30_39_c1 nmdc:mga0sz30_39_c1_10575_11939 421
133 3300015261 Ga0182006_1001162 Ga0182006_10011624 422
134 3300015262 Ga0182007_10000898 Ga0182007_1000089816 422
135 3300028794 Ga0307515_10000011 Ga0307515_10000011293 422
136 3300046474 Ga0495605_0000114 Ga0495605_0000114_77730_79268 422
137 3300046522 Ga0495643_0005726 Ga0495643_0005726_114_1652 422
138 3300046542 Ga0495597_0002955 Ga0495597_0002955_4100_5638 422
139 3300046794 Ga0495589_0000141 Ga0495589_0000141_43688_45226 422
140 3300047320 Ga0495672_0006208 Ga0495672_0006208_6204_7625 422
141 3300048091 Ga0495626_0001572 Ga0495626_0001572_3094_4515 422
142 3300013308 Ga0157375_10000034 Ga0157375_10000034152 423
143 3300047469 Ga0495673_0003114 Ga0495673_0003114_6772_8121 423
144 3300048924 Ga0496121_0006347 Ga0496121_0006347_8484_9842 423
145 3300006186 Ga0075369_10004715 Ga0075369_100047154 424
146 3300025298 Ga0209050_1014585 Ga0209050_10145852 424
147 3300031456 Ga0307513_10000004 Ga0307513_10000004424 424
148 3300049581 Ga0501047_0006739 Ga0501047_0006739_6290_7762 424
149 3300050516 nmdc:mga0sz30_2314_c2 nmdc:mga0sz30_2314_c2_2025_3458 424
150 3300053153 Ga0500616_0002438 Ga0500616_0002438_2600_4084 424
151 iso_pu_bacteria 2522572158 2523107480 424
152 3300005327 Ga0070658_10011003 Ga0070658_100110034 425
153 3300025909 Ga0207705_10011361 Ga0207705_100113615 425
154 3300046492 Ga0495585_0000811 Ga0495585_0000811_11801_13210 425
155 3300046507 Ga0495606_0075194 Ga0495606_0075194_651_2060 425
156 3300042121 Ga0450919_003654 Ga0450919_003654_279_1706 426
157 3300042439 Ga0439464_0000460 Ga0439464_0000460_6683_8050 426
158 3300042531 Ga0450918_000060 Ga0450918_000060_17419_18846 426
159 3300050513 nmdc:mga0rr50_115952_c1 nmdc:mga0rr50_115952_c1_620_2053 426
160 3300005288 Ga0065714_10006583 Ga0065714_100065832 427
161 3300005435 Ga0070714_100060880 Ga0070714_1000608803 427
162 3300006048 Ga0075363_100005206 Ga0075363_1000052064 427
163 3300006177 Ga0075362_10000003 Ga0075362_1000000365 427
164 3300006186 Ga0075369_10001406 Ga0075369_1000140611 427
165 3300025929 Ga0207664_10079101 Ga0207664_100791013 427
166 3300031730 Ga0307516_10000046 Ga0307516_1000004658 427
167 3300042009 Ga0439451_007886 Ga0439451_007886_610_2040 427
168 3300042461 Ga0439460_0002759 Ga0439460_0002759_2577_4007 427
169 3300046525 Ga0495663_0001725 Ga0495663_0001725_2213_3640 427
170 3300046615 Ga0495656_0000403 Ga0495656_0000403_10552_11979 427
171 3300048090 Ga0495615_0001492 Ga0495615_0001492_222_1649 427
172 3300003215 JGI25153J46596_10001939 JGI25153J46596_100019396 428
173 3300014325 Ga0163163_10069987 Ga0163163_100699873 428
174 3300025297 Ga0209758_1000188 Ga0209758_100018880 428
175 3300027907 Ga0207428_10000096 Ga0207428_1000009615 428
176 3300046558 Ga0495633_0000031 Ga0495633_0000031_163496_164863 428
177 3300053158 Ga0500627_0014604 Ga0500627_0014604_619_1953 428
178 3300025919 Ga0207657_10007495 Ga0207657_100074952 429
179 3300042146 Ga0450907_000146 Ga0450907_000146_15730_17079 429
180 3300042435 Ga0439434_0000153 Ga0439434_0000153_11942_13291 429
181 3300046455 Ga0495603_0000930 Ga0495603_0000930_1969_3318 429
182 3300047318 Ga0495636_0073822 Ga0495636_0073822_10_1404 429
183 iso_pu_bacteria 2511231023 2511368931 429
184 3300005564 Ga0070664_100045925 Ga0070664_1000459252 430
185 3300005578 Ga0068854_100097767 Ga0068854_1000977672 430
186 3300005834 Ga0068851_10004431 Ga0068851_100044314 430
187 3300009545 Ga0105237_10177669 Ga0105237_101776691 430
188 3300021384 Ga0213876_10003348 Ga0213876_100033484 430
189 3300025912 Ga0207707_10025476 Ga0207707_100254762 430
190 3300025913 Ga0207695_10119767 Ga0207695_101197672 430
191 3300025919 Ga0207657_10019888 Ga0207657_100198883 430
192 3300025949 Ga0207667_10020552 Ga0207667_100205523 430
193 3300026067 Ga0207678_10031845 Ga0207678_100318453 430
194 3300026078 Ga0207702_10086814 Ga0207702_100868141 430
195 3300026116 Ga0207674_10021913 Ga0207674_100219132 430
196 3300039437 Ga0436365_0120529 Ga0436365_0120529_5144_6646 430
197 3300045051 Ga0451576_0147559 Ga0451576_0147559_898_2358 430
198 3300049570 Ga0501033_0002268 Ga0501033_0002268_2019_3461 430
199 3300049581 Ga0501047_0028558 Ga0501047_0028558_1812_3254 430
200 3300049742 Ga0501080_0088672 Ga0501080_0088672_577_2019 430
201 3300049822 Ga0501035_0106758 Ga0501035_0106758_886_2349 430
202 3300049823 Ga0501044_0000764 Ga0501044_0000764_32714_34156 430
