F478138
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 541 | 465 | 465 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10004443|Ga0105239_1000444317 |
| Length | 527 |
| Sequence | MISPKHSVKRTNKMQMVRVPPYQAKSYLSARTSQTSPETELMLKPIIERPDKTEAGRMKAAPSIRWALASLSLSMLMPSLDTSIANVGLPTLAEAFGASFQQVQWIVLAYLLAITALIVSVGRLGDIVGRRRLLLAGIALFTLASLFCGIAPTLWLLIAARALQGLGAAMMMALTVAMVGETVPKERTGSAMGLLGTMSAIGTTLGPSLGGVLIAGFGWETLFLVNVPLGIANFLLAARFLPVDRPNRKAGQGRPDAIGTLLLALTLAAYALAMTMGHGSFGVLNIGLLLAAAFGTALFAFTEAKVKSPLVRLTMFRDSALSVGLAMSTLVSTVMMATLVVGPFYLSRALGLDAAHVGAVMSAGPLVAALTGVPAGRIVDRFGAHRMTITGLVAMIIGLFLVAAMQGRFGVVGYIGPLALVTANYALFQAANNTTIMTNIRPDQRGVISGMLSLSRNLGLITGASVMGAVFTLASGTTGITTARPEAIATGMQVTFAIAALLIVAALVVALTGFAIAKRTALSEQAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 8 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 9 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 10 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 11 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 12 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 13 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 14 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 15 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 16 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 17 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 18 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 19 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 20 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 21 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 22 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 23 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 24 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 25 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 26 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 27 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 28 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 29 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 30 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 31 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 32 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 33 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 34 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 35 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 36 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 37 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 38 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 39 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 40 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 41 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 42 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 43 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 44 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 45 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 46 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 47 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 48 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 49 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 50 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 51 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 52 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 53 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 54 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 55 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 56 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 57 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 58 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 59 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 60 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 61 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 62 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 63 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 64 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 65 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 66 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 67 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 68 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 69 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 70 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 71 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 72 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 73 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 74 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 75 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 76 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 77 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 78 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 79 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 80 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 81 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 82 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 83 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 84 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 85 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 86 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 87 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 88 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 89 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 90 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 91 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 92 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 93 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 94 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 95 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 96 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 97 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 98 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 99 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 100 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 101 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 102 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 103 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 104 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 105 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 106 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 107 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 108 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 109 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 110 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 111 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 112 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 113 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 114 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 115 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 116 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 117 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 118 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 119 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 120 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 121 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 122 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 123 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 124 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 125 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 126 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 127 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 128 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 129 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 130 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 131 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 132 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 133 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 134 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 135 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 136 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 137 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 138 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 139 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 140 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 141 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 142 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 143 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 144 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 145 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 146 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 147 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 148 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 149 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 150 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 151 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 152 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 153 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 154 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 155 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 156 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 157 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 158 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 159 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 160 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 161 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 162 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 163 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 164 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 165 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 166 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 167 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 168 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 169 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 170 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 171 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 172 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 173 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 174 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 175 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 176 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 177 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 178 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 179 | 2941479691 | |||
| 180 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 181 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 182 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 183 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 184 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 185 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 186 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 187 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 188 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 189 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 190 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 191 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 192 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 193 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 194 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 195 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 196 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 197 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 198 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 199 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 200 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 201 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 202 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 203 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 204 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 205 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 206 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 207 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 208 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 209 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 210 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 211 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 212 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 213 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 214 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 215 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 216 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 217 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 218 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 219 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 220 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 221 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 222 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 223 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 224 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 225 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 226 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 227 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 228 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 229 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 230 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 231 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 232 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 233 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 234 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 235 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 236 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 237 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 238 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 239 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 240 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 241 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 242 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 243 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 244 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 245 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 246 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 247 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 248 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 249 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 250 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 251 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 252 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 253 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 254 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 255 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 256 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 257 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 258 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 259 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 260 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 261 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 262 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 263 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 264 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 265 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 266 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 267 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 268 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 270 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 273 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 278 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 279 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 280 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 281 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 283 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 284 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 286 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 287 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 288 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 289 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 290 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 291 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 292 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 293 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 294 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 295 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 296 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 297 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 298 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 299 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 300 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 302 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 303 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 305 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 306 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 315 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 316 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 318 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 319 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 320 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 321 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 322 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 325 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 326 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 327 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 329 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 330 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 331 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 332 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 333 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 334 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 335 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 336 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 337 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 338 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 339 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 340 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 341 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 342 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 343 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 344 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 372 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 373 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 374 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 376 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 377 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 378 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 379 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 380 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 381 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 382 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 383 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 384 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 385 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 386 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 387 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 388 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 389 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 390 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 391 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 392 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 393 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 394 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 395 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 396 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 397 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 398 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 399 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 400 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 401 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 402 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 403 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 404 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 405 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 406 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 407 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 408 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 409 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 410 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 411 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 412 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 413 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 414 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 415 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 466 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 467 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 468 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 469 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 470 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 471 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 472 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 473 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 474 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 475 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 476 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 477 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 478 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 479 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 480 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 481 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 482 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 483 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 484 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 485 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 486 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 487 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 488 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 489 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 492 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 493 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 498 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 503 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 505 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 506 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 507 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 508 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 509 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 510 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 511 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 512 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 513 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 514 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 515 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 516 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 518 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 519 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 521 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 522 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 523 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 524 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 525 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 526 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 527 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 528 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 529 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 530 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 531 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 532 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 533 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 534 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 535 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 536 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 537 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 538 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 539 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 540 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 541 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 63.35 |
| Metatranscriptomes | 0 |
| Isolates | 36.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.54 |
| Nodule | 25.61 |