203 iso_pu_bacteria 2643221613 2644083260 430
204 iso_pu_bacteria 2643221721 2644666456 430
205 iso_pu_bacteria 2935890801 2935890948 430
206 iso_pu_bacteria 8056172158 8056174894 430
207 3300005331 Ga0070670_100060006 Ga0070670_1000600065 431
208 3300009094 Ga0111539_10041691 Ga0111539_100416913 431
209 3300009147 Ga0114129_10037370 Ga0114129_100373702 431
210 3300046491 Ga0495584_0001610 Ga0495584_0001610_9153_10691 431
211 3300046519 Ga0495632_0000455 Ga0495632_0000455_21069_22607 431
212 3300046528 Ga0495642_0000162 Ga0495642_0000162_16754_18292 431
213 3300046538 Ga0495609_0003974 Ga0495609_0003974_186_1724 431
214 3300046694 Ga0495649_0000013 Ga0495649_0000013_105039_106577 431
215 3300048091 Ga0495626_0000849 Ga0495626_0000849_9376_10914 431
216 3300048905 Ga0496102_0014331 Ga0496102_0014331_5247_6638 431
217 3300048907 Ga0496104_0002324 Ga0496104_0002324_5135_6526 431
218 3300048911 Ga0496108_0001103 Ga0496108_0001103_18369_19760 431
219 3300048912 Ga0496109_0051857 Ga0496109_0051857_1428_2819 431
220 3300048913 Ga0496110_0095428 Ga0496110_0095428_77_1468 431
221 3300048914 Ga0496111_0001613 Ga0496111_0001613_6403_7794 431
222 3300048915 Ga0496112_0004257 Ga0496112_0004257_2970_4361 431
223 3300048916 Ga0496113_0000394 Ga0496113_0000394_14357_15748 431
224 3300048918 Ga0496115_0240525 Ga0496115_0240525_11_1405 431
225 3300049459 Ga0495678_000495 Ga0495678_000495_20943_22481 431
226 iso_pu_bacteria 2823421272 2823424397 431
227 iso_pu_bacteria 3007614139 3007614796 431
228 iso_pu_bacteria 8005246636 8005249859 431
229 3300013306 Ga0163162_10307152 Ga0163162_103071522 432
230 3300046660 Ga0495625_0016365 Ga0495625_0016365_3811_5226 432
231 3300046664 Ga0495659_0035210 Ga0495659_0035210_182_1597 432
232 3300046691 Ga0495670_0033998 Ga0495670_0033998_587_2002 432
233 3300047320 Ga0495672_0052794 Ga0495672_0052794_182_1597 432
234 3300049460 Ga0495682_0003805 Ga0495682_0003805_174_1589 432
235 3300060353 Ga0501082_0000143 Ga0501082_0000143_55552_56985 432
236 iso_pu_bacteria 2643221605 2644039912 432
237 iso_pu_bacteria 2977907340 2977907610 432
238 3300005355 Ga0070671_100035995 Ga0070671_1000359953 433
239 3300049571 Ga0501034_0010327 Ga0501034_0010327_6354_7757 433
240 iso_pu_bacteria 2599185292 2599906057 433
241 iso_pu_bacteria 2751185734 2753072851 433
242 3300002737 JGI25162J39368_1001910 JGI25162J39368_10019109 434
243 3300003214 JGI25165J46597_1001922 JGI25165J46597_10019222 434
244 3300025207 Ga0209760_100936 Ga0209760_1009364 434
245 3300025233 Ga0209437_100107 Ga0209437_100107201 434
246 3300025256 Ga0209759_1008451 Ga0209759_10084512 434
247 3300025261 Ga0209233_1000178 Ga0209233_10001789 434
248 3300026088 Ga0207641_10117943 Ga0207641_101179431 434
249 3300028794 Ga0307515_10001041 Ga0307515_1000104116 434
250 3300031649 Ga0307514_10002190 Ga0307514_1000219012 434
251 3300046460 Ga0495638_0035873 Ga0495638_0035873_298_1728 434
252 3300046810 Ga0495660_0020219 Ga0495660_0020219_526_1878 434
253 3300049586 Ga0501070_0054546 Ga0501070_0054546_1283_2767 434
254 3300005539 Ga0068853_100000769 Ga0068853_1000007692 435
255 3300005548 Ga0070665_100010800 Ga0070665_1000108009 435
256 3300005563 Ga0068855_100003263 Ga0068855_10000326314 435
257 3300005577 Ga0068857_100053343 Ga0068857_1000533432 435
258 3300005841 Ga0068863_100010114 Ga0068863_1000101146 435
259 3300010375 Ga0105239_10003240 Ga0105239_1000324011 435
260 3300025949 Ga0207667_10003694 Ga0207667_1000369413 435
261 3300026041 Ga0207639_10001206 Ga0207639_1000120614 435
262 3300026088 Ga0207641_10062147 Ga0207641_100621472 435
263 3300026116 Ga0207674_10064094 Ga0207674_100640942 435
264 3300028379 Ga0268266_10019839 Ga0268266_100198395 435
265 3300028794 Ga0307515_10014858 Ga0307515_1001485811 435
266 3300031616 Ga0307508_10001284 Ga0307508_1000128413 435
267 3300033179 Ga0307507_10116268 Ga0307507_101162681 435
268 3300046475 Ga0495639_0000001 Ga0495639_0000001_199630_201051 435
269 3300046499 Ga0495594_0004250 Ga0495594_0004250_5727_7148 435
270 3300046557 Ga0495622_0000181 Ga0495622_0000181_46358_47779 435
271 3300047673 Ga0495593_0014775 Ga0495593_0014775_1841_3262 435
272 3300049744 Ga0501083_0041093 Ga0501083_0041093_377_1912 435
273 iso_pu_bacteria 2818991272 2819241022 435
274 iso_pu_bacteria 2989776772 2989779533 435
275 3300003320 rootH2_10033048 rootH2_100330485 436
276 3300047446 Ga0495679_000793 Ga0495679_000793_8591_10009 436
277 3300010159 Ga0099796_10006581 Ga0099796_100065812 437
278 3300032004 Ga0307414_10001606 Ga0307414_100016063 437
279 3300037418 Ga0395900_0012611 Ga0395900_0012611_267_1697 437
280 3300037471 Ga0395905_0001527 Ga0395905_0001527_9635_11065 437
281 3300038443 Ga0395901_0001188 Ga0395901_0001188_12229_13659 437
282 3300049571 Ga0501034_0035051 Ga0501034_0035051_1852_3306 437
283 3300060353 Ga0501082_0142097 Ga0501082_0142097_323_1768 437
284 3300041411 Ga0439466_0002142 Ga0439466_0002142_2058_3470 438
285 3300046530 Ga0495654_0001192 Ga0495654_0001192_14202_15623 438
286 3300049583 Ga0501067_0044324 Ga0501067_0044324_112_1557 438
287 3300049589 Ga0501073_0099650 Ga0501073_0099650_186_1724 438
288 3300049742 Ga0501080_0136870 Ga0501080_0136870_502_1956 438
289 3300054114 Ga0501084_0095059 Ga0501084_0095059_556_2094 438
290 iso_pu_bacteria 2551306092 2551738844 438
291 iso_pu_bacteria 2941479691 2941479818 438
292 3300001990 JGI24737J22298_10004055 JGI24737J22298_100040555 439
293 3300005262 Ga0065165_1007717 Ga0065165_10077176 439
294 3300005563 Ga0068855_100013519 Ga0068855_1000135197 439
295 3300005577 Ga0068857_100000436 Ga0068857_10000043610 439
296 3300005578 Ga0068854_100014066 Ga0068854_1000140664 439
297 3300005834 Ga0068851_10001004 Ga0068851_100010041 439
298 3300009545 Ga0105237_10000023 Ga0105237_10000023158 439
299 3300012500 Ga0157314_1000522 Ga0157314_10005222 439
300 3300025913 Ga0207695_10012305 Ga0207695_100123056 439
301 3300025914 Ga0207671_10000020 Ga0207671_1000002078 439
302 3300025914 Ga0207671_10000033 Ga0207671_10000033177 439
303 3300025949 Ga0207667_10000238 Ga0207667_1000023810 439
304 3300025981 Ga0207640_10000277 Ga0207640_1000027727 439
305 3300026116 Ga0207674_10000074 Ga0207674_1000007446 439
306 3300046452 Ga0495617_002636 Ga0495617_002636_892_2307 439
307 3300046492 Ga0495585_0001985 Ga0495585_0001985_13350_14765 439
308 3300046506 Ga0495583_0038363 Ga0495583_0038363_647_2062 439
309 3300046810 Ga0495660_0011537 Ga0495660_0011537_376_1791 439
310 3300048924 Ga0496121_0050746 Ga0496121_0050746_10_1455 439
311 3300046501 Ga0495607_0007673 Ga0495607_0007673_1729_3144 440
312 3300046542 Ga0495597_0017925 Ga0495597_0017925_843_2213 440
313 iso_pu_bacteria 2551306087 2551700281 440
314 3300005339 Ga0070660_100046034 Ga0070660_1000460344 441
315 3300005530 Ga0070679_100066453 Ga0070679_1000664532 441
316 3300009148 Ga0105243_10001488 Ga0105243_1000148816 441
317 3300025917 Ga0207660_10011068 Ga0207660_100110685 441
318 3300025921 Ga0207652_10020020 Ga0207652_100200202 441
319 3300035398 Ga0316574_0016352 Ga0316574_0016352_1202_2659 441
320 3300042009 Ga0439451_001281 Ga0439451_001281_2562_3983 441
321 iso_pu_bacteria 2869256925 2869262131 441
322 3300005343 Ga0070687_100006936 Ga0070687_1000069362 442
323 3300009036 Ga0105244_10007446 Ga0105244_100074464 442
324 3300009766 Ga0123342_1000455 Ga0123342_100045554 442
325 3300025728 Ga0207655_1001260 Ga0207655_10012606 442
326 3300025918 Ga0207662_10013471 Ga0207662_100134712 442
327 3300046460 Ga0495638_0053280 Ga0495638_0053280_449_1870 442
328 3300046506 Ga0495583_0011682 Ga0495583_0011682_496_1917 442
329 3300046664 Ga0495659_0000507 Ga0495659_0000507_3688_5109 442
330 3300046694 Ga0495649_0000890 Ga0495649_0000890_16686_18107 442
331 3300048909 Ga0496106_0040336 Ga0496106_0040336_1420_2841 442
332 3300048924 Ga0496121_0004070 Ga0496121_0004070_15568_16989 442
333 3300048925 Ga0496122_0003392 Ga0496122_0003392_2058_3479 442
334 3300048926 Ga0496123_0030307 Ga0496123_0030307_1799_3220 442
335 3300048927 Ga0496124_0133766 Ga0496124_0133766_204_1625 442
336 3300049823 Ga0501044_0002447 Ga0501044_0002447_958_2418 442
337 3300006353 Ga0075370_10001512 Ga0075370_100015124 443
338 3300046557 Ga0495622_0058521 Ga0495622_0058521_157_1569 443
339 3300046691 Ga0495670_0022507 Ga0495670_0022507_1076_2497 443
340 3300046794 Ga0495589_0004061 Ga0495589_0004061_3737_5158 443
341 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_413281_414714 443
342 3300053079 Ga0500610_0005577 Ga0500610_0005577_2959_4416 443
343 iso_pu_bacteria 2958137437 2958143535 443
344 3300021321 Ga0214542_1010266 Ga0214542_10102667 444
345 3300021327 Ga0214543_1000156 Ga0214543_10001569 444
346 3300046542 Ga0495597_0018415 Ga0495597_0018415_108_1529 444