| Rhizoplane | 4.63 |
| Rhizosphere | 48.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_222 | 2124908027 | Bacteria | 16053 |
| 2 | JGI24740J21852_10000004 | 3300001979 | Bacteria | 91019 |
| 3 | JGI24737J22298_10004055 | 3300001990 | Bacteria | 5122 |
| 4 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 5 | JGI25156J39149_1000014 | 3300002705 | Bacteria | 189257 |
| 6 | JGI25162J39368_1000670 | 3300002737 | Bacteria | 24190 |
| 7 | JGI25162J39368_1001910 | 3300002737 | Bacteria | 9544 |
| 8 | JGI25154J39366_1000096 | 3300002738 | Bacteria | 79168 |
| 9 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 10 | JGI25151J46595_10015201 | 3300003187 | Bacteria | 3404 |
| 11 | JGI25165J46597_1001403 | 3300003214 | Bacteria | 13115 |
| 12 | JGI25165J46597_1001922 | 3300003214 | Bacteria | 8293 |
| 13 | JGI25153J46596_10001939 | 3300003215 | Bacteria | 12282 |
| 14 | JGI25153J46596_10006633 | 3300003215 | Bacteria | 5825 |
| 15 | rootH1_10083839 | 3300003316 | Bacteria | 2851 |
| 16 | rootH2_10033048 | 3300003320 | Bacteria | 10091 |
| 17 | rootL2_10123289 | 3300003322 | Bacteria | 2261 |
| 18 | rootH1_10063462 | 3300003323 | Bacteria | 6542 |
| 19 | Ga0055542_1000839 | 3300003762 | Bacteria | 21795 |
| 20 | Ga0065165_1007717 | 3300005262 | Bacteria | 5209 |
| 21 | Ga0065714_10000305 | 3300005288 | Bacteria | 11964 |
| 22 | Ga0065714_10006583 | 3300005288 | Bacteria | 7426 |
| 23 | Ga0065714_10076125 | 3300005288 | Bacteria | 2826 |
| 24 | Ga0065714_10088436 | 3300005288 | Bacteria | 2017 |
| 25 | Ga0065715_10002056 | 3300005293 | Bacteria | 5661 |
| 26 | Ga0070658_10011003 | 3300005327 | Bacteria | 7252 |
| 27 | Ga0070658_10041052 | 3300005327 | Bacteria | 3733 |
| 28 | Ga0070658_10114001 | 3300005327 | Bacteria | 2241 |
| 29 | Ga0070683_100042696 | 3300005329 | Bacteria | 4176 |
| 30 | Ga0070670_100060006 | 3300005331 | Bacteria | 3265 |
| 31 | Ga0070660_100046034 | 3300005339 | Bacteria | 3343 |
| 32 | Ga0070687_100006936 | 3300005343 | Bacteria | 4682 |
| 33 | Ga0070661_100015245 | 3300005344 | Bacteria | 5425 |
| 34 | Ga0070661_100093086 | 3300005344 | Bacteria | 2233 |
| 35 | Ga0070671_100035995 | 3300005355 | Bacteria | 4103 |
| 36 | Ga0070714_100034145 | 3300005435 | Bacteria | 4258 |
| 37 | Ga0070714_100060880 | 3300005435 | Bacteria | 3241 |
| 38 | Ga0070663_100010866 | 3300005455 | Bacteria | 5687 |
| 39 | Ga0070663_100045377 | 3300005455 | Bacteria | 3104 |
| 40 | Ga0070681_10090096 | 3300005458 | Bacteria | 3018 |
| 41 | Ga0070679_100066453 | 3300005530 | Bacteria | 3594 |
| 42 | Ga0070684_100017827 | 3300005535 | Bacteria | 5836 |
| 43 | Ga0068853_100000769 | 3300005539 | Bacteria | 22243 |
| 44 | Ga0068853_100025427 | 3300005539 | Bacteria | 4967 |
| 45 | Ga0068853_100030296 | 3300005539 | Bacteria | 4569 |
| 46 | Ga0068853_100037371 | 3300005539 | Bacteria | 4131 |
| 47 | Ga0068853_100117831 | 3300005539 | Bacteria | 2366 |
| 48 | Ga0070672_100000700 | 3300005543 | Bacteria | 19849 |
| 49 | Ga0070665_100010800 | 3300005548 | Bacteria | 9235 |
| 50 | Ga0070665_100104702 | 3300005548 | Bacteria | 2831 |
| 51 | Ga0068855_100003263 | 3300005563 | Bacteria | 19852 |
| 52 | Ga0068855_100010532 | 3300005563 | Bacteria | 11152 |
| 53 | Ga0068855_100013519 | 3300005563 | Bacteria | 9842 |
| 54 | Ga0068855_100018293 | 3300005563 | Bacteria | 8417 |
| 55 | Ga0068855_100085765 | 3300005563 | Bacteria | 3643 |
| 56 | Ga0068855_100119141 | 3300005563 | Bacteria | 3022 |
| 57 | Ga0068855_100194899 | 3300005563 | Bacteria | 2283 |
| 58 | Ga0070664_100045925 | 3300005564 | Bacteria | 3689 |
| 59 | Ga0068857_100000436 | 3300005577 | Bacteria | 29551 |
| 60 | Ga0068857_100053343 | 3300005577 | Bacteria | 3587 |
| 61 | Ga0068857_100060748 | 3300005577 | Bacteria | 3357 |
| 62 | Ga0068854_100000056 | 3300005578 | Bacteria | 82924 |
| 63 | Ga0068854_100014066 | 3300005578 | Bacteria | 5269 |
| 64 | Ga0068854_100097767 | 3300005578 | Bacteria | 2195 |
| 65 | Ga0068856_100304891 | 3300005614 | Bacteria | 1610 |
| 66 | Ga0068852_100139096 | 3300005616 | Bacteria | 2245 |
| 67 | Ga0068859_100208336 | 3300005617 | Bacteria | 2041 |
| 68 | Ga0068859_100284352 | 3300005617 | Bacteria | 1747 |
| 69 | Ga0068864_100065800 | 3300005618 | Bacteria | 3144 |
| 70 | Ga0068861_100180889 | 3300005719 | Bacteria | 1755 |
| 71 | Ga0068851_10001004 | 3300005834 | Bacteria | 12245 |
| 72 | Ga0068851_10004431 | 3300005834 | Bacteria | 6331 |
| 73 | Ga0068863_100010114 | 3300005841 | Bacteria | 9174 |
| 74 | Ga0068863_100226920 | 3300005841 | Bacteria | 1801 |
| 75 | Ga0081539_10005268 | 3300005985 | Bacteria | 13337 |
| 76 | Ga0075365_10008710 | 3300006038 | Bacteria | 5781 |
| 77 | Ga0075365_10016144 | 3300006038 | Bacteria | 4534 |
| 78 | Ga0075363_100005206 | 3300006048 | Bacteria | 5761 |
| 79 | Ga0075362_10000003 | 3300006177 | Bacteria | 171099 |
| 80 | Ga0075367_10002906 | 3300006178 | Bacteria | 7980 |
| 81 | Ga0075369_10001406 | 3300006186 | Bacteria | 8191 |
| 82 | Ga0075369_10004715 | 3300006186 | Bacteria | 5059 |
| 83 | Ga0097621_100033411 | 3300006237 | Bacteria | 4097 |
| 84 | Ga0075370_10001512 | 3300006353 | Bacteria | 10167 |
| 85 | Ga0068865_100022643 | 3300006881 | Bacteria | 4102 |
| 86 | Ga0097620_100208335 | 3300006931 | Bacteria | 2041 |
| 87 | Ga0097620_100284355 | 3300006931 | Bacteria | 1747 |
| 88 | Ga0079104_1000007 | 3300006946 | Bacteria | 390531 |
| 89 | Ga0079104_1003920 | 3300006946 | Bacteria | 6646 |
| 90 | Ga0105244_10007446 | 3300009036 | Bacteria | 6959 |
| 91 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 92 | Ga0105240_10065614 | 3300009093 | Bacteria | 4506 |
| 93 | Ga0111539_10000100 | 3300009094 | Bacteria | 91427 |
| 94 | Ga0111539_10041691 | 3300009094 | Bacteria | 5517 |
| 95 | Ga0114129_10037370 | 3300009147 | Bacteria | 6856 |
| 96 | Ga0105243_10001488 | 3300009148 | Bacteria | 20504 |
| 97 | Ga0105241_10010112 | 3300009174 | Bacteria | 6927 |
| 98 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 99 | Ga0105237_10005220 | 3300009545 | Bacteria | 14694 |
| 100 | Ga0105237_10130343 | 3300009545 | Bacteria | 2509 |
| 101 | Ga0105237_10177669 | 3300009545 | Bacteria | 2129 |
| 102 | Ga0105238_10049578 | 3300009551 | Bacteria | 4227 |
| 103 | Ga0105238_10176236 | 3300009551 | Bacteria | 2115 |
| 104 | Ga0105249_10055894 | 3300009553 | Bacteria | 3613 |
| 105 | Ga0123342_1000455 | 3300009766 | Bacteria | 64500 |
| 106 | Ga0099796_10006581 | 3300010159 | Bacteria | 2985 |
| 107 | Ga0105239_10003240 | 3300010375 | Bacteria | 20106 |
| 108 | Ga0105239_10004443 | 3300010375 | Bacteria | 16762 |
| 109 | Ga0105239_10045237 | 3300010375 | Bacteria | 4824 |
| 110 | Ga0105239_10205152 | 3300010375 | Bacteria | 2209 |
| 111 | Ga0157314_1000522 | 3300012500 | Bacteria | 3627 |
| 112 | Ga0157373_10016254 | 3300013100 | Bacteria | 5431 |
| 113 | Ga0157373_10021379 | 3300013100 | Bacteria | 4700 |
| 114 | Ga0157371_10001861 | 3300013102 | Bacteria | 21161 |
| 115 | Ga0157371_10078920 | 3300013102 | Bacteria | 2332 |
| 116 | Ga0157370_10003433 | 3300013104 | Bacteria | 18605 |
| 117 | Ga0157370_10006851 | 3300013104 | Bacteria | 12477 |
| 118 | Ga0157370_10111199 | 3300013104 | Bacteria | 2561 |
| 119 | Ga0163162_10307152 | 3300013306 | Bacteria | 1718 |
| 120 | Ga0157375_10000034 | 3300013308 | Bacteria | 184385 |
| 121 | Ga0163163_10069987 | 3300014325 | Bacteria | 3494 |
| 122 | Ga0182008_10015402 | 3300014497 | Bacteria | 3989 |
| 123 | Ga0182006_1001162 | 3300015261 | Bacteria | 16594 |
| 124 | Ga0182007_10000898 | 3300015262 | Bacteria | 16505 |
| 125 | Ga0182007_10002371 | 3300015262 | Bacteria | 9423 |
| 126 | Ga0163161_10025204 | 3300017792 | Bacteria | 4208 |
| 127 | Ga0214542_1010266 | 3300021321 | Bacteria | 13792 |
| 128 | Ga0214543_1000156 | 3300021327 | Bacteria | 96889 |
| 129 | Ga0213876_10003348 | 3300021384 | Bacteria | 9178 |
| 130 | Ga0228711_1000006 | 3300022739 | Bacteria | 202437 |
| 131 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 132 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 133 | Ga0209760_100936 | 3300025207 | Bacteria | 3586 |
| 134 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 135 | Ga0209437_100107 | 3300025233 | Bacteria | 218656 |
| 136 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 137 | Ga0209646_1004842 | 3300025246 | Bacteria | 2414 |
| 138 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 139 | Ga0209677_100382 | 3300025253 | Bacteria | 27101 |
| 140 | Ga0209148_1000050 | 3300025254 | Bacteria | 413178 |
| 141 | Ga0209148_1006050 | 3300025254 | Bacteria | 2669 |
| 142 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 143 | Ga0209759_1008451 | 3300025256 | Bacteria | 3202 |
| 144 | Ga0209129_1010251 | 3300025258 | Bacteria | 2362 |
| 145 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 146 | Ga0209233_1000178 | 3300025261 | Bacteria | 140956 |
| 147 | Ga0209233_1000358 | 3300025261 | Bacteria | 41919 |
| 148 | Ga0209455_1000183 | 3300025272 | Bacteria | 99952 |
| 149 | Ga0209676_1000065 | 3300025292 | Bacteria | 318605 |
| 150 | Ga0209025_1000216 | 3300025294 | Bacteria | 138307 |
| 151 | Ga0209025_1011346 | 3300025294 | Bacteria | 5886 |
| 152 | Ga0209758_1000188 | 3300025297 | Bacteria | 138749 |
| 153 | Ga0209758_1000537 | 3300025297 | Bacteria | 60204 |
| 154 | Ga0209050_1014585 | 3300025298 | Bacteria | 3370 |
| 155 | Ga0207655_1001260 | 3300025728 | Bacteria | 24152 |
| 156 | Ga0207705_10005324 | 3300025909 | Bacteria | 9625 |
| 157 | Ga0207705_10011361 | 3300025909 | Bacteria | 6448 |
| 158 | Ga0207707_10025476 | 3300025912 | Bacteria | 5173 |
| 159 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 160 | Ga0207695_10012305 | 3300025913 | Bacteria | 10280 |
| 161 | Ga0207695_10013689 | 3300025913 | Bacteria | 9655 |
| 162 | Ga0207695_10033043 | 3300025913 | Bacteria | 5652 |
| 163 | Ga0207695_10119767 | 3300025913 | Bacteria | 2602 |
| 164 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 165 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 166 | Ga0207671_10000400 | 3300025914 | Bacteria | 60604 |
| 167 | Ga0207660_10011068 | 3300025917 | Bacteria | 5867 |
| 168 | Ga0207662_10013471 | 3300025918 | Bacteria | 4573 |
| 169 | Ga0207657_10007495 | 3300025919 | Bacteria | 11184 |
| 170 | Ga0207657_10019888 | 3300025919 | Bacteria | 6361 |
| 171 | Ga0207649_10069631 | 3300025920 | Bacteria | 2241 |
| 172 | Ga0207652_10020020 | 3300025921 | Bacteria | 5509 |
| 173 | Ga0207694_10180774 | 3300025924 | Bacteria | 1710 |
| 174 | Ga0207650_10037522 | 3300025925 | Bacteria | 3532 |
| 175 | Ga0207664_10079101 | 3300025929 | Bacteria | 2668 |
| 176 | Ga0207709_10000172 | 3300025935 | Bacteria | 86654 |
| 177 | Ga0207691_10002020 | 3300025940 | Bacteria | 19862 |
| 178 | Ga0207679_10040382 | 3300025945 | Bacteria | 3340 |
| 179 | Ga0207667_10000094 | 3300025949 | Bacteria | 145771 |
| 180 | Ga0207667_10000238 | 3300025949 | Bacteria | 76840 |
| 181 | Ga0207667_10003694 | 3300025949 | Bacteria | 18862 |
| 182 | Ga0207667_10020552 | 3300025949 | Bacteria | 7338 |
| 183 | Ga0207640_10000043 | 3300025981 | Bacteria | 102669 |
| 184 | Ga0207640_10000277 | 3300025981 | Bacteria | 34453 |
| 185 | Ga0207639_10001206 | 3300026041 | Bacteria | 17558 |
| 186 | Ga0207639_10050301 | 3300026041 | Bacteria | 3165 |
| 187 | Ga0207678_10008151 | 3300026067 | Bacteria | 9239 |
| 188 | Ga0207678_10031845 | 3300026067 | Bacteria | 4598 |
| 189 | Ga0207702_10086814 | 3300026078 | Bacteria | 2729 |
| 190 | Ga0207641_10062147 | 3300026088 | Bacteria | 3186 |
| 191 | Ga0207641_10117943 | 3300026088 | Bacteria | 2364 |
| 192 | Ga0207674_10000074 | 3300026116 | Bacteria | 105369 |
| 193 | Ga0207674_10002846 | 3300026116 | Bacteria | 21521 |
| 194 | Ga0207674_10021913 | 3300026116 | Bacteria | 6873 |
| 195 | Ga0207674_10064094 | 3300026116 | Bacteria | 3707 |
| 196 | Ga0209281_1000020 | 3300027111 | Bacteria | 575972 |
| 197 | Ga0209281_1000102 | 3300027111 | Bacteria | 221665 |
| 198 | Ga0209282_1000013 | 3300027666 | Bacteria | 215053 |
| 199 | Ga0207428_10000096 | 3300027907 | Bacteria | 123081 |
| 200 | Ga0207428_10092959 | 3300027907 | Bacteria | 2340 |
| 201 | Ga0268266_10019839 | 3300028379 | Bacteria | 5730 |
| 202 | Ga0268266_10044597 | 3300028379 | Bacteria | 3791 |
| 203 | Ga0307515_10000011 | 3300028794 | Bacteria | 633903 |
| 204 | Ga0307515_10001041 | 3300028794 | Bacteria | 63402 |
| 205 | Ga0307515_10001245 | 3300028794 | Bacteria | 58063 |
| 206 | Ga0307515_10014858 | 3300028794 | Bacteria | 14393 |
| 207 | Ga0307515_10099050 | 3300028794 | Bacteria | 3543 |
| 208 | Ga0268256_1011759 | 3300030500 | Bacteria | 2747 |