347 3300048918 Ga0496115_0075286 Ga0496115_0075286_1228_2631 444
348 3300053086 Ga0500578_0000309 Ga0500578_0000309_1795_3216 444
349 iso_pu_bacteria 2600255292 2601667911 444
350 iso_pu_bacteria 2857547612 2857550056 444
351 3300013104 Ga0157370_10006851 Ga0157370_1000685113 445
352 3300049573 Ga0501037_0031652 Ga0501037_0031652_2115_3557 445
353 3300049580 Ga0501046_0000761 Ga0501046_0000761_25443_26885 445
354 3300049581 Ga0501047_0043333 Ga0501047_0043333_1731_3173 445
355 3300006237 Ga0097621_100033411 Ga0097621_1000334114 446
356 3300013102 Ga0157371_10001861 Ga0157371_1000186115 446
357 3300025935 Ga0207709_10000172 Ga0207709_1000017272 446
358 3300041407 Ga0439447_000014 Ga0439447_000014_34286_35734 446
359 3300046474 Ga0495605_0003571 Ga0495605_0003571_7619_9022 446
360 3300046692 Ga0495671_0013321 Ga0495671_0013321_2756_4168 446
361 3300048909 Ga0496106_0003149 Ga0496106_0003149_3229_4659 446
362 iso_pu_bacteria 2808606377 2808930213 446
363 iso_pu_bacteria 2808606381 2808952222 446
364 iso_pu_bacteria 2847686936 2847687639 446
365 iso_pu_bacteria 2860339153 2860342459 446
366 iso_pu_bacteria 2906328253 2906332352 446
367 iso_pu_bacteria 2924726620 2924727608 446
368 iso_pu_bacteria 2937891427 2937894836 446
369 iso_pu_bacteria 2958115193 2958117382 446
370 iso_pu_bacteria 2968091066 2968092901 446
371 iso_pu_bacteria 2968097103 2968103185 446
372 iso_pu_bacteria 2968128360 2968132496 446
373 iso_pu_bacteria 2977858184 2977862061 446
374 iso_pu_bacteria 2979779861 2979783612 446
375 iso_pu_bacteria 8004703790 8004711267 446
376 3300005719 Ga0068861_100180889 Ga0068861_1001808891 447
377 3300013100 Ga0157373_10016254 Ga0157373_100162547 447
378 3300025292 Ga0209676_1000065 Ga0209676_1000065215 447
379 3300042009 Ga0439451_000635 Ga0439451_000635_178_1599 447
380 3300046457 Ga0495590_0015385 Ga0495590_0015385_617_2062 447
381 3300046471 Ga0495650_0001441 Ga0495650_0001441_10610_12148 447
382 3300046492 Ga0495585_0001747 Ga0495585_0001747_11342_12772 447
383 3300046501 Ga0495607_0002550 Ga0495607_0002550_2722_4260 447
384 3300046501 Ga0495607_0087746 Ga0495607_0087746_126_1556 447
385 3300046513 Ga0495616_0000480 Ga0495616_0000480_27407_28852 447
386 3300046513 Ga0495616_0009080 Ga0495616_0009080_442_1872 447
387 3300046518 Ga0495631_0008437 Ga0495631_0008437_1512_2942 447
388 3300046519 Ga0495632_0001698 Ga0495632_0001698_1965_3395 447
389 3300046520 Ga0495637_0001301 Ga0495637_0001301_1039_2469 447
390 3300046538 Ga0495609_0033289 Ga0495609_0033289_186_1724 447
391 3300046615 Ga0495656_0001604 Ga0495656_0001604_701_2131 447
392 3300046648 Ga0495611_0001155 Ga0495611_0001155_5990_7528 447
393 3300046660 Ga0495625_0001903 Ga0495625_0001903_20113_21534 447
394 3300046684 Ga0495669_0028623 Ga0495669_0028623_247_1677 447
395 3300046794 Ga0495589_0015712 Ga0495589_0015712_789_2219 447
396 3300047318 Ga0495636_0004061 Ga0495636_0004061_2505_4043 447
397 3300047320 Ga0495672_0000419 Ga0495672_0000419_33041_34579 447
398 3300047323 Ga0495683_0049957 Ga0495683_0049957_410_1840 447
399 3300047445 Ga0495677_0000322 Ga0495677_0000322_7697_9127 447
400 3300047469 Ga0495673_0003032 Ga0495673_0003032_4484_6022 447
401 3300047469 Ga0495673_0053931 Ga0495673_0053931_60_1490 447
402 3300049460 Ga0495682_0010167 Ga0495682_0010167_1506_2936 447
403 iso_pu_bacteria 2511231007 2511270328 447
404 iso_pu_bacteria 2511231016 2511328683 447
405 iso_pu_bacteria 2511231022 2511362463 447
406 iso_pu_bacteria 2599185352 2600195904 447
407 iso_pu_bacteria 2846037992 2846040830 447
408 iso_pu_bacteria 2919697872 2919701160 447
409 iso_pu_bacteria 8019775933 8019778240 447
410 iso_pu_bacteria 8056155041 8056156868 447
411 3300053117 Ga0500593_021410 Ga0500593_021410_898_2355 448
412 iso_pu_bacteria 2516143018 2516206607 448
413 iso_pu_bacteria 2987666974 2987668880 448
414 3300009553 Ga0105249_10055894 Ga0105249_100558941 449
415 3300049459 Ga0495678_000358 Ga0495678_000358_16819_18228 449
416 iso_pu_bacteria 2512047018 2512325100 449
417 iso_pu_bacteria 2582580891 2583791355 449
418 iso_pu_bacteria 2597489887 2597859123 449
419 iso_pu_bacteria 2599185185 2599487455 449
420 iso_pu_bacteria 2599185257 2599806230 449
421 iso_pu_bacteria 2671180172 2671772707 449
422 iso_pu_bacteria 2791355123 2792749608 449
423 iso_pu_bacteria 2882632389 2882635625 449
424 iso_pu_bacteria 8055770955 8055775047 449