| 209 | Ga0307513_10000004 | 3300031456 | Bacteria | 558931 |
| 210 | Ga0307513_10000011 | 3300031456 | Bacteria | 354929 |
| 211 | Ga0307513_10021757 | 3300031456 | Bacteria | 7564 |
| 212 | Ga0307508_10001284 | 3300031616 | Bacteria | 28530 |
| 213 | Ga0307514_10000722 | 3300031649 | Bacteria | 57107 |
| 214 | Ga0307514_10002190 | 3300031649 | Bacteria | 20986 |
| 215 | Ga0307516_10000046 | 3300031730 | Bacteria | 130851 |
| 216 | Ga0307413_10057325 | 3300031824 | Bacteria | 2381 |
| 217 | Ga0307407_10000948 | 3300031903 | Bacteria | 9860 |
| 218 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 219 | Ga0307414_10001606 | 3300032004 | Bacteria | 11747 |
| 220 | Ga0307415_100007608 | 3300032126 | Bacteria | 5938 |
| 221 | Ga0307507_10116268 | 3300033179 | Bacteria | 2161 |
| 222 | Ga0315913_1000011 | 3300033430 | Bacteria | 140532 |
| 223 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 224 | Ga0316574_0016352 | 3300035398 | Bacteria | 4322 |
| 225 | Ga0373935_0061307 | 3300035692 | Bacteria | 2408 |
| 226 | Ga0373927_0000048 | 3300035695 | Bacteria | 86106 |
| 227 | Ga0373925_0001567 | 3300037068 | Bacteria | 19370 |
| 228 | Ga0395900_0012611 | 3300037418 | Bacteria | 8643 |
| 229 | Ga0395905_0001527 | 3300037471 | Bacteria | 27687 |
| 230 | Ga0395905_0002046 | 3300037471 | Bacteria | 23048 |
| 231 | Ga0395905_0007463 | 3300037471 | Bacteria | 10872 |
| 232 | Ga0395905_0189005 | 3300037471 | Bacteria | 1932 |
| 233 | Ga0395901_0001188 | 3300038443 | Bacteria | 27720 |
| 234 | Ga0436365_0120529 | 3300039437 | Bacteria | 8359 |
| 235 | Ga0439438_003703 | 3300041405 | Bacteria | 6082 |
| 236 | Ga0439447_000014 | 3300041407 | Bacteria | 72178 |
| 237 | Ga0439466_0002142 | 3300041411 | Bacteria | 7738 |
| 238 | Ga0439451_000635 | 3300042009 | Bacteria | 6668 |
| 239 | Ga0439451_001281 | 3300042009 | Bacteria | 4958 |
| 240 | Ga0439451_007886 | 3300042009 | Bacteria | 2161 |
| 241 | Ga0439452_004214 | 3300042010 | Bacteria | 4872 |
| 242 | Ga0439452_006400 | 3300042010 | Bacteria | 3689 |
| 243 | Ga0439463_004121 | 3300042016 | Bacteria | 3651 |
| 244 | Ga0450919_003654 | 3300042121 | Bacteria | 1909 |
| 245 | Ga0450905_000726 | 3300042142 | Bacteria | 4029 |
| 246 | Ga0450907_000146 | 3300042146 | Bacteria | 26937 |
| 247 | Ga0450909_000154 | 3300042185 | Bacteria | 7356 |
| 248 | Ga0450909_006941 | 3300042185 | Bacteria | 1633 |
| 249 | Ga0439434_0000153 | 3300042435 | Bacteria | 18390 |
| 250 | Ga0439464_0000460 | 3300042439 | Bacteria | 8157 |
| 251 | Ga0439460_0002759 | 3300042461 | Bacteria | 4226 |
| 252 | Ga0450918_000060 | 3300042531 | Bacteria | 21957 |
| 253 | Ga0439440_0011138 | 3300042993 | Bacteria | 1892 |
| 254 | Ga0466961_0006453 | 3300044693 | Bacteria | 7447 |
| 255 | Ga0466959_0066038 | 3300045049 | Bacteria | 2624 |
| 256 | Ga0451576_0147559 | 3300045051 | Bacteria | 2453 |
| 257 | Ga0495617_002636 | 3300046452 | Bacteria | 7008 |
| 258 | Ga0495603_0000930 | 3300046455 | Bacteria | 16822 |
| 259 | Ga0495590_0015385 | 3300046457 | Bacteria | 2777 |
| 260 | Ga0495638_0035873 | 3300046460 | Bacteria | 3159 |
| 261 | Ga0495638_0053280 | 3300046460 | Bacteria | 2518 |
| 262 | Ga0495651_0106528 | 3300046462 | Bacteria | 2078 |
| 263 | Ga0495650_0001441 | 3300046471 | Bacteria | 22950 |
| 264 | Ga0495650_0012043 | 3300046471 | Bacteria | 4680 |
| 265 | Ga0495650_0018092 | 3300046471 | Bacteria | 3513 |
| 266 | Ga0495605_0000114 | 3300046474 | Bacteria | 103834 |
| 267 | Ga0495605_0003571 | 3300046474 | Bacteria | 9216 |
| 268 | Ga0495605_0026142 | 3300046474 | Bacteria | 3036 |
| 269 | Ga0495639_0000001 | 3300046475 | Bacteria | 204442 |
| 270 | Ga0495584_0000086 | 3300046491 | Bacteria | 64500 |
| 271 | Ga0495584_0001610 | 3300046491 | Bacteria | 13285 |
| 272 | Ga0495584_0004386 | 3300046491 | Bacteria | 7599 |
| 273 | Ga0495585_0000756 | 3300046492 | Bacteria | 28639 |
| 274 | Ga0495585_0000811 | 3300046492 | Bacteria | 27233 |
| 275 | Ga0495585_0001747 | 3300046492 | Bacteria | 16555 |
| 276 | Ga0495585_0001985 | 3300046492 | Bacteria | 15206 |
| 277 | Ga0495594_0004250 | 3300046499 | Bacteria | 7356 |
| 278 | Ga0495607_0002550 | 3300046501 | Bacteria | 14728 |
| 279 | Ga0495607_0007673 | 3300046501 | Bacteria | 7434 |
| 280 | Ga0495607_0053905 | 3300046501 | Bacteria | 2320 |
| 281 | Ga0495607_0087746 | 3300046501 | Bacteria | 1692 |
| 282 | Ga0495583_0000959 | 3300046506 | Bacteria | 33478 |
| 283 | Ga0495583_0007862 | 3300046506 | Bacteria | 6620 |
| 284 | Ga0495583_0011682 | 3300046506 | Bacteria | 5029 |
| 285 | Ga0495583_0038363 | 3300046506 | Bacteria | 2263 |
| 286 | Ga0495606_0004670 | 3300046507 | Bacteria | 13535 |
| 287 | Ga0495606_0013066 | 3300046507 | Bacteria | 6596 |
| 288 | Ga0495606_0075194 | 3300046507 | Bacteria | 2114 |
| 289 | Ga0495610_0000813 | 3300046512 | Bacteria | 29272 |
| 290 | Ga0495610_0008005 | 3300046512 | Bacteria | 6926 |
| 291 | Ga0495616_0000480 | 3300046513 | Bacteria | 30368 |
| 292 | Ga0495616_0009080 | 3300046513 | Bacteria | 5832 |
| 293 | Ga0495616_0025257 | 3300046513 | Bacteria | 3176 |
| 294 | Ga0495631_0008437 | 3300046518 | Bacteria | 5192 |
| 295 | Ga0495632_0000455 | 3300046519 | Bacteria | 38969 |
| 296 | Ga0495632_0001698 | 3300046519 | Bacteria | 17954 |
| 297 | Ga0495632_0007967 | 3300046519 | Bacteria | 6579 |
| 298 | Ga0495637_0001301 | 3300046520 | Bacteria | 14990 |
| 299 | Ga0495637_0010096 | 3300046520 | Bacteria | 4580 |
| 300 | Ga0495643_0005726 | 3300046522 | Bacteria | 8315 |
| 301 | Ga0495643_0012472 | 3300046522 | Bacteria | 5127 |
| 302 | Ga0495643_0028814 | 3300046522 | Bacteria | 3110 |
| 303 | Ga0495643_0046678 | 3300046522 | Bacteria | 2347 |
| 304 | Ga0495648_0009876 | 3300046524 | Bacteria | 7333 |
| 305 | Ga0495648_0022911 | 3300046524 | Bacteria | 4287 |
| 306 | Ga0495663_0001725 | 3300046525 | Bacteria | 6785 |
| 307 | Ga0495642_0000162 | 3300046528 | Bacteria | 38956 |
| 308 | Ga0495654_0001192 | 3300046530 | Bacteria | 18488 |
| 309 | Ga0495654_0016938 | 3300046530 | Bacteria | 3838 |
| 310 | Ga0495609_0003974 | 3300046538 | Bacteria | 8270 |
| 311 | Ga0495609_0033289 | 3300046538 | Bacteria | 2339 |
| 312 | Ga0495597_0002955 | 3300046542 | Bacteria | 10301 |
| 313 | Ga0495597_0017925 | 3300046542 | Bacteria | 3325 |
| 314 | Ga0495597_0018415 | 3300046542 | Bacteria | 3277 |
| 315 | Ga0495622_0000181 | 3300046557 | Bacteria | 51031 |
| 316 | Ga0495622_0000202 | 3300046557 | Bacteria | 47328 |
| 317 | Ga0495622_0058521 | 3300046557 | Bacteria | 1785 |
| 318 | Ga0495633_0000031 | 3300046558 | Bacteria | 196727 |
| 319 | Ga0495656_0000403 | 3300046615 | Bacteria | 14328 |
| 320 | Ga0495656_0001604 | 3300046615 | Bacteria | 7402 |
| 321 | Ga0495611_0001155 | 3300046648 | Bacteria | 13789 |
| 322 | Ga0495625_0001903 | 3300046660 | Bacteria | 23588 |
| 323 | Ga0495625_0016365 | 3300046660 | Bacteria | 5839 |
| 324 | Ga0495659_0000507 | 3300046664 | Bacteria | 14341 |
| 325 | Ga0495659_0035210 | 3300046664 | Bacteria | 1763 |
| 326 | Ga0495661_0008104 | 3300046665 | Bacteria | 7288 |
| 327 | Ga0495588_0002907 | 3300046674 | Bacteria | 7388 |
| 328 | Ga0495669_0003306 | 3300046684 | Bacteria | 6633 |
| 329 | Ga0495669_0028623 | 3300046684 | Bacteria | 2440 |
| 330 | Ga0495670_0022507 | 3300046691 | Bacteria | 3111 |
| 331 | Ga0495670_0033998 | 3300046691 | Bacteria | 2537 |
| 332 | Ga0495670_0037742 | 3300046691 | Bacteria | 2408 |
| 333 | Ga0495671_0000138 | 3300046692 | Bacteria | 64535 |
| 334 | Ga0495671_0010358 | 3300046692 | Bacteria | 5168 |
| 335 | Ga0495671_0013321 | 3300046692 | Bacteria | 4457 |
| 336 | Ga0495649_0000013 | 3300046694 | Bacteria | 316013 |
| 337 | Ga0495649_0000890 | 3300046694 | Bacteria | 23784 |
| 338 | Ga0495649_0003006 | 3300046694 | Bacteria | 11575 |
| 339 | Ga0495649_0014706 | 3300046694 | Bacteria | 4474 |
| 340 | Ga0495649_0014886 | 3300046694 | Bacteria | 4445 |
| 341 | Ga0495589_0000141 | 3300046794 | Bacteria | 66457 |
| 342 | Ga0495589_0004061 | 3300046794 | Bacteria | 7843 |
| 343 | Ga0495589_0015712 | 3300046794 | Bacteria | 3891 |
| 344 | Ga0495660_0011537 | 3300046810 | Bacteria | 5126 |
| 345 | Ga0495660_0020219 | 3300046810 | Bacteria | 3816 |
| 346 | Ga0495660_0046209 | 3300046810 | Bacteria | 2388 |
| 347 | Ga0495660_0061135 | 3300046810 | Bacteria | 2022 |
| 348 | Ga0495636_0004061 | 3300047318 | Bacteria | 5724 |
| 349 | Ga0495636_0073822 | 3300047318 | Bacteria | 1460 |
| 350 | Ga0495672_0000419 | 3300047320 | Bacteria | 51114 |
| 351 | Ga0495672_0006208 | 3300047320 | Bacteria | 9319 |
| 352 | Ga0495672_0052794 | 3300047320 | Bacteria | 2385 |
| 353 | Ga0495683_0043601 | 3300047323 | Bacteria | 2258 |
| 354 | Ga0495683_0049957 | 3300047323 | Bacteria | 2093 |
| 355 | Ga0495677_0000322 | 3300047445 | Bacteria | 20705 |
| 356 | Ga0495679_000793 | 3300047446 | Bacteria | 20055 |
| 357 | Ga0495679_015906 | 3300047446 | Bacteria | 2735 |
| 358 | Ga0495673_0003032 | 3300047469 | Bacteria | 11314 |
| 359 | Ga0495673_0003114 | 3300047469 | Bacteria | 11110 |
| 360 | Ga0495673_0006252 | 3300047469 | Bacteria | 7036 |
| 361 | Ga0495673_0013855 | 3300047469 | Bacteria | 4213 |
| 362 | Ga0495673_0053931 | 3300047469 | Bacteria | 1750 |
| 363 | Ga0495684_0021634 | 3300047471 | Bacteria | 4952 |
| 364 | Ga0495593_0014775 | 3300047673 | Bacteria | 4436 |
| 365 | Ga0495615_0001492 | 3300048090 | Bacteria | 3504 |
| 366 | Ga0495626_0000329 | 3300048091 | Bacteria | 50091 |
| 367 | Ga0495626_0000849 | 3300048091 | Bacteria | 27275 |
| 368 | Ga0495626_0001572 | 3300048091 | Bacteria | 17894 |
| 369 | Ga0495626_0009783 | 3300048091 | Bacteria | 5161 |
| 370 | Ga0496100_0006646 | 3300048903 | Bacteria | 6322 |
| 371 | Ga0496102_0014331 | 3300048905 | Bacteria | 6887 |
| 372 | Ga0496102_0041392 | 3300048905 | Bacteria | 4171 |
| 373 | Ga0496102_0245150 | 3300048905 | Bacteria | 1689 |
| 374 | Ga0496103_0012713 | 3300048906 | Bacteria | 4993 |
| 375 | Ga0496104_0002324 | 3300048907 | Bacteria | 16426 |
| 376 | Ga0496104_0005274 | 3300048907 | Bacteria | 11296 |
| 377 | Ga0496105_0038760 | 3300048908 | Bacteria | 3926 |
| 378 | Ga0496106_0003149 | 3300048909 | Bacteria | 12312 |
| 379 | Ga0496106_0040336 | 3300048909 | Bacteria | 3496 |
| 380 | Ga0496108_0001103 | 3300048911 | Bacteria | 21100 |
| 381 | Ga0496108_0003172 | 3300048911 | Bacteria | 13232 |
| 382 | Ga0496109_0003718 | 3300048912 | Bacteria | 12748 |
| 383 | Ga0496109_0051857 | 3300048912 | Bacteria | 3737 |
| 384 | Ga0496110_0001272 | 3300048913 | Bacteria | 18044 |
| 385 | Ga0496110_0095428 | 3300048913 | Bacteria | 2663 |
| 386 | Ga0496111_0001613 | 3300048914 | Bacteria | 13053 |
| 387 | Ga0496112_0004257 | 3300048915 | Bacteria | 12078 |
| 388 | Ga0496112_0052446 | 3300048915 | Bacteria | 4003 |
| 389 | Ga0496113_0000394 | 3300048916 | Bacteria | 21064 |
| 390 | Ga0496113_0003078 | 3300048916 | Bacteria | 9903 |
| 391 | Ga0496113_0059542 | 3300048916 | Bacteria | 2877 |
| 392 | Ga0496114_0167313 | 3300048917 | Bacteria | 1915 |
| 393 | Ga0496115_0016207 | 3300048918 | Bacteria | 5671 |
| 394 | Ga0496115_0075286 | 3300048918 | Bacteria | 2742 |
| 395 | Ga0496115_0240525 | 3300048918 | Bacteria | 1492 |
| 396 | Ga0496116_0026740 | 3300048919 | Bacteria | 4209 |
| 397 | Ga0496117_0011833 | 3300048920 | Bacteria | 7766 |
| 398 | Ga0496118_0013506 | 3300048921 | Bacteria | 7716 |
| 399 | Ga0496119_0026392 | 3300048922 | Bacteria | 4029 |
| 400 | Ga0496120_0011566 | 3300048923 | Bacteria | 6060 |
| 401 | Ga0496121_0000396 | 3300048924 | Bacteria | 87716 |
| 402 | Ga0496121_0004070 | 3300048924 | Bacteria | 20079 |
| 403 | Ga0496121_0006347 | 3300048924 | Bacteria | 14733 |
| 404 | Ga0496121_0049280 | 3300048924 | Bacteria | 3572 |
| 405 | Ga0496121_0050746 | 3300048924 | Bacteria | 3501 |
| 406 | Ga0496122_0003392 | 3300048925 | Bacteria | 20972 |
| 407 | Ga0496122_0016932 | 3300048925 | Bacteria | 6849 |
| 408 | Ga0496122_0045378 | 3300048925 | Bacteria | 3416 |
| 409 | Ga0496123_0014523 | 3300048926 | Bacteria | 6520 |
| 410 | Ga0496123_0030307 | 3300048926 | Bacteria | 3962 |
| 411 | Ga0496123_0032039 | 3300048926 | Bacteria | 3814 |
| 412 | Ga0496124_0018862 | 3300048927 | Bacteria | 6442 |
| 413 | Ga0496124_0133766 | 3300048927 | Bacteria | 1966 |
| 414 | Ga0496125_0002729 | 3300048928 | Bacteria | 22402 |
| 415 | Ga0496125_0019592 | 3300048928 | Bacteria | 6375 |
| 416 | Ga0496125_0036060 | 3300048928 | Bacteria | 4325 |
| 417 | Ga0496125_0041900 | 3300048928 | Bacteria | 3908 |
| 418 | Ga0495678_000358 | 3300049459 | Bacteria | 46919 |
| 419 | Ga0495678_000495 | 3300049459 | Bacteria | 38920 |
| 420 | Ga0495678_011653 | 3300049459 | Bacteria | 4200 |
| 421 | Ga0495682_0003805 | 3300049460 | Bacteria | 6632 |
| 422 | Ga0495682_0010167 | 3300049460 | Bacteria | 3654 |
| 423 | Ga0501033_0002268 | 3300049570 | Bacteria | 16450 |
| 424 | Ga0501034_0010327 | 3300049571 | Bacteria | 9732 |
| 425 | Ga0501034_0035051 | 3300049571 | Bacteria | 5089 |
| 426 | Ga0501037_0031652 | 3300049573 | Bacteria | 3906 |
| 427 | Ga0501043_0065552 | 3300049579 | Bacteria | 2852 |
| 428 | Ga0501046_0000761 | 3300049580 | Bacteria | 31142 |
| 429 | Ga0501046_0003012 | 3300049580 | Bacteria | 15574 |
| 430 | Ga0501047_0006739 | 3300049581 | Bacteria | 10797 |
| 431 | Ga0501047_0028558 | 3300049581 | Bacteria | 5380 |
| 432 | Ga0501047_0043333 | 3300049581 | Bacteria | 4347 |
| 433 | Ga0501047_0071315 | 3300049581 | Bacteria | 3344 |
| 434 | Ga0501067_0044324 | 3300049583 | Bacteria | 2471 |
| 435 | Ga0501070_0054546 | 3300049586 | Bacteria | 3315 |
| 436 | Ga0501073_0099650 | 3300049589 | Bacteria | 2017 |
| 437 | Ga0501074_0109341 | 3300049590 | Bacteria | 1978 |
| 438 | Ga0501080_0088672 | 3300049742 | Bacteria | 2874 |
| 439 | Ga0501080_0136870 | 3300049742 | Bacteria | 2266 |
| 440 | Ga0501083_0037613 | 3300049744 | Bacteria | 3295 |
| 441 | Ga0501083_0041093 | 3300049744 | Bacteria | 3137 |
| 442 | Ga0501035_0106758 | 3300049822 | Bacteria | 2455 |
| 443 | Ga0501044_0000764 | 3300049823 | Bacteria | 38944 |
| 444 | Ga0501044_0002447 | 3300049823 | Bacteria | 21166 |
| 445 | nmdc:mga03683_22_c1 | 3300050489 | Bacteria | 82016 |
| 446 | nmdc:mga03n38_2422_c1 | 3300050490 | Bacteria | 5760 |
| 447 | nmdc:mga0yw44_1058_c1 | 3300050492 | Bacteria | 5879 |
| 448 | nmdc:mga0yw44_14127_c1 | 3300050492 | Bacteria | 4228 |
| 449 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 450 | nmdc:mga08y16_248024_c1 | 3300050511 | Bacteria | 1840 |
| 451 | nmdc:mga08y16_62_c1 | 3300050511 | Bacteria | 89583 |
| 452 | nmdc:mga0rr50_115952_c1 | 3300050513 | Bacteria | 2126 |
| 453 | nmdc:mga0sz30_2314_c2 | 3300050516 | Bacteria | 6485 |
| 454 | nmdc:mga0sz30_39_c1 | 3300050516 | Bacteria | 12429 |
| 455 | Ga0500610_0005577 | 3300053079 | Bacteria | 5176 |
| 456 | Ga0500578_0000309 | 3300053086 | Bacteria | 59973 |
| 457 | Ga0500593_021410 | 3300053117 | Bacteria | 2846 |
| 458 | Ga0500594_0000141 | 3300053118 | Bacteria | 19985 |
| 459 | Ga0500618_005740 | 3300053125 | Bacteria | 3740 |
| 460 | Ga0500616_0002438 | 3300053153 | Bacteria | 15481 |
| 461 | Ga0500627_0014604 | 3300053158 | Bacteria | 3013 |
| 462 | Ga0501084_0095059 | 3300054114 | Bacteria | 2502 |
| 463 | Ga0501082_0000027 | 3300060353 | Bacteria | 100915 |
| 464 | Ga0501082_0000143 | 3300060353 | Bacteria | 59481 |
| 465 | Ga0501082_0142097 | 3300060353 | Bacteria | 2083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046506 | Ga0495583_0000959 | Ga0495583_0000959_26998_28407 | 372 |
| 2 | 3300050511 | nmdc:mga08y16_248024_c1 | nmdc:mga08y16_248024_c1_392_1804 | 374 |
| 3 | iso_pu_bacteria | 2965062239 | 2965067217 | 379 |
| 4 | 3300048915 | Ga0496112_0052446 | Ga0496112_0052446_1669_2931 | 381 |
| 5 | 3300009551 | Ga0105238_10049578 | Ga0105238_100495785 | 388 |
| 6 | iso_pu_bacteria | 2881845957 | 2881851177 | 388 |
| 7 | 3300046507 | Ga0495606_0013066 | Ga0495606_0013066_5163_6572 | 390 |
| 8 | 3300046513 | Ga0495616_0025257 | Ga0495616_0025257_901_2265 | 391 |
| 9 | 3300046694 | Ga0495649_0003006 | Ga0495649_0003006_5000_6409 | 391 |
| 10 | 3300047469 | Ga0495673_0013855 | Ga0495673_0013855_270_1634 | 391 |
| 11 | 3300017792 | Ga0163161_10025204 | Ga0163161_100252043 | 392 |
| 12 | 3300037471 | Ga0395905_0007463 | Ga0395905_0007463_5234_6613 | 393 |
| 13 | 3300003316 | rootH1_10083839 | rootH1_100838392 | 394 |
| 14 | 3300003322 | rootL2_10123289 | rootL2_101232892 | 394 |
| 15 | iso_pu_bacteria | 2924741084 | 2924746220 | 397 |
| 16 | 3300048918 | Ga0496115_0016207 | Ga0496115_0016207_3429_4844 | 398 |
| 17 | 3300005548 | Ga0070665_100104702 | Ga0070665_1001047023 | 400 |
| 18 | 3300046471 | Ga0495650_0018092 | Ga0495650_0018092_539_1903 | 400 |
| 19 | 3300046491 | Ga0495584_0004386 | Ga0495584_0004386_4762_6126 | 400 |
| 20 | 3300046501 | Ga0495607_0053905 | Ga0495607_0053905_229_1593 | 400 |
| 21 | 3300046507 | Ga0495606_0004670 | Ga0495606_0004670_4572_5936 | 400 |
| 22 | 3300046512 | Ga0495610_0008005 | Ga0495610_0008005_2272_3636 | 400 |
| 23 | 3300046520 | Ga0495637_0010096 | Ga0495637_0010096_1551_2915 | 400 |
| 24 | 3300046522 | Ga0495643_0046678 | Ga0495643_0046678_726_2090 | 400 |
| 25 | 3300046524 | Ga0495648_0022911 | Ga0495648_0022911_1035_2399 | 400 |
| 26 | 3300046530 | Ga0495654_0016938 | Ga0495654_0016938_920_2284 | 400 |
| 27 | 3300046665 | Ga0495661_0008104 | Ga0495661_0008104_5471_6835 | 400 |
| 28 | 3300046691 | Ga0495670_0037742 | Ga0495670_0037742_181_1545 | 400 |
| 29 | 3300046692 | Ga0495671_0010358 | Ga0495671_0010358_2697_4061 | 400 |
| 30 | 3300046694 | Ga0495649_0014886 | Ga0495649_0014886_1022_2386 | 400 |
| 31 | 3300047446 | Ga0495679_015906 | Ga0495679_015906_476_1840 | 400 |
| 32 | 3300048091 | Ga0495626_0000329 | Ga0495626_0000329_44926_46290 | 400 |
| 33 | 3300005344 | Ga0070661_100015245 | Ga0070661_1000152453 | 401 |
| 34 | 3300005563 | Ga0068855_100018293 | Ga0068855_1000182938 | 401 |
| 35 | 3300025945 | Ga0207679_10040382 | Ga0207679_100403824 | 401 |
| 36 | 3300003187 | JGI25151J46595_10015201 | JGI25151J46595_100152012 | 402 |
| 37 | 3300025294 | Ga0209025_1000216 | Ga0209025_1000216110 | 402 |
| 38 | 3300026116 | Ga0207674_10002846 | Ga0207674_1000284619 | 402 |
| 39 | 3300046684 | Ga0495669_0003306 | Ga0495669_0003306_4607_6109 | 403 |
| 40 | 3300025254 | Ga0209148_1006050 | Ga0209148_10060501 | 405 |
| 41 | 3300031456 | Ga0307513_10000011 | Ga0307513_10000011169 | 405 |
| 42 | 3300047469 | Ga0495673_0006252 | Ga0495673_0006252_2617_3981 | 405 |
| 43 | iso_pu_bacteria | 2922158528 | 2922162984 | 405 |
| 44 | 3300005614 | Ga0068856_100304891 | Ga0068856_1003048911 | 406 |
| 45 | 3300013104 | Ga0157370_10111199 | Ga0157370_101111992 | 406 |
| 46 | 3300048917 | Ga0496114_0167313 | Ga0496114_0167313_105_1388 | 406 |
| 47 | 3300047323 | Ga0495683_0043601 | Ga0495683_0043601_235_1644 | 407 |
| 48 | 3300005327 | Ga0070658_10041052 | Ga0070658_100410523 | 408 |
| 49 | 3300005329 | Ga0070683_100042696 | Ga0070683_1000426963 | 408 |
| 50 | 3300005563 | Ga0068855_100085765 | Ga0068855_1000857652 | 408 |
| 51 | 3300005577 | Ga0068857_100060748 | Ga0068857_1000607482 | 408 |
| 52 | 3300006038 | Ga0075365_10016144 | Ga0075365_100161444 | 408 |
| 53 | 3300006178 | Ga0075367_10002906 | Ga0075367_100029065 | 408 |
| 54 | 3300009551 | Ga0105238_10176236 | Ga0105238_101762362 | 408 |
| 55 | 3300025924 | Ga0207694_10180774 | Ga0207694_101807742 | 408 |
| 56 | 3300031649 | Ga0307514_10000722 | Ga0307514_1000072248 | 408 |
| 57 | 3300042142 | Ga0450905_000726 | Ga0450905_000726_2527_3930 | 408 |
| 58 | 3300046810 | Ga0495660_0061135 | Ga0495660_0061135_488_1960 | 408 |
| 59 | 3300048928 | Ga0496125_0036060 | Ga0496125_0036060_1195_2538 | 409 |
| 60 | 3300005543 | Ga0070672_100000700 | Ga0070672_10000070017 | 410 |
| 61 | 3300013102 | Ga0157371_10078920 | Ga0157371_100789202 | 410 |
| 62 | 3300014497 | Ga0182008_10015402 | Ga0182008_100154023 | 410 |
| 63 | 3300025940 | Ga0207691_10002020 | Ga0207691_100020204 | 410 |
| 64 | 3300048924 | Ga0496121_0000396 | Ga0496121_0000396_17916_19238 | 410 |
| 65 | iso_pu_bacteria | 2996341866 | 2996344928 | 410 |
| 66 | 3300046694 | Ga0495649_0014706 | Ga0495649_0014706_3061_4413 | 411 |
| 67 | 3300049590 | Ga0501074_0109341 | Ga0501074_0109341_571_1929 | 411 |
| 68 | 3300049744 | Ga0501083_0037613 | Ga0501083_0037613_115_1551 | 412 |
| 69 | 3300060353 | Ga0501082_0000027 | Ga0501082_0000027_15038_16474 | 412 |
| 70 | iso_pu_bacteria | 2643221585 | 2643935837 | 412 |
| 71 | iso_pu_bacteria | 2643221656 | 2644317620 | 412 |
| 72 | 3300005327 | Ga0070658_10114001 | Ga0070658_101140012 | 413 |
| 73 | 3300005344 | Ga0070661_100093086 | Ga0070661_1000930862 | 413 |
| 74 | 3300005455 | Ga0070663_100010866 | Ga0070663_1000108662 | 413 |
| 75 | 3300005539 | Ga0068853_100037371 | Ga0068853_1000373711 | 413 |
| 76 | 3300005616 | Ga0068852_100139096 | Ga0068852_1001390963 | 413 |
| 77 | 3300005617 | Ga0068859_100284352 | Ga0068859_1002843522 | 413 |
| 78 | 3300006931 | Ga0097620_100284355 | Ga0097620_1002843552 | 413 |
| 79 | 3300025909 | Ga0207705_10005324 | Ga0207705_1000532411 | 413 |
| 80 | 3300025920 | Ga0207649_10069631 | Ga0207649_100696312 | 413 |
| 81 | 3300026067 | Ga0207678_10008151 | Ga0207678_100081518 | 413 |
| 82 | 3300028794 | Ga0307515_10001245 | Ga0307515_1000124531 | 413 |
| 83 | 3300048908 | Ga0496105_0038760 | Ga0496105_0038760_1767_3191 | 413 |
| 84 | 3300053118 | Ga0500594_0000141 | Ga0500594_0000141_16823_18307 | 413 |
| 85 | 3300005458 | Ga0070681_10090096 | Ga0070681_100900963 | 414 |
| 86 | 3300048905 | Ga0496102_0245150 | Ga0496102_0245150_263_1648 | 414 |
| 87 | 3300049580 | Ga0501046_0003012 | Ga0501046_0003012_3079_4551 | 414 |
| 88 | 3300049581 | Ga0501047_0071315 | Ga0501047_0071315_177_1487 | 414 |
| 89 | 3300005618 | Ga0068864_100065800 | Ga0068864_1000658002 | 415 |
| 90 | 3300005841 | Ga0068863_100226920 | Ga0068863_1002269202 | 415 |
| 91 | 3300028794 | Ga0307515_10099050 | Ga0307515_100990502 | 415 |
| 92 | 3300037471 | Ga0395905_0002046 | Ga0395905_0002046_7472_8932 | 416 |
| 93 | 3300046810 | Ga0495660_0046209 | Ga0495660_0046209_932_2356 | 416 |
| 94 | 3300048907 | Ga0496104_0005274 | Ga0496104_0005274_2300_3724 | 416 |
| 95 | 3300048911 | Ga0496108_0003172 | Ga0496108_0003172_4561_5985 | 416 |
| 96 | 3300048912 | Ga0496109_0003718 | Ga0496109_0003718_2191_3615 | 416 |
| 97 | 3300048913 | Ga0496110_0001272 | Ga0496110_0001272_7448_8872 | 416 |
| 98 | 3300048916 | Ga0496113_0003078 | Ga0496113_0003078_4702_6126 | 416 |
| 99 | 3300003762 | Ga0055542_1000839 | Ga0055542_100083916 | 418 |
| 100 | 3300025254 | Ga0209148_1000050 | Ga0209148_1000050196 | 418 |
| 101 | 3300025272 | Ga0209455_1000183 | Ga0209455_100018399 | 418 |
| 102 | 3300035695 | Ga0373927_0000048 | Ga0373927_0000048_35486_37039 | 418 |
| 103 | 3300037068 | Ga0373925_0001567 | Ga0373925_0001567_16696_18249 | 418 |
| 104 | 3300005563 | Ga0068855_100119141 | Ga0068855_1001191411 | 419 |
| 105 | 3300005985 | Ga0081539_10005268 | Ga0081539_1000526813 | 419 |
| 106 | 3300006038 | Ga0075365_10008710 | Ga0075365_100087104 | 419 |
| 107 | 3300006881 | Ga0068865_100022643 | Ga0068865_1000226432 | 419 |
| 108 | 3300050492 | nmdc:mga0yw44_1058_c1 | nmdc:mga0yw44_1058_c1_1077_2576 | 419 |
| 109 | 3300005539 | Ga0068853_100117831 | Ga0068853_1001178311 | 420 |
| 110 | 3300025294 | Ga0209025_1011346 | Ga0209025_10113465 | 420 |
| 111 | 3300025913 | Ga0207695_10013689 | Ga0207695_100136899 | 420 |
| 112 | 3300046471 | Ga0495650_0012043 | Ga0495650_0012043_2371_3741 | 420 |
| 113 | 3300046474 | Ga0495605_0026142 | Ga0495605_0026142_473_1843 | 420 |
| 114 | 3300046519 | Ga0495632_0007967 | Ga0495632_0007967_3783_5153 | 420 |
| 115 | 3300005435 | Ga0070714_100034145 | Ga0070714_1000341453 | 421 |
| 116 | 3300005455 | Ga0070663_100045377 | Ga0070663_1000453772 | 421 |
| 117 | 3300005535 | Ga0070684_100017827 | Ga0070684_1000178272 | 421 |
| 118 | 3300005539 | Ga0068853_100030296 | Ga0068853_1000302963 | 421 |
| 119 | 3300009174 | Ga0105241_10010112 | Ga0105241_100101122 | 421 |
| 120 | 3300013100 | Ga0157373_10021379 | Ga0157373_100213793 | 421 |
| 121 | 3300041405 | Ga0439438_003703 | Ga0439438_003703_3802_5223 | 421 |
| 122 | 3300042016 | Ga0439463_004121 | Ga0439463_004121_834_2255 | 421 |
| 123 | 3300042185 | Ga0450909_006941 | Ga0450909_006941_118_1539 | 421 |
| 124 | 3300042993 | Ga0439440_0011138 | Ga0439440_0011138_228_1649 | 421 |
| 125 | 3300046491 | Ga0495584_0000086 | Ga0495584_0000086_30243_31664 | 421 |
| 126 | 3300046492 | Ga0495585_0000756 | Ga0495585_0000756_9793_11217 | 421 |
| 127 | 3300046524 | Ga0495648_0009876 | Ga0495648_0009876_3755_5176 | 421 |
| 128 | 3300046692 | Ga0495671_0000138 | Ga0495671_0000138_32837_34258 | 421 |
| 129 | 3300048091 | Ga0495626_0009783 | Ga0495626_0009783_2124_3545 | 421 |
| 130 | 3300050489 | nmdc:mga03683_22_c1 | nmdc:mga03683_22_c1_41181_42545 | 421 |
| 131 | 3300050490 | nmdc:mga03n38_2422_c1 | nmdc:mga03n38_2422_c1_2699_4063 | 421 |
| 132 | 3300050516 | nmdc:mga0sz30_39_c1 | nmdc:mga0sz30_39_c1_10575_11939 | 421 |
| 133 | 3300015261 | Ga0182006_1001162 | Ga0182006_10011624 | 422 |
| 134 | 3300015262 | Ga0182007_10000898 | Ga0182007_1000089816 | 422 |
| 135 | 3300028794 | Ga0307515_10000011 | Ga0307515_10000011293 | 422 |