425 3300005293 Ga0065715_10002056 Ga0065715_100020562 450
426 iso_pu_bacteria 2582581279 2585146442 450
427 iso_pu_bacteria 2920822456 2920824997 450
428 iso_pu_bacteria 2937822353 2937824841 450
429 3300003323 rootH1_10063462 rootH1_100634626 451
430 3300005288 Ga0065714_10076125 Ga0065714_100761253 451
431 3300006946 Ga0079104_1000007 Ga0079104_100000763 451
432 3300027111 Ga0209281_1000020 Ga0209281_1000020434 451
433 3300031456 Ga0307513_10021757 Ga0307513_100217576 451
434 3300031824 Ga0307413_10057325 Ga0307413_100573252 451
435 3300031903 Ga0307407_10000948 Ga0307407_100009481 451
436 3300032126 Ga0307415_100007608 Ga0307415_1000076082 451
437 iso_pu_bacteria 2509276019 2509379630 451
438 iso_pu_bacteria 2511231018 2511337475 451
439 iso_pu_bacteria 2513237305 2514420219 451
440 iso_pu_bacteria 2558860100 2558866617 451
441 iso_pu_bacteria 2615840698 2616557566 451
442 iso_pu_bacteria 2690316117 2692318130 451
443 iso_pu_bacteria 2721755686 2723575735 451
444 iso_pu_bacteria 2847417321 2847423365 451
445 iso_pu_bacteria 2850079185 2850079414 451
446 iso_pu_bacteria 2869169390 2869172915 451
447 iso_pu_bacteria 2869234852 2869235396 451
448 iso_pu_bacteria 2869242130 2869246847 451
449 iso_pu_bacteria 2871481445 2871486486 451
450 iso_pu_bacteria 2874109183 2874110209 451
451 iso_pu_bacteria 2874116593 2874118764 451
452 iso_pu_bacteria 2876386047 2876387316 451
453 iso_pu_bacteria 2876420981 2876421819 451
454 iso_pu_bacteria 2897803580 2897809537 451
455 iso_pu_bacteria 2903513507 2903519072 451
456 iso_pu_bacteria 2906401398 2906405282 451
457 iso_pu_bacteria 2906427513 2906432935 451
458 iso_pu_bacteria 2937861824 2937864866 451
459 iso_pu_bacteria 2937980651 2937983309 451
460 iso_pu_bacteria 2958108152 2958110516 451
461 iso_pu_bacteria 2961183825 2961186397 451
462 iso_pu_bacteria 2970532167 2970539868 451
463 iso_pu_bacteria 2970627176 2970629398 451
464 iso_pu_bacteria 2977851361 2977853666 451
465 iso_pu_bacteria 2979764755 2979768864 451
466 iso_pu_bacteria 2979772303 2979775216 451
467 iso_pu_bacteria 3004232784 3004238935 451
468 iso_pu_bacteria 3004248173 3004250814 451
469 iso_pu_bacteria 8004727605 8004729110 451
470 iso_pu_bacteria 8056177738 8056178628 451
471 3300005288 Ga0065714_10088436 Ga0065714_100884361 452
472 3300006946 Ga0079104_1003920 Ga0079104_10039202 452
473 3300022739 Ga0228711_1000006 Ga0228711_100000681 452
474 3300022740 Ga0228710_1000004 Ga0228710_1000004129 452
475 3300027111 Ga0209281_1000102 Ga0209281_100010264 452
476 3300027666 Ga0209282_1000013 Ga0209282_100001399 452
477 3300031967 Ga0315914_1000004 Ga0315914_1000004134 452
478 3300033430 Ga0315913_1000011 Ga0315913_100001157 452
479 3300033464 Ga0315915_1000003 Ga0315915_1000003241 452
480 3300046462 Ga0495651_0106528 Ga0495651_0106528_290_1705 452
481 3300047471 Ga0495684_0021634 Ga0495684_0021634_3508_4923 452
482 iso_pu_bacteria 2509276018 2509371150 452
483 iso_pu_bacteria 2510065059 2510313733 452
484 iso_pu_bacteria 2512875026 2512973225 452
485 iso_pu_bacteria 2513237089 2513603583 452
486 iso_pu_bacteria 2513237156 2513983288 452
487 iso_pu_bacteria 2513237160 2514005823 452
488 iso_pu_bacteria 2517487022 2517571774 452
489 iso_pu_bacteria 2643221595 2643986936 452
490 iso_pu_bacteria 2643221610 2644063679 452
491 iso_pu_bacteria 2643221627 2644158434 452
492 iso_pu_bacteria 2643221675 2644414442 452
493 iso_pu_bacteria 2643221680 2644447970 452
494 iso_pu_bacteria 2643221726 2644690443 452
495 iso_pu_bacteria 2687453392 2688598791 452
496 iso_pu_bacteria 2738543030 2739341891 452
497 iso_pu_bacteria 2784132072 2784312318 452
498 iso_pu_bacteria 2802428858 2802720866 452
499 iso_pu_bacteria 2802428859 2802724470 452
500 iso_pu_bacteria 2802428861 2802737209 452
501 iso_pu_bacteria 2802428862 2802746337 452
502 iso_pu_bacteria 2802428863 2802751826 452
503 iso_pu_bacteria 2840764183 2840764887 452
504 iso_pu_bacteria 2844009547 2844014129 452
505 iso_pu_bacteria 2848992105 2848997155 452
506 iso_pu_bacteria 2855872281 2855875170 452
507 iso_pu_bacteria 2856328259 2856331448 452
508 iso_pu_bacteria 2856334872 2856335216 452
509 iso_pu_bacteria 2857367948 2857369334 452
510 iso_pu_bacteria 2869264136 2869270460 452
511 iso_pu_bacteria 2869271264 2869271549 452
512 iso_pu_bacteria 2874131515 2874136854 452
513 iso_pu_bacteria 2874168670 2874174443 452
514 iso_pu_bacteria 2876399893 2876405995 452