| 136 | 3300046474 | Ga0495605_0000114 | Ga0495605_0000114_77730_79268 | 422 |
| 137 | 3300046522 | Ga0495643_0005726 | Ga0495643_0005726_114_1652 | 422 |
| 138 | 3300046542 | Ga0495597_0002955 | Ga0495597_0002955_4100_5638 | 422 |
| 139 | 3300046794 | Ga0495589_0000141 | Ga0495589_0000141_43688_45226 | 422 |
| 140 | 3300047320 | Ga0495672_0006208 | Ga0495672_0006208_6204_7625 | 422 |
| 141 | 3300048091 | Ga0495626_0001572 | Ga0495626_0001572_3094_4515 | 422 |
| 142 | 3300013308 | Ga0157375_10000034 | Ga0157375_10000034152 | 423 |
| 143 | 3300047469 | Ga0495673_0003114 | Ga0495673_0003114_6772_8121 | 423 |
| 144 | 3300048924 | Ga0496121_0006347 | Ga0496121_0006347_8484_9842 | 423 |
| 145 | 3300006186 | Ga0075369_10004715 | Ga0075369_100047154 | 424 |
| 146 | 3300025298 | Ga0209050_1014585 | Ga0209050_10145852 | 424 |
| 147 | 3300031456 | Ga0307513_10000004 | Ga0307513_10000004424 | 424 |
| 148 | 3300049581 | Ga0501047_0006739 | Ga0501047_0006739_6290_7762 | 424 |
| 149 | 3300050516 | nmdc:mga0sz30_2314_c2 | nmdc:mga0sz30_2314_c2_2025_3458 | 424 |
| 150 | 3300053153 | Ga0500616_0002438 | Ga0500616_0002438_2600_4084 | 424 |
| 151 | iso_pu_bacteria | 2522572158 | 2523107480 | 424 |
| 152 | 3300005327 | Ga0070658_10011003 | Ga0070658_100110034 | 425 |
| 153 | 3300025909 | Ga0207705_10011361 | Ga0207705_100113615 | 425 |
| 154 | 3300046492 | Ga0495585_0000811 | Ga0495585_0000811_11801_13210 | 425 |
| 155 | 3300046507 | Ga0495606_0075194 | Ga0495606_0075194_651_2060 | 425 |
| 156 | 3300042121 | Ga0450919_003654 | Ga0450919_003654_279_1706 | 426 |
| 157 | 3300042439 | Ga0439464_0000460 | Ga0439464_0000460_6683_8050 | 426 |
| 158 | 3300042531 | Ga0450918_000060 | Ga0450918_000060_17419_18846 | 426 |
| 159 | 3300050513 | nmdc:mga0rr50_115952_c1 | nmdc:mga0rr50_115952_c1_620_2053 | 426 |
| 160 | 3300005288 | Ga0065714_10006583 | Ga0065714_100065832 | 427 |
| 161 | 3300005435 | Ga0070714_100060880 | Ga0070714_1000608803 | 427 |
| 162 | 3300006048 | Ga0075363_100005206 | Ga0075363_1000052064 | 427 |
| 163 | 3300006177 | Ga0075362_10000003 | Ga0075362_1000000365 | 427 |
| 164 | 3300006186 | Ga0075369_10001406 | Ga0075369_1000140611 | 427 |
| 165 | 3300025929 | Ga0207664_10079101 | Ga0207664_100791013 | 427 |
| 166 | 3300031730 | Ga0307516_10000046 | Ga0307516_1000004658 | 427 |
| 167 | 3300042009 | Ga0439451_007886 | Ga0439451_007886_610_2040 | 427 |
| 168 | 3300042461 | Ga0439460_0002759 | Ga0439460_0002759_2577_4007 | 427 |
| 169 | 3300046525 | Ga0495663_0001725 | Ga0495663_0001725_2213_3640 | 427 |
| 170 | 3300046615 | Ga0495656_0000403 | Ga0495656_0000403_10552_11979 | 427 |
| 171 | 3300048090 | Ga0495615_0001492 | Ga0495615_0001492_222_1649 | 427 |
| 172 | 3300003215 | JGI25153J46596_10001939 | JGI25153J46596_100019396 | 428 |
| 173 | 3300014325 | Ga0163163_10069987 | Ga0163163_100699873 | 428 |
| 174 | 3300025297 | Ga0209758_1000188 | Ga0209758_100018880 | 428 |
| 175 | 3300027907 | Ga0207428_10000096 | Ga0207428_1000009615 | 428 |
| 176 | 3300046558 | Ga0495633_0000031 | Ga0495633_0000031_163496_164863 | 428 |
| 177 | 3300053158 | Ga0500627_0014604 | Ga0500627_0014604_619_1953 | 428 |
| 178 | 3300025919 | Ga0207657_10007495 | Ga0207657_100074952 | 429 |
| 179 | 3300042146 | Ga0450907_000146 | Ga0450907_000146_15730_17079 | 429 |
| 180 | 3300042435 | Ga0439434_0000153 | Ga0439434_0000153_11942_13291 | 429 |
| 181 | 3300046455 | Ga0495603_0000930 | Ga0495603_0000930_1969_3318 | 429 |
| 182 | 3300047318 | Ga0495636_0073822 | Ga0495636_0073822_10_1404 | 429 |
| 183 | iso_pu_bacteria | 2511231023 | 2511368931 | 429 |
| 184 | 3300005564 | Ga0070664_100045925 | Ga0070664_1000459252 | 430 |
| 185 | 3300005578 | Ga0068854_100097767 | Ga0068854_1000977672 | 430 |
| 186 | 3300005834 | Ga0068851_10004431 | Ga0068851_100044314 | 430 |
| 187 | 3300009545 | Ga0105237_10177669 | Ga0105237_101776691 | 430 |
| 188 | 3300021384 | Ga0213876_10003348 | Ga0213876_100033484 | 430 |
| 189 | 3300025912 | Ga0207707_10025476 | Ga0207707_100254762 | 430 |
| 190 | 3300025913 | Ga0207695_10119767 | Ga0207695_101197672 | 430 |
| 191 | 3300025919 | Ga0207657_10019888 | Ga0207657_100198883 | 430 |
| 192 | 3300025949 | Ga0207667_10020552 | Ga0207667_100205523 | 430 |
| 193 | 3300026067 | Ga0207678_10031845 | Ga0207678_100318453 | 430 |
| 194 | 3300026078 | Ga0207702_10086814 | Ga0207702_100868141 | 430 |
| 195 | 3300026116 | Ga0207674_10021913 | Ga0207674_100219132 | 430 |
| 196 | 3300039437 | Ga0436365_0120529 | Ga0436365_0120529_5144_6646 | 430 |
| 197 | 3300045051 | Ga0451576_0147559 | Ga0451576_0147559_898_2358 | 430 |
| 198 | 3300049570 | Ga0501033_0002268 | Ga0501033_0002268_2019_3461 | 430 |
| 199 | 3300049581 | Ga0501047_0028558 | Ga0501047_0028558_1812_3254 | 430 |
| 200 | 3300049742 | Ga0501080_0088672 | Ga0501080_0088672_577_2019 | 430 |
| 201 | 3300049822 | Ga0501035_0106758 | Ga0501035_0106758_886_2349 | 430 |
| 202 | 3300049823 | Ga0501044_0000764 | Ga0501044_0000764_32714_34156 | 430 |
| 203 | iso_pu_bacteria | 2643221613 | 2644083260 | 430 |
| 204 | iso_pu_bacteria | 2643221721 | 2644666456 | 430 |
| 205 | iso_pu_bacteria | 2935890801 | 2935890948 | 430 |
| 206 | iso_pu_bacteria | 8056172158 | 8056174894 | 430 |
| 207 | 3300005331 | Ga0070670_100060006 | Ga0070670_1000600065 | 431 |
| 208 | 3300009094 | Ga0111539_10041691 | Ga0111539_100416913 | 431 |
| 209 | 3300009147 | Ga0114129_10037370 | Ga0114129_100373702 | 431 |
| 210 | 3300046491 | Ga0495584_0001610 | Ga0495584_0001610_9153_10691 | 431 |
| 211 | 3300046519 | Ga0495632_0000455 | Ga0495632_0000455_21069_22607 | 431 |
| 212 | 3300046528 | Ga0495642_0000162 | Ga0495642_0000162_16754_18292 | 431 |
| 213 | 3300046538 | Ga0495609_0003974 | Ga0495609_0003974_186_1724 | 431 |
| 214 | 3300046694 | Ga0495649_0000013 | Ga0495649_0000013_105039_106577 | 431 |
| 215 | 3300048091 | Ga0495626_0000849 | Ga0495626_0000849_9376_10914 | 431 |
| 216 | 3300048905 | Ga0496102_0014331 | Ga0496102_0014331_5247_6638 | 431 |
| 217 | 3300048907 | Ga0496104_0002324 | Ga0496104_0002324_5135_6526 | 431 |
| 218 | 3300048911 | Ga0496108_0001103 | Ga0496108_0001103_18369_19760 | 431 |
| 219 | 3300048912 | Ga0496109_0051857 | Ga0496109_0051857_1428_2819 | 431 |
| 220 | 3300048913 | Ga0496110_0095428 | Ga0496110_0095428_77_1468 | 431 |
| 221 | 3300048914 | Ga0496111_0001613 | Ga0496111_0001613_6403_7794 | 431 |
| 222 | 3300048915 | Ga0496112_0004257 | Ga0496112_0004257_2970_4361 | 431 |
| 223 | 3300048916 | Ga0496113_0000394 | Ga0496113_0000394_14357_15748 | 431 |
| 224 | 3300048918 | Ga0496115_0240525 | Ga0496115_0240525_11_1405 | 431 |
| 225 | 3300049459 | Ga0495678_000495 | Ga0495678_000495_20943_22481 | 431 |
| 226 | iso_pu_bacteria | 2823421272 | 2823424397 | 431 |
| 227 | iso_pu_bacteria | 3007614139 | 3007614796 | 431 |
| 228 | iso_pu_bacteria | 8005246636 | 8005249859 | 431 |
| 229 | 3300013306 | Ga0163162_10307152 | Ga0163162_103071522 | 432 |
| 230 | 3300046660 | Ga0495625_0016365 | Ga0495625_0016365_3811_5226 | 432 |
| 231 | 3300046664 | Ga0495659_0035210 | Ga0495659_0035210_182_1597 | 432 |
| 232 | 3300046691 | Ga0495670_0033998 | Ga0495670_0033998_587_2002 | 432 |
| 233 | 3300047320 | Ga0495672_0052794 | Ga0495672_0052794_182_1597 | 432 |
| 234 | 3300049460 | Ga0495682_0003805 | Ga0495682_0003805_174_1589 | 432 |
| 235 | 3300060353 | Ga0501082_0000143 | Ga0501082_0000143_55552_56985 | 432 |
| 236 | iso_pu_bacteria | 2643221605 | 2644039912 | 432 |
| 237 | iso_pu_bacteria | 2977907340 | 2977907610 | 432 |
| 238 | 3300005355 | Ga0070671_100035995 | Ga0070671_1000359953 | 433 |
| 239 | 3300049571 | Ga0501034_0010327 | Ga0501034_0010327_6354_7757 | 433 |
| 240 | iso_pu_bacteria | 2599185292 | 2599906057 | 433 |
| 241 | iso_pu_bacteria | 2751185734 | 2753072851 | 433 |
| 242 | 3300002737 | JGI25162J39368_1001910 | JGI25162J39368_10019109 | 434 |
| 243 | 3300003214 | JGI25165J46597_1001922 | JGI25165J46597_10019222 | 434 |
| 244 | 3300025207 | Ga0209760_100936 | Ga0209760_1009364 | 434 |
| 245 | 3300025233 | Ga0209437_100107 | Ga0209437_100107201 | 434 |
| 246 | 3300025256 | Ga0209759_1008451 | Ga0209759_10084512 | 434 |
| 247 | 3300025261 | Ga0209233_1000178 | Ga0209233_10001789 | 434 |
| 248 | 3300026088 | Ga0207641_10117943 | Ga0207641_101179431 | 434 |
| 249 | 3300028794 | Ga0307515_10001041 | Ga0307515_1000104116 | 434 |
| 250 | 3300031649 | Ga0307514_10002190 | Ga0307514_1000219012 | 434 |
| 251 | 3300046460 | Ga0495638_0035873 | Ga0495638_0035873_298_1728 | 434 |
| 252 | 3300046810 | Ga0495660_0020219 | Ga0495660_0020219_526_1878 | 434 |
| 253 | 3300049586 | Ga0501070_0054546 | Ga0501070_0054546_1283_2767 | 434 |
| 254 | 3300005539 | Ga0068853_100000769 | Ga0068853_1000007692 | 435 |
| 255 | 3300005548 | Ga0070665_100010800 | Ga0070665_1000108009 | 435 |
| 256 | 3300005563 | Ga0068855_100003263 | Ga0068855_10000326314 | 435 |
| 257 | 3300005577 | Ga0068857_100053343 | Ga0068857_1000533432 | 435 |
| 258 | 3300005841 | Ga0068863_100010114 | Ga0068863_1000101146 | 435 |
| 259 | 3300010375 | Ga0105239_10003240 | Ga0105239_1000324011 | 435 |
| 260 | 3300025949 | Ga0207667_10003694 | Ga0207667_1000369413 | 435 |
| 261 | 3300026041 | Ga0207639_10001206 | Ga0207639_1000120614 | 435 |
| 262 | 3300026088 | Ga0207641_10062147 | Ga0207641_100621472 | 435 |
| 263 | 3300026116 | Ga0207674_10064094 | Ga0207674_100640942 | 435 |
| 264 | 3300028379 | Ga0268266_10019839 | Ga0268266_100198395 | 435 |
| 265 | 3300028794 | Ga0307515_10014858 | Ga0307515_1001485811 | 435 |
| 266 | 3300031616 | Ga0307508_10001284 | Ga0307508_1000128413 | 435 |
| 267 | 3300033179 | Ga0307507_10116268 | Ga0307507_101162681 | 435 |
| 268 | 3300046475 | Ga0495639_0000001 | Ga0495639_0000001_199630_201051 | 435 |
| 269 | 3300046499 | Ga0495594_0004250 | Ga0495594_0004250_5727_7148 | 435 |
| 270 | 3300046557 | Ga0495622_0000181 | Ga0495622_0000181_46358_47779 | 435 |
| 271 | 3300047673 | Ga0495593_0014775 | Ga0495593_0014775_1841_3262 | 435 |
| 272 | 3300049744 | Ga0501083_0041093 | Ga0501083_0041093_377_1912 | 435 |
| 273 | iso_pu_bacteria | 2818991272 | 2819241022 | 435 |
| 274 | iso_pu_bacteria | 2989776772 | 2989779533 | 435 |
| 275 | 3300003320 | rootH2_10033048 | rootH2_100330485 | 436 |
| 276 | 3300047446 | Ga0495679_000793 | Ga0495679_000793_8591_10009 | 436 |
| 277 | 3300010159 | Ga0099796_10006581 | Ga0099796_100065812 | 437 |
| 278 | 3300032004 | Ga0307414_10001606 | Ga0307414_100016063 | 437 |
| 279 | 3300037418 | Ga0395900_0012611 | Ga0395900_0012611_267_1697 | 437 |
| 280 | 3300037471 | Ga0395905_0001527 | Ga0395905_0001527_9635_11065 | 437 |
| 281 | 3300038443 | Ga0395901_0001188 | Ga0395901_0001188_12229_13659 | 437 |
| 282 | 3300049571 | Ga0501034_0035051 | Ga0501034_0035051_1852_3306 | 437 |
| 283 | 3300060353 | Ga0501082_0142097 | Ga0501082_0142097_323_1768 | 437 |
| 284 | 3300041411 | Ga0439466_0002142 | Ga0439466_0002142_2058_3470 | 438 |
| 285 | 3300046530 | Ga0495654_0001192 | Ga0495654_0001192_14202_15623 | 438 |
| 286 | 3300049583 | Ga0501067_0044324 | Ga0501067_0044324_112_1557 | 438 |
| 287 | 3300049589 | Ga0501073_0099650 | Ga0501073_0099650_186_1724 | 438 |
| 288 | 3300049742 | Ga0501080_0136870 | Ga0501080_0136870_502_1956 | 438 |
| 289 | 3300054114 | Ga0501084_0095059 | Ga0501084_0095059_556_2094 | 438 |
| 290 | iso_pu_bacteria | 2551306092 | 2551738844 | 438 |
| 291 | iso_pu_bacteria | 2941479691 | 2941479818 | 438 |
| 292 | 3300001990 | JGI24737J22298_10004055 | JGI24737J22298_100040555 | 439 |
| 293 | 3300005262 | Ga0065165_1007717 | Ga0065165_10077176 | 439 |
| 294 | 3300005563 | Ga0068855_100013519 | Ga0068855_1000135197 | 439 |
| 295 | 3300005577 | Ga0068857_100000436 | Ga0068857_10000043610 | 439 |
| 296 | 3300005578 | Ga0068854_100014066 | Ga0068854_1000140664 | 439 |
| 297 | 3300005834 | Ga0068851_10001004 | Ga0068851_100010041 | 439 |
| 298 | 3300009545 | Ga0105237_10000023 | Ga0105237_10000023158 | 439 |
| 299 | 3300012500 | Ga0157314_1000522 | Ga0157314_10005222 | 439 |
| 300 | 3300025913 | Ga0207695_10012305 | Ga0207695_100123056 | 439 |
| 301 | 3300025914 | Ga0207671_10000020 | Ga0207671_1000002078 | 439 |
| 302 | 3300025914 | Ga0207671_10000033 | Ga0207671_10000033177 | 439 |
| 303 | 3300025949 | Ga0207667_10000238 | Ga0207667_1000023810 | 439 |
| 304 | 3300025981 | Ga0207640_10000277 | Ga0207640_1000027727 | 439 |
| 305 | 3300026116 | Ga0207674_10000074 | Ga0207674_1000007446 | 439 |
| 306 | 3300046452 | Ga0495617_002636 | Ga0495617_002636_892_2307 | 439 |
| 307 | 3300046492 | Ga0495585_0001985 | Ga0495585_0001985_13350_14765 | 439 |
| 308 | 3300046506 | Ga0495583_0038363 | Ga0495583_0038363_647_2062 | 439 |
| 309 | 3300046810 | Ga0495660_0011537 | Ga0495660_0011537_376_1791 | 439 |
| 310 | 3300048924 | Ga0496121_0050746 | Ga0496121_0050746_10_1455 | 439 |
| 311 | 3300046501 | Ga0495607_0007673 | Ga0495607_0007673_1729_3144 | 440 |
| 312 | 3300046542 | Ga0495597_0017925 | Ga0495597_0017925_843_2213 | 440 |
| 313 | iso_pu_bacteria | 2551306087 | 2551700281 | 440 |
| 314 | 3300005339 | Ga0070660_100046034 | Ga0070660_1000460344 | 441 |
| 315 | 3300005530 | Ga0070679_100066453 | Ga0070679_1000664532 | 441 |
| 316 | 3300009148 | Ga0105243_10001488 | Ga0105243_1000148816 | 441 |
| 317 | 3300025917 | Ga0207660_10011068 | Ga0207660_100110685 | 441 |
| 318 | 3300025921 | Ga0207652_10020020 | Ga0207652_100200202 | 441 |
| 319 | 3300035398 | Ga0316574_0016352 | Ga0316574_0016352_1202_2659 | 441 |
| 320 | 3300042009 | Ga0439451_001281 | Ga0439451_001281_2562_3983 | 441 |
| 321 | iso_pu_bacteria | 2869256925 | 2869262131 | 441 |
| 322 | 3300005343 | Ga0070687_100006936 | Ga0070687_1000069362 | 442 |
| 323 | 3300009036 | Ga0105244_10007446 | Ga0105244_100074464 | 442 |
| 324 | 3300009766 | Ga0123342_1000455 | Ga0123342_100045554 | 442 |
| 325 | 3300025728 | Ga0207655_1001260 | Ga0207655_10012606 | 442 |
| 326 | 3300025918 | Ga0207662_10013471 | Ga0207662_100134712 | 442 |
| 327 | 3300046460 | Ga0495638_0053280 | Ga0495638_0053280_449_1870 | 442 |
| 328 | 3300046506 | Ga0495583_0011682 | Ga0495583_0011682_496_1917 | 442 |
| 329 | 3300046664 | Ga0495659_0000507 | Ga0495659_0000507_3688_5109 | 442 |
| 330 | 3300046694 | Ga0495649_0000890 | Ga0495649_0000890_16686_18107 | 442 |
| 331 | 3300048909 | Ga0496106_0040336 | Ga0496106_0040336_1420_2841 | 442 |
| 332 | 3300048924 | Ga0496121_0004070 | Ga0496121_0004070_15568_16989 | 442 |
| 333 | 3300048925 | Ga0496122_0003392 | Ga0496122_0003392_2058_3479 | 442 |
| 334 | 3300048926 | Ga0496123_0030307 | Ga0496123_0030307_1799_3220 | 442 |
| 335 | 3300048927 | Ga0496124_0133766 | Ga0496124_0133766_204_1625 | 442 |
| 336 | 3300049823 | Ga0501044_0002447 | Ga0501044_0002447_958_2418 | 442 |
| 337 | 3300006353 | Ga0075370_10001512 | Ga0075370_100015124 | 443 |
| 338 | 3300046557 | Ga0495622_0058521 | Ga0495622_0058521_157_1569 | 443 |
| 339 | 3300046691 | Ga0495670_0022507 | Ga0495670_0022507_1076_2497 | 443 |
| 340 | 3300046794 | Ga0495589_0004061 | Ga0495589_0004061_3737_5158 | 443 |
| 341 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_413281_414714 | 443 |
| 342 | 3300053079 | Ga0500610_0005577 | Ga0500610_0005577_2959_4416 | 443 |
| 343 | iso_pu_bacteria | 2958137437 | 2958143535 | 443 |
| 344 | 3300021321 | Ga0214542_1010266 | Ga0214542_10102667 | 444 |
| 345 | 3300021327 | Ga0214543_1000156 | Ga0214543_10001569 | 444 |
| 346 | 3300046542 | Ga0495597_0018415 | Ga0495597_0018415_108_1529 | 444 |
| 347 | 3300048918 | Ga0496115_0075286 | Ga0496115_0075286_1228_2631 | 444 |
| 348 | 3300053086 | Ga0500578_0000309 | Ga0500578_0000309_1795_3216 | 444 |
| 349 | iso_pu_bacteria | 2600255292 | 2601667911 | 444 |
| 350 | iso_pu_bacteria | 2857547612 | 2857550056 | 444 |
| 351 | 3300013104 | Ga0157370_10006851 | Ga0157370_1000685113 | 445 |
| 352 | 3300049573 | Ga0501037_0031652 | Ga0501037_0031652_2115_3557 | 445 |
| 353 | 3300049580 | Ga0501046_0000761 | Ga0501046_0000761_25443_26885 | 445 |
| 354 | 3300049581 | Ga0501047_0043333 | Ga0501047_0043333_1731_3173 | 445 |
| 355 | 3300006237 | Ga0097621_100033411 | Ga0097621_1000334114 | 446 |
| 356 | 3300013102 | Ga0157371_10001861 | Ga0157371_1000186115 | 446 |
| 357 | 3300025935 | Ga0207709_10000172 | Ga0207709_1000017272 | 446 |
| 358 | 3300041407 | Ga0439447_000014 | Ga0439447_000014_34286_35734 | 446 |
| 359 | 3300046474 | Ga0495605_0003571 | Ga0495605_0003571_7619_9022 | 446 |
| 360 | 3300046692 | Ga0495671_0013321 | Ga0495671_0013321_2756_4168 | 446 |
| 361 | 3300048909 | Ga0496106_0003149 | Ga0496106_0003149_3229_4659 | 446 |
| 362 | iso_pu_bacteria | 2808606377 | 2808930213 | 446 |
| 363 | iso_pu_bacteria | 2808606381 | 2808952222 | 446 |
| 364 | iso_pu_bacteria | 2847686936 | 2847687639 | 446 |
| 365 | iso_pu_bacteria | 2860339153 | 2860342459 | 446 |
| 366 | iso_pu_bacteria | 2906328253 | 2906332352 | 446 |
| 367 | iso_pu_bacteria | 2924726620 | 2924727608 | 446 |
| 368 | iso_pu_bacteria | 2937891427 | 2937894836 | 446 |
| 369 | iso_pu_bacteria | 2958115193 | 2958117382 | 446 |
| 370 | iso_pu_bacteria | 2968091066 | 2968092901 | 446 |
| 371 | iso_pu_bacteria | 2968097103 | 2968103185 | 446 |
| 372 | iso_pu_bacteria | 2968128360 | 2968132496 | 446 |
| 373 | iso_pu_bacteria | 2977858184 | 2977862061 | 446 |
| 374 | iso_pu_bacteria | 2979779861 | 2979783612 | 446 |
| 375 | iso_pu_bacteria | 8004703790 | 8004711267 | 446 |
| 376 | 3300005719 | Ga0068861_100180889 | Ga0068861_1001808891 | 447 |
| 377 | 3300013100 | Ga0157373_10016254 | Ga0157373_100162547 | 447 |
| 378 | 3300025292 | Ga0209676_1000065 | Ga0209676_1000065215 | 447 |
| 379 | 3300042009 | Ga0439451_000635 | Ga0439451_000635_178_1599 | 447 |
| 380 | 3300046457 | Ga0495590_0015385 | Ga0495590_0015385_617_2062 | 447 |
| 381 | 3300046471 | Ga0495650_0001441 | Ga0495650_0001441_10610_12148 | 447 |
| 382 | 3300046492 | Ga0495585_0001747 | Ga0495585_0001747_11342_12772 | 447 |
| 383 | 3300046501 | Ga0495607_0002550 | Ga0495607_0002550_2722_4260 | 447 |
| 384 | 3300046501 | Ga0495607_0087746 | Ga0495607_0087746_126_1556 | 447 |
| 385 | 3300046513 | Ga0495616_0000480 | Ga0495616_0000480_27407_28852 | 447 |
| 386 | 3300046513 | Ga0495616_0009080 | Ga0495616_0009080_442_1872 | 447 |
| 387 | 3300046518 | Ga0495631_0008437 | Ga0495631_0008437_1512_2942 | 447 |
| 388 | 3300046519 | Ga0495632_0001698 | Ga0495632_0001698_1965_3395 | 447 |
| 389 | 3300046520 | Ga0495637_0001301 | Ga0495637_0001301_1039_2469 | 447 |
| 390 | 3300046538 | Ga0495609_0033289 | Ga0495609_0033289_186_1724 | 447 |
| 391 | 3300046615 | Ga0495656_0001604 | Ga0495656_0001604_701_2131 | 447 |
| 392 | 3300046648 | Ga0495611_0001155 | Ga0495611_0001155_5990_7528 | 447 |
| 393 | 3300046660 | Ga0495625_0001903 | Ga0495625_0001903_20113_21534 | 447 |
| 394 | 3300046684 | Ga0495669_0028623 | Ga0495669_0028623_247_1677 | 447 |
| 395 | 3300046794 | Ga0495589_0015712 | Ga0495589_0015712_789_2219 | 447 |
| 396 | 3300047318 | Ga0495636_0004061 | Ga0495636_0004061_2505_4043 | 447 |
| 397 | 3300047320 | Ga0495672_0000419 | Ga0495672_0000419_33041_34579 | 447 |
| 398 | 3300047323 | Ga0495683_0049957 | Ga0495683_0049957_410_1840 | 447 |
| 399 | 3300047445 | Ga0495677_0000322 | Ga0495677_0000322_7697_9127 | 447 |
| 400 | 3300047469 | Ga0495673_0003032 | Ga0495673_0003032_4484_6022 | 447 |
| 401 | 3300047469 | Ga0495673_0053931 | Ga0495673_0053931_60_1490 | 447 |
| 402 | 3300049460 | Ga0495682_0010167 | Ga0495682_0010167_1506_2936 | 447 |
| 403 | iso_pu_bacteria | 2511231007 | 2511270328 | 447 |
| 404 | iso_pu_bacteria | 2511231016 | 2511328683 | 447 |
| 405 | iso_pu_bacteria | 2511231022 | 2511362463 | 447 |
| 406 | iso_pu_bacteria | 2599185352 | 2600195904 | 447 |
| 407 | iso_pu_bacteria | 2846037992 | 2846040830 | 447 |
| 408 | iso_pu_bacteria | 2919697872 | 2919701160 | 447 |
| 409 | iso_pu_bacteria | 8019775933 | 8019778240 | 447 |
| 410 | iso_pu_bacteria | 8056155041 | 8056156868 | 447 |
| 411 | 3300053117 | Ga0500593_021410 | Ga0500593_021410_898_2355 | 448 |
| 412 | iso_pu_bacteria | 2516143018 | 2516206607 | 448 |
| 413 | iso_pu_bacteria | 2987666974 | 2987668880 | 448 |
| 414 | 3300009553 | Ga0105249_10055894 | Ga0105249_100558941 | 449 |
| 415 | 3300049459 | Ga0495678_000358 | Ga0495678_000358_16819_18228 | 449 |
| 416 | iso_pu_bacteria | 2512047018 | 2512325100 | 449 |
| 417 | iso_pu_bacteria | 2582580891 | 2583791355 | 449 |
| 418 | iso_pu_bacteria | 2597489887 | 2597859123 | 449 |
| 419 | iso_pu_bacteria | 2599185185 | 2599487455 | 449 |
| 420 | iso_pu_bacteria | 2599185257 | 2599806230 | 449 |
| 421 | iso_pu_bacteria | 2671180172 | 2671772707 | 449 |
| 422 | iso_pu_bacteria | 2791355123 | 2792749608 | 449 |
| 423 | iso_pu_bacteria | 2882632389 | 2882635625 | 449 |
| 424 | iso_pu_bacteria | 8055770955 | 8055775047 | 449 |
| 425 | 3300005293 | Ga0065715_10002056 | Ga0065715_100020562 | 450 |
| 426 | iso_pu_bacteria | 2582581279 | 2585146442 | 450 |
| 427 | iso_pu_bacteria | 2920822456 | 2920824997 | 450 |
| 428 | iso_pu_bacteria | 2937822353 | 2937824841 | 450 |
| 429 | 3300003323 | rootH1_10063462 | rootH1_100634626 | 451 |
| 430 | 3300005288 | Ga0065714_10076125 | Ga0065714_100761253 | 451 |
| 431 | 3300006946 | Ga0079104_1000007 | Ga0079104_100000763 | 451 |
| 432 | 3300027111 | Ga0209281_1000020 | Ga0209281_1000020434 | 451 |
| 433 | 3300031456 | Ga0307513_10021757 | Ga0307513_100217576 | 451 |
| 434 | 3300031824 | Ga0307413_10057325 | Ga0307413_100573252 | 451 |
| 435 | 3300031903 | Ga0307407_10000948 | Ga0307407_100009481 | 451 |
| 436 | 3300032126 | Ga0307415_100007608 | Ga0307415_1000076082 | 451 |
| 437 | iso_pu_bacteria | 2509276019 | 2509379630 | 451 |
| 438 | iso_pu_bacteria | 2511231018 | 2511337475 | 451 |
| 439 | iso_pu_bacteria | 2513237305 | 2514420219 | 451 |
| 440 | iso_pu_bacteria | 2558860100 | 2558866617 | 451 |
| 441 | iso_pu_bacteria | 2615840698 | 2616557566 | 451 |
| 442 | iso_pu_bacteria | 2690316117 | 2692318130 | 451 |
| 443 | iso_pu_bacteria | 2721755686 | 2723575735 | 451 |
| 444 | iso_pu_bacteria | 2847417321 | 2847423365 | 451 |
| 445 | iso_pu_bacteria | 2850079185 | 2850079414 | 451 |
| 446 | iso_pu_bacteria | 2869169390 | 2869172915 | 451 |
| 447 | iso_pu_bacteria | 2869234852 | 2869235396 | 451 |
| 448 | iso_pu_bacteria | 2869242130 | 2869246847 | 451 |
| 449 | iso_pu_bacteria | 2871481445 | 2871486486 | 451 |
| 450 | iso_pu_bacteria | 2874109183 | 2874110209 | 451 |
| 451 | iso_pu_bacteria | 2874116593 | 2874118764 | 451 |
| 452 | iso_pu_bacteria | 2876386047 | 2876387316 | 451 |
| 453 | iso_pu_bacteria | 2876420981 | 2876421819 | 451 |
| 454 | iso_pu_bacteria | 2897803580 | 2897809537 | 451 |
| 455 | iso_pu_bacteria | 2903513507 | 2903519072 | 451 |
| 456 | iso_pu_bacteria | 2906401398 | 2906405282 | 451 |
| 457 | iso_pu_bacteria | 2906427513 | 2906432935 | 451 |
| 458 | iso_pu_bacteria | 2937861824 | 2937864866 | 451 |
| 459 | iso_pu_bacteria | 2937980651 | 2937983309 | 451 |
| 460 | iso_pu_bacteria | 2958108152 | 2958110516 | 451 |
| 461 | iso_pu_bacteria | 2961183825 | 2961186397 | 451 |
| 462 | iso_pu_bacteria | 2970532167 | 2970539868 | 451 |
| 463 | iso_pu_bacteria | 2970627176 | 2970629398 | 451 |
| 464 | iso_pu_bacteria | 2977851361 | 2977853666 | 451 |
| 465 | iso_pu_bacteria | 2979764755 | 2979768864 | 451 |
| 466 | iso_pu_bacteria | 2979772303 | 2979775216 | 451 |
| 467 | iso_pu_bacteria | 3004232784 | 3004238935 | 451 |
| 468 | iso_pu_bacteria | 3004248173 | 3004250814 | 451 |
| 469 | iso_pu_bacteria | 8004727605 | 8004729110 | 451 |
| 470 | iso_pu_bacteria | 8056177738 | 8056178628 | 451 |
| 471 | 3300005288 | Ga0065714_10088436 | Ga0065714_100884361 | 452 |
| 472 | 3300006946 | Ga0079104_1003920 | Ga0079104_10039202 | 452 |
| 473 | 3300022739 | Ga0228711_1000006 | Ga0228711_100000681 | 452 |
| 474 | 3300022740 | Ga0228710_1000004 | Ga0228710_1000004129 | 452 |
| 475 | 3300027111 | Ga0209281_1000102 | Ga0209281_100010264 | 452 |
| 476 | 3300027666 | Ga0209282_1000013 | Ga0209282_100001399 | 452 |
| 477 | 3300031967 | Ga0315914_1000004 | Ga0315914_1000004134 | 452 |
| 478 | 3300033430 | Ga0315913_1000011 | Ga0315913_100001157 | 452 |
| 479 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003241 | 452 |
| 480 | 3300046462 | Ga0495651_0106528 | Ga0495651_0106528_290_1705 | 452 |
| 481 | 3300047471 | Ga0495684_0021634 | Ga0495684_0021634_3508_4923 | 452 |
| 482 | iso_pu_bacteria | 2509276018 | 2509371150 | 452 |
| 483 | iso_pu_bacteria | 2510065059 | 2510313733 | 452 |
| 484 | iso_pu_bacteria | 2512875026 | 2512973225 | 452 |
| 485 | iso_pu_bacteria | 2513237089 | 2513603583 | 452 |
| 486 | iso_pu_bacteria | 2513237156 | 2513983288 | 452 |
| 487 | iso_pu_bacteria | 2513237160 | 2514005823 | 452 |
| 488 | iso_pu_bacteria | 2517487022 | 2517571774 | 452 |
| 489 | iso_pu_bacteria | 2643221595 | 2643986936 | 452 |
| 490 | iso_pu_bacteria | 2643221610 | 2644063679 | 452 |
| 491 | iso_pu_bacteria | 2643221627 | 2644158434 | 452 |
| 492 | iso_pu_bacteria | 2643221675 | 2644414442 | 452 |
| 493 | iso_pu_bacteria | 2643221680 | 2644447970 | 452 |
| 494 | iso_pu_bacteria | 2643221726 | 2644690443 | 452 |
| 495 | iso_pu_bacteria | 2687453392 | 2688598791 | 452 |
| 496 | iso_pu_bacteria | 2738543030 | 2739341891 | 452 |
| 497 | iso_pu_bacteria | 2784132072 | 2784312318 | 452 |
| 498 | iso_pu_bacteria | 2802428858 | 2802720866 | 452 |