515 iso_pu_bacteria 2876406927 2876410321 452
516 iso_pu_bacteria 2878774303 2878778213 452
517 iso_pu_bacteria 2878781027 2878787193 452
518 iso_pu_bacteria 2881155292 2881155653 452
519 iso_pu_bacteria 2885342637 2885346123 452
520 iso_pu_bacteria 2906363423 2906367470 452
521 iso_pu_bacteria 2906370794 2906373723 452
522 iso_pu_bacteria 2906386501 2906388425 452
523 iso_pu_bacteria 2906393657 2906398318 452
524 iso_pu_bacteria 2906408224 2906412113 452
525 iso_pu_bacteria 2915980308 2915982720 452
526 iso_pu_bacteria 2916061851 2916063894 452
527 iso_pu_bacteria 2921250672 2921256305 452
528 iso_pu_bacteria 2922151315 2922151768 452
529 iso_pu_bacteria 2922172374 2922174446 452
530 iso_pu_bacteria 2922178524 2922180698 452
531 iso_pu_bacteria 2924748358 2924750481 452
532 iso_pu_bacteria 2932416698 2932418877 452
533 iso_pu_bacteria 2937029754 2937030606 452
534 iso_pu_bacteria 2937036028 2937039076 452
535 iso_pu_bacteria 2937078374 2937083947 452
536 iso_pu_bacteria 2937084907 2937090792 452
537 iso_pu_bacteria 2937868953 2937872086 452
538 iso_pu_bacteria 2957437181 2957442450 452
539 iso_pu_bacteria 2958122699 2958124743 452
540 iso_pu_bacteria 2958158011 2958158978 452
541 iso_pu_bacteria 2960591022 2960593144 452
542 iso_pu_bacteria 2960680706 2960682680 452
543 iso_pu_bacteria 2960693952 2960697551 452
544 iso_pu_bacteria 2961136820 2961143391 452
545 iso_pu_bacteria 2965025482 2965026507 452
546 iso_pu_bacteria 2965032056 2965036813 452
547 iso_pu_bacteria 2965040258 2965044552 452
548 iso_pu_bacteria 2965047637 2965050020 452
549 iso_pu_bacteria 2965089291 2965093984 452
550 iso_pu_bacteria 2965102966 2965106369 452
551 iso_pu_bacteria 2965110997 2965115023 452
552 iso_pu_bacteria 2967728569 2967733837 452
553 iso_pu_bacteria 2970026789 2970031984 452
554 iso_pu_bacteria 2970122695 2970122801 452
555 iso_pu_bacteria 2970143518 2970145326 452
556 iso_pu_bacteria 2970489779 2970495695 452
557 iso_pu_bacteria 2970510686 2970512814 452
558 iso_pu_bacteria 2970547951 2970551317 452
559 iso_pu_bacteria 2977530762 2977530877 452
560 iso_pu_bacteria 2977544691 2977546905 452
561 iso_pu_bacteria 2977872689 2977873582 452
562 iso_pu_bacteria 2977935797 2977940891 452
563 iso_pu_bacteria 2977950692 2977952867 452
564 iso_pu_bacteria 2977957713 2977959437 452
565 iso_pu_bacteria 2979793036 2979797742 452
566 iso_pu_bacteria 2987645492 2987648119 452
567 iso_pu_bacteria 2987673487 2987673712 452
568 iso_pu_bacteria 2996386984 2996389358 452
569 iso_pu_bacteria 3004239961 3004245866 452
570 iso_pu_bacteria 643692032 643822214 452
571 iso_pu_bacteria 649633066 649873306 452
572 iso_pu_bacteria 8003999396 8004003443 452
573 iso_pu_bacteria 8004300914 8004304504 452
574 iso_pu_bacteria 8004361976 8004368187 452
575 iso_pu_bacteria 8004695233 8004698876 452
576 3300003215 JGI25153J46596_10006633 JGI25153J46596_100066335 453
577 3300005563 Ga0068855_100010532 Ga0068855_1000105325 453
578 3300005578 Ga0068854_100000056 Ga0068854_100000056115 453
579 3300009093 Ga0105240_10065614 Ga0105240_100656146 453
580 3300010375 Ga0105239_10045237 Ga0105239_100452373 453
581 3300025258 Ga0209129_1010251 Ga0209129_10102511 453
582 3300025297 Ga0209758_1000537 Ga0209758_100053712 453
583 3300025913 Ga0207695_10033043 Ga0207695_100330432 453
584 3300025949 Ga0207667_10000094 Ga0207667_1000009489 453
585 3300025981 Ga0207640_10000043 Ga0207640_10000043126 453
586 3300046506 Ga0495583_0007862 Ga0495583_0007862_4771_6201 453
587 3300048928 Ga0496125_0002729 Ga0496125_0002729_14609_16054 453
588 iso_pu_bacteria 2643221644 2644247713 453
589 iso_pu_bacteria 2751185821 2753461152 453
590 iso_pu_bacteria 2791355094 2792643351 453
591 iso_pu_bacteria 2838029111 2838030949 453
592 iso_pu_bacteria 2842475841 2842477681 453
593 iso_pu_bacteria 2842502639 2842504447 453
594 iso_pu_bacteria 2856356410 2856358374 453
595 iso_pu_bacteria 2871488783 2871491333 453
596 iso_pu_bacteria 2878753008 2878757768 453
597 iso_pu_bacteria 2881861095 2881864965 453
598 iso_pu_bacteria 2882912400 2882915259 453
599 iso_pu_bacteria 2885318864 2885321577 453
600 iso_pu_bacteria 2903492973 2903506443 453
601 iso_pu_bacteria 2904424332 2904427440 453
602 iso_pu_bacteria 2924784321 2924785737 453
603 iso_pu_bacteria 2961170736 2961174311 453
604 iso_pu_bacteria 2967996073 2968000258 453
605 iso_pu_bacteria 2968003550 2968005470 453
606 iso_pu_bacteria 2970503327 2970506898 453
607 iso_pu_bacteria 2977821940 2977822300 453
608 iso_pu_bacteria 2977828996 2977832020 453
609 iso_pu_bacteria 2977986579 2977986799 453
610 iso_pu_bacteria 2979808191 2979812093 453
611 iso_pu_bacteria 8004374579 8004379279 453
612 3300035692 Ga0373935_0061307 Ga0373935_0061307_89_1618 454
613 3300044693 Ga0466961_0006453 Ga0466961_0006453_5703_7136 454
614 3300045049 Ga0466959_0066038 Ga0466959_0066038_313_1746 454
615 3300046512 Ga0495610_0000813 Ga0495610_0000813_24254_25663 454
616 3300046522 Ga0495643_0028814 Ga0495643_0028814_1060_2472 454
617 iso_pu_bacteria 2508501122 2509111487 454
618 iso_pu_bacteria 2512875024 2512958948 454
619 iso_pu_bacteria 2885350715 2885357946 454
620 iso_pu_bacteria 2896384573 2896385936 454
621 iso_pu_bacteria 2903448605 2903455393 454
622 iso_pu_bacteria 2906378014 2906382585 454
623 iso_pu_bacteria 2937848649 2937855119 454
624 iso_pu_bacteria 2968083720 2968090903 454
625 iso_pu_bacteria 2977922695 2977929212 454
626 iso_pu_bacteria 3000135777 3000140249 454
627 iso_pu_bacteria 3004211236 3004216322 454
628 iso_pu_bacteria 3004218560 3004224072 454
629 iso_pu_bacteria 3004334049 3004341337 454
630 3300005288 Ga0065714_10000305 Ga0065714_1000030511 455
631 3300005539 Ga0068853_100025427 Ga0068853_1000254274 455
632 3300005617 Ga0068859_100208336 Ga0068859_1002083362 455
633 3300006931 Ga0097620_100208335 Ga0097620_1002083352 455
634 3300009094 Ga0111539_10000100 Ga0111539_1000010050 455
635 3300009545 Ga0105237_10130343 Ga0105237_101303433 455
636 3300010375 Ga0105239_10205152 Ga0105239_102051521 455
637 3300025206 Ga0209435_100009 Ga0209435_100009237 455
638 3300025246 Ga0209646_1000018 Ga0209646_1000018237 455
639 3300025250 Ga0209026_1000043 Ga0209026_1000043237 455
640 3300025256 Ga0209759_1000007 Ga0209759_1000007237 455
641 3300026041 Ga0207639_10050301 Ga0207639_100503011 455
642 3300028379 Ga0268266_10044597 Ga0268266_100445974 455
643 3300046557 Ga0495622_0000202 Ga0495622_0000202_33159_34589 455
644 3300049579 Ga0501043_0065552 Ga0501043_0065552_395_1855 455
645 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_34290_35747 455
646 iso_pu_bacteria 2524023207 2524452499 455
647 iso_pu_bacteria 2643221618 2644104161 455
648 iso_pu_bacteria 2643221655 2644307035 455
649 iso_pu_bacteria 2643221659 2644331520 455
650 iso_pu_bacteria 2643221698 2644540313 455
651 iso_pu_bacteria 2643221712 2644619272 455
652 iso_pu_bacteria 2773857925 2774870016 455
653 iso_pu_bacteria 2844163670 2844169416 455
654 iso_pu_bacteria 2874123672 2874127524 455
655 iso_pu_bacteria 2882456835 2882461286 455
656 iso_pu_bacteria 2936996657 2936998764 455
657 iso_pu_bacteria 8024486573 8024492453 455
658 3300001979 JGI24740J21852_10000004 JGI24740J21852_1000000418 456
659 3300002704 JGI25155J39150_1000004 JGI25155J39150_100000422 456
660 3300002705 JGI25156J39149_1000014 JGI25156J39149_1000014159 456
661 3300002737 JGI25162J39368_1000670 JGI25162J39368_10006709 456
662 3300002738 JGI25154J39366_1000096 JGI25154J39366_100009632 456
663 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005241 456
664 3300003214 JGI25165J46597_1001403 JGI25165J46597_10014035 456
665 3300025233 Ga0209437_100057 Ga0209437_100057226 456
666 3300025246 Ga0209646_1004842 Ga0209646_10048421 456
667 3300025261 Ga0209233_1000130 Ga0209233_100013028 456
668 3300030500 Ga0268256_1011759 Ga0268256_10117592 456
669 3300037471 Ga0395905_0189005 Ga0395905_0189005_471_1922 456
670 3300042010 Ga0439452_004214 Ga0439452_004214_1072_2502 456
671 3300042010 Ga0439452_006400 Ga0439452_006400_1188_2618 456
672 3300042185 Ga0450909_000154 Ga0450909_000154_5197_6627 456
673 3300046522 Ga0495643_0012472 Ga0495643_0012472_893_2323 456
674 3300046674 Ga0495588_0002907 Ga0495588_0002907_2254_3684 456
675 3300048922 Ga0496119_0026392 Ga0496119_0026392_2118_3581 456
676 3300048925 Ga0496122_0016932 Ga0496122_0016932_3381_4844 456
677 3300048926 Ga0496123_0032039 Ga0496123_0032039_636_2099 456
678 3300048927 Ga0496124_0018862 Ga0496124_0018862_1515_2978 456
679 3300048928 Ga0496125_0041900 Ga0496125_0041900_1977_3440 456
680 3300049459 Ga0495678_011653 Ga0495678_011653_1167_2597 456
681 iso_pu_bacteria 2512875016 2512931137 456
682 iso_pu_bacteria 2582581315 2585326525 456
683 iso_pu_bacteria 2667528174 2671113462 456
684 iso_pu_bacteria 2721755523 2722883147 456
685 iso_pu_bacteria 2775507266 2778178640 456
686 iso_pu_bacteria 2818991448 2819611255 456
687 iso_pu_bacteria 2839138175 2839143666 456
688 iso_pu_bacteria 2876363079 2876365606 456
689 iso_pu_bacteria 2903521522 2903523535 456
690 iso_pu_bacteria 2903528002 2903534169 456
691 iso_pu_bacteria 2919408235 2919411081 456
692 iso_pu_bacteria 2963644680 2963648081 456
693 iso_pu_bacteria 637000159 637074238 456
694 iso_pu_bacteria 8005645114 8005646965 456
695 iso_pu_bacteria 8005682033 8005688115 456
696 3300025925 Ga0207650_10037522 Ga0207650_100375225 457
697 3300027907 Ga0207428_10092959 Ga0207428_100929593 457
698 3300050492 nmdc:mga0yw44_14127_c1 nmdc:mga0yw44_14127_c1_1174_2619 457
699 2124908027 MRS2a_Contig_222 MRS2a_00124630 458
700 3300005563 Ga0068855_100194899 Ga0068855_1001948992 458
701 3300009093 Ga0105240_10000013 Ga0105240_10000013226 458
702 3300009545 Ga0105237_10005220 Ga0105237_1000522011 458
703 3300010375 Ga0105239_10004443 Ga0105239_1000444317 458
704 3300013104 Ga0157370_10003433 Ga0157370_1000343310 458
705 3300015262 Ga0182007_10002371 Ga0182007_100023714 458
706 3300025253 Ga0209677_100382 Ga0209677_10038211 458
707 3300025261 Ga0209233_1000358 Ga0209233_100035823 458
708 3300025913 Ga0207695_10000044 Ga0207695_10000044183 458
709 3300025914 Ga0207671_10000400 Ga0207671_1000040049 458
710 3300048903 Ga0496100_0006646 Ga0496100_0006646_1831_3291 458
711 3300048905 Ga0496102_0041392 Ga0496102_0041392_1042_2502 458
712 3300048906 Ga0496103_0012713 Ga0496103_0012713_449_1909 458
713 3300048916 Ga0496113_0059542 Ga0496113_0059542_860_2320 458
714 3300048919 Ga0496116_0026740 Ga0496116_0026740_411_1994 458
715 3300048920 Ga0496117_0011833 Ga0496117_0011833_2028_3488 458
716 3300048921 Ga0496118_0013506 Ga0496118_0013506_1978_3438 458
717 3300048923 Ga0496120_0011566 Ga0496120_0011566_4479_5939 458
718 3300048924 Ga0496121_0049280 Ga0496121_0049280_122_1582 458
719 3300048925 Ga0496122_0045378 Ga0496122_0045378_1155_2615 458
720 3300048926 Ga0496123_0014523 Ga0496123_0014523_3023_4483 458
721 3300048928 Ga0496125_0019592 Ga0496125_0019592_1904_3364 458
722 3300053125 Ga0500618_005740 Ga0500618_005740_1898_3358 458
723 iso_pu_bacteria 2582581308 2585280736 458
724 iso_pu_bacteria 2582581316 2585334129 458
725 iso_pu_bacteria 2585427527 2585531669 458
726 iso_pu_bacteria 2585427530 2585551384 458
727 iso_pu_bacteria 2615840626 2616306719 458
728 iso_pu_bacteria 2617270742 2617386383 458
729 iso_pu_bacteria 2808606982 2811842972 458
730 iso_pu_bacteria 2818991453 2819638814 458
731 iso_pu_bacteria 2842482326 2842484987 458
732 iso_pu_bacteria 3005416602 3005421607 458
733 iso_pu_bacteria 8005314921 8005319688 458
734 iso_pu_bacteria 8005484373 8005490312 458

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

71

464

0.93

PF05977

MFS_3

Transmembrane secretion effector

59

248

0.91

PF00083

Sugar_tr

Sugar (and other) transporter

65

243

0.9

PF12832

MFS_1_like

MFS_1 like family

92

225

0.87

PF07690

MFS_1

Major Facilitator Superfamily

321

525

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9137 20 425
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8993 16 426
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8973 16 426
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8738 19 442
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8665 20 442
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9535 22 203 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9521 20 191 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9492 21 259 1.20.1250.20
af_P9WJX3_18_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9478 19 193 1.20.1250.20
af_Q9HE13_92_349_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9396 23 268 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A257QZJ3-F1-model_v4 EmrB/QacA family drug resistance transporter 0.9744 16 189 GO:0005886
GO:0022857
AF-A0A537NMT5-F1-model_v4 MFS transporter 0.9657 19 169 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.956 25 161 GO:0005886
GO:0022857
AF-A0A242MTR8-F1-model_v4 MFS permease 0.9547 19 167 GO:0016020
GO:0022857
AF-A0A1S4CMP2-F1-model_v4 Monosaccharide-sensing protein 1-like 0.9403 14 136 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.33 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map