| 499 | iso_pu_bacteria | 2802428859 | 2802724470 | 452 |
| 500 | iso_pu_bacteria | 2802428861 | 2802737209 | 452 |
| 501 | iso_pu_bacteria | 2802428862 | 2802746337 | 452 |
| 502 | iso_pu_bacteria | 2802428863 | 2802751826 | 452 |
| 503 | iso_pu_bacteria | 2840764183 | 2840764887 | 452 |
| 504 | iso_pu_bacteria | 2844009547 | 2844014129 | 452 |
| 505 | iso_pu_bacteria | 2848992105 | 2848997155 | 452 |
| 506 | iso_pu_bacteria | 2855872281 | 2855875170 | 452 |
| 507 | iso_pu_bacteria | 2856328259 | 2856331448 | 452 |
| 508 | iso_pu_bacteria | 2856334872 | 2856335216 | 452 |
| 509 | iso_pu_bacteria | 2857367948 | 2857369334 | 452 |
| 510 | iso_pu_bacteria | 2869264136 | 2869270460 | 452 |
| 511 | iso_pu_bacteria | 2869271264 | 2869271549 | 452 |
| 512 | iso_pu_bacteria | 2874131515 | 2874136854 | 452 |
| 513 | iso_pu_bacteria | 2874168670 | 2874174443 | 452 |
| 514 | iso_pu_bacteria | 2876399893 | 2876405995 | 452 |
| 515 | iso_pu_bacteria | 2876406927 | 2876410321 | 452 |
| 516 | iso_pu_bacteria | 2878774303 | 2878778213 | 452 |
| 517 | iso_pu_bacteria | 2878781027 | 2878787193 | 452 |
| 518 | iso_pu_bacteria | 2881155292 | 2881155653 | 452 |
| 519 | iso_pu_bacteria | 2885342637 | 2885346123 | 452 |
| 520 | iso_pu_bacteria | 2906363423 | 2906367470 | 452 |
| 521 | iso_pu_bacteria | 2906370794 | 2906373723 | 452 |
| 522 | iso_pu_bacteria | 2906386501 | 2906388425 | 452 |
| 523 | iso_pu_bacteria | 2906393657 | 2906398318 | 452 |
| 524 | iso_pu_bacteria | 2906408224 | 2906412113 | 452 |
| 525 | iso_pu_bacteria | 2915980308 | 2915982720 | 452 |
| 526 | iso_pu_bacteria | 2916061851 | 2916063894 | 452 |
| 527 | iso_pu_bacteria | 2921250672 | 2921256305 | 452 |
| 528 | iso_pu_bacteria | 2922151315 | 2922151768 | 452 |
| 529 | iso_pu_bacteria | 2922172374 | 2922174446 | 452 |
| 530 | iso_pu_bacteria | 2922178524 | 2922180698 | 452 |
| 531 | iso_pu_bacteria | 2924748358 | 2924750481 | 452 |
| 532 | iso_pu_bacteria | 2932416698 | 2932418877 | 452 |
| 533 | iso_pu_bacteria | 2937029754 | 2937030606 | 452 |
| 534 | iso_pu_bacteria | 2937036028 | 2937039076 | 452 |
| 535 | iso_pu_bacteria | 2937078374 | 2937083947 | 452 |
| 536 | iso_pu_bacteria | 2937084907 | 2937090792 | 452 |
| 537 | iso_pu_bacteria | 2937868953 | 2937872086 | 452 |
| 538 | iso_pu_bacteria | 2957437181 | 2957442450 | 452 |
| 539 | iso_pu_bacteria | 2958122699 | 2958124743 | 452 |
| 540 | iso_pu_bacteria | 2958158011 | 2958158978 | 452 |
| 541 | iso_pu_bacteria | 2960591022 | 2960593144 | 452 |
| 542 | iso_pu_bacteria | 2960680706 | 2960682680 | 452 |
| 543 | iso_pu_bacteria | 2960693952 | 2960697551 | 452 |
| 544 | iso_pu_bacteria | 2961136820 | 2961143391 | 452 |
| 545 | iso_pu_bacteria | 2965025482 | 2965026507 | 452 |
| 546 | iso_pu_bacteria | 2965032056 | 2965036813 | 452 |
| 547 | iso_pu_bacteria | 2965040258 | 2965044552 | 452 |
| 548 | iso_pu_bacteria | 2965047637 | 2965050020 | 452 |
| 549 | iso_pu_bacteria | 2965089291 | 2965093984 | 452 |
| 550 | iso_pu_bacteria | 2965102966 | 2965106369 | 452 |
| 551 | iso_pu_bacteria | 2965110997 | 2965115023 | 452 |
| 552 | iso_pu_bacteria | 2967728569 | 2967733837 | 452 |
| 553 | iso_pu_bacteria | 2970026789 | 2970031984 | 452 |
| 554 | iso_pu_bacteria | 2970122695 | 2970122801 | 452 |
| 555 | iso_pu_bacteria | 2970143518 | 2970145326 | 452 |
| 556 | iso_pu_bacteria | 2970489779 | 2970495695 | 452 |
| 557 | iso_pu_bacteria | 2970510686 | 2970512814 | 452 |
| 558 | iso_pu_bacteria | 2970547951 | 2970551317 | 452 |
| 559 | iso_pu_bacteria | 2977530762 | 2977530877 | 452 |
| 560 | iso_pu_bacteria | 2977544691 | 2977546905 | 452 |
| 561 | iso_pu_bacteria | 2977872689 | 2977873582 | 452 |
| 562 | iso_pu_bacteria | 2977935797 | 2977940891 | 452 |
| 563 | iso_pu_bacteria | 2977950692 | 2977952867 | 452 |
| 564 | iso_pu_bacteria | 2977957713 | 2977959437 | 452 |
| 565 | iso_pu_bacteria | 2979793036 | 2979797742 | 452 |
| 566 | iso_pu_bacteria | 2987645492 | 2987648119 | 452 |
| 567 | iso_pu_bacteria | 2987673487 | 2987673712 | 452 |
| 568 | iso_pu_bacteria | 2996386984 | 2996389358 | 452 |
| 569 | iso_pu_bacteria | 3004239961 | 3004245866 | 452 |
| 570 | iso_pu_bacteria | 643692032 | 643822214 | 452 |
| 571 | iso_pu_bacteria | 649633066 | 649873306 | 452 |
| 572 | iso_pu_bacteria | 8003999396 | 8004003443 | 452 |
| 573 | iso_pu_bacteria | 8004300914 | 8004304504 | 452 |
| 574 | iso_pu_bacteria | 8004361976 | 8004368187 | 452 |
| 575 | iso_pu_bacteria | 8004695233 | 8004698876 | 452 |
| 576 | 3300003215 | JGI25153J46596_10006633 | JGI25153J46596_100066335 | 453 |
| 577 | 3300005563 | Ga0068855_100010532 | Ga0068855_1000105325 | 453 |
| 578 | 3300005578 | Ga0068854_100000056 | Ga0068854_100000056115 | 453 |
| 579 | 3300009093 | Ga0105240_10065614 | Ga0105240_100656146 | 453 |
| 580 | 3300010375 | Ga0105239_10045237 | Ga0105239_100452373 | 453 |
| 581 | 3300025258 | Ga0209129_1010251 | Ga0209129_10102511 | 453 |
| 582 | 3300025297 | Ga0209758_1000537 | Ga0209758_100053712 | 453 |
| 583 | 3300025913 | Ga0207695_10033043 | Ga0207695_100330432 | 453 |
| 584 | 3300025949 | Ga0207667_10000094 | Ga0207667_1000009489 | 453 |
| 585 | 3300025981 | Ga0207640_10000043 | Ga0207640_10000043126 | 453 |
| 586 | 3300046506 | Ga0495583_0007862 | Ga0495583_0007862_4771_6201 | 453 |
| 587 | 3300048928 | Ga0496125_0002729 | Ga0496125_0002729_14609_16054 | 453 |
| 588 | iso_pu_bacteria | 2643221644 | 2644247713 | 453 |
| 589 | iso_pu_bacteria | 2751185821 | 2753461152 | 453 |
| 590 | iso_pu_bacteria | 2791355094 | 2792643351 | 453 |
| 591 | iso_pu_bacteria | 2838029111 | 2838030949 | 453 |
| 592 | iso_pu_bacteria | 2842475841 | 2842477681 | 453 |
| 593 | iso_pu_bacteria | 2842502639 | 2842504447 | 453 |
| 594 | iso_pu_bacteria | 2856356410 | 2856358374 | 453 |
| 595 | iso_pu_bacteria | 2871488783 | 2871491333 | 453 |
| 596 | iso_pu_bacteria | 2878753008 | 2878757768 | 453 |
| 597 | iso_pu_bacteria | 2881861095 | 2881864965 | 453 |
| 598 | iso_pu_bacteria | 2882912400 | 2882915259 | 453 |
| 599 | iso_pu_bacteria | 2885318864 | 2885321577 | 453 |
| 600 | iso_pu_bacteria | 2903492973 | 2903506443 | 453 |
| 601 | iso_pu_bacteria | 2904424332 | 2904427440 | 453 |
| 602 | iso_pu_bacteria | 2924784321 | 2924785737 | 453 |
| 603 | iso_pu_bacteria | 2961170736 | 2961174311 | 453 |
| 604 | iso_pu_bacteria | 2967996073 | 2968000258 | 453 |
| 605 | iso_pu_bacteria | 2968003550 | 2968005470 | 453 |
| 606 | iso_pu_bacteria | 2970503327 | 2970506898 | 453 |
| 607 | iso_pu_bacteria | 2977821940 | 2977822300 | 453 |
| 608 | iso_pu_bacteria | 2977828996 | 2977832020 | 453 |
| 609 | iso_pu_bacteria | 2977986579 | 2977986799 | 453 |
| 610 | iso_pu_bacteria | 2979808191 | 2979812093 | 453 |
| 611 | iso_pu_bacteria | 8004374579 | 8004379279 | 453 |
| 612 | 3300035692 | Ga0373935_0061307 | Ga0373935_0061307_89_1618 | 454 |
| 613 | 3300044693 | Ga0466961_0006453 | Ga0466961_0006453_5703_7136 | 454 |
| 614 | 3300045049 | Ga0466959_0066038 | Ga0466959_0066038_313_1746 | 454 |
| 615 | 3300046512 | Ga0495610_0000813 | Ga0495610_0000813_24254_25663 | 454 |
| 616 | 3300046522 | Ga0495643_0028814 | Ga0495643_0028814_1060_2472 | 454 |
| 617 | iso_pu_bacteria | 2508501122 | 2509111487 | 454 |
| 618 | iso_pu_bacteria | 2512875024 | 2512958948 | 454 |
| 619 | iso_pu_bacteria | 2885350715 | 2885357946 | 454 |
| 620 | iso_pu_bacteria | 2896384573 | 2896385936 | 454 |
| 621 | iso_pu_bacteria | 2903448605 | 2903455393 | 454 |
| 622 | iso_pu_bacteria | 2906378014 | 2906382585 | 454 |
| 623 | iso_pu_bacteria | 2937848649 | 2937855119 | 454 |
| 624 | iso_pu_bacteria | 2968083720 | 2968090903 | 454 |
| 625 | iso_pu_bacteria | 2977922695 | 2977929212 | 454 |
| 626 | iso_pu_bacteria | 3000135777 | 3000140249 | 454 |
| 627 | iso_pu_bacteria | 3004211236 | 3004216322 | 454 |
| 628 | iso_pu_bacteria | 3004218560 | 3004224072 | 454 |
| 629 | iso_pu_bacteria | 3004334049 | 3004341337 | 454 |
| 630 | 3300005288 | Ga0065714_10000305 | Ga0065714_1000030511 | 455 |
| 631 | 3300005539 | Ga0068853_100025427 | Ga0068853_1000254274 | 455 |
| 632 | 3300005617 | Ga0068859_100208336 | Ga0068859_1002083362 | 455 |
| 633 | 3300006931 | Ga0097620_100208335 | Ga0097620_1002083352 | 455 |
| 634 | 3300009094 | Ga0111539_10000100 | Ga0111539_1000010050 | 455 |
| 635 | 3300009545 | Ga0105237_10130343 | Ga0105237_101303433 | 455 |
| 636 | 3300010375 | Ga0105239_10205152 | Ga0105239_102051521 | 455 |
| 637 | 3300025206 | Ga0209435_100009 | Ga0209435_100009237 | 455 |
| 638 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018237 | 455 |
| 639 | 3300025250 | Ga0209026_1000043 | Ga0209026_1000043237 | 455 |
| 640 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007237 | 455 |
| 641 | 3300026041 | Ga0207639_10050301 | Ga0207639_100503011 | 455 |
| 642 | 3300028379 | Ga0268266_10044597 | Ga0268266_100445974 | 455 |
| 643 | 3300046557 | Ga0495622_0000202 | Ga0495622_0000202_33159_34589 | 455 |
| 644 | 3300049579 | Ga0501043_0065552 | Ga0501043_0065552_395_1855 | 455 |
| 645 | 3300050511 | nmdc:mga08y16_62_c1 | nmdc:mga08y16_62_c1_34290_35747 | 455 |
| 646 | iso_pu_bacteria | 2524023207 | 2524452499 | 455 |
| 647 | iso_pu_bacteria | 2643221618 | 2644104161 | 455 |
| 648 | iso_pu_bacteria | 2643221655 | 2644307035 | 455 |
| 649 | iso_pu_bacteria | 2643221659 | 2644331520 | 455 |
| 650 | iso_pu_bacteria | 2643221698 | 2644540313 | 455 |
| 651 | iso_pu_bacteria | 2643221712 | 2644619272 | 455 |
| 652 | iso_pu_bacteria | 2773857925 | 2774870016 | 455 |
| 653 | iso_pu_bacteria | 2844163670 | 2844169416 | 455 |
| 654 | iso_pu_bacteria | 2874123672 | 2874127524 | 455 |
| 655 | iso_pu_bacteria | 2882456835 | 2882461286 | 455 |
| 656 | iso_pu_bacteria | 2936996657 | 2936998764 | 455 |
| 657 | iso_pu_bacteria | 8024486573 | 8024492453 | 455 |
| 658 | 3300001979 | JGI24740J21852_10000004 | JGI24740J21852_1000000418 | 456 |
| 659 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_100000422 | 456 |
| 660 | 3300002705 | JGI25156J39149_1000014 | JGI25156J39149_1000014159 | 456 |
| 661 | 3300002737 | JGI25162J39368_1000670 | JGI25162J39368_10006709 | 456 |
| 662 | 3300002738 | JGI25154J39366_1000096 | JGI25154J39366_100009632 | 456 |
| 663 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_1000005241 | 456 |
| 664 | 3300003214 | JGI25165J46597_1001403 | JGI25165J46597_10014035 | 456 |
| 665 | 3300025233 | Ga0209437_100057 | Ga0209437_100057226 | 456 |
| 666 | 3300025246 | Ga0209646_1004842 | Ga0209646_10048421 | 456 |
| 667 | 3300025261 | Ga0209233_1000130 | Ga0209233_100013028 | 456 |
| 668 | 3300030500 | Ga0268256_1011759 | Ga0268256_10117592 | 456 |
| 669 | 3300037471 | Ga0395905_0189005 | Ga0395905_0189005_471_1922 | 456 |
| 670 | 3300042010 | Ga0439452_004214 | Ga0439452_004214_1072_2502 | 456 |
| 671 | 3300042010 | Ga0439452_006400 | Ga0439452_006400_1188_2618 | 456 |
| 672 | 3300042185 | Ga0450909_000154 | Ga0450909_000154_5197_6627 | 456 |
| 673 | 3300046522 | Ga0495643_0012472 | Ga0495643_0012472_893_2323 | 456 |
| 674 | 3300046674 | Ga0495588_0002907 | Ga0495588_0002907_2254_3684 | 456 |
| 675 | 3300048922 | Ga0496119_0026392 | Ga0496119_0026392_2118_3581 | 456 |
| 676 | 3300048925 | Ga0496122_0016932 | Ga0496122_0016932_3381_4844 | 456 |
| 677 | 3300048926 | Ga0496123_0032039 | Ga0496123_0032039_636_2099 | 456 |
| 678 | 3300048927 | Ga0496124_0018862 | Ga0496124_0018862_1515_2978 | 456 |
| 679 | 3300048928 | Ga0496125_0041900 | Ga0496125_0041900_1977_3440 | 456 |
| 680 | 3300049459 | Ga0495678_011653 | Ga0495678_011653_1167_2597 | 456 |
| 681 | iso_pu_bacteria | 2512875016 | 2512931137 | 456 |
| 682 | iso_pu_bacteria | 2582581315 | 2585326525 | 456 |
| 683 | iso_pu_bacteria | 2667528174 | 2671113462 | 456 |
| 684 | iso_pu_bacteria | 2721755523 | 2722883147 | 456 |
| 685 | iso_pu_bacteria | 2775507266 | 2778178640 | 456 |
| 686 | iso_pu_bacteria | 2818991448 | 2819611255 | 456 |
| 687 | iso_pu_bacteria | 2839138175 | 2839143666 | 456 |
| 688 | iso_pu_bacteria | 2876363079 | 2876365606 | 456 |
| 689 | iso_pu_bacteria | 2903521522 | 2903523535 | 456 |
| 690 | iso_pu_bacteria | 2903528002 | 2903534169 | 456 |
| 691 | iso_pu_bacteria | 2919408235 | 2919411081 | 456 |
| 692 | iso_pu_bacteria | 2963644680 | 2963648081 | 456 |
| 693 | iso_pu_bacteria | 637000159 | 637074238 | 456 |
| 694 | iso_pu_bacteria | 8005645114 | 8005646965 | 456 |
| 695 | iso_pu_bacteria | 8005682033 | 8005688115 | 456 |
| 696 | 3300025925 | Ga0207650_10037522 | Ga0207650_100375225 | 457 |
| 697 | 3300027907 | Ga0207428_10092959 | Ga0207428_100929593 | 457 |
| 698 | 3300050492 | nmdc:mga0yw44_14127_c1 | nmdc:mga0yw44_14127_c1_1174_2619 | 457 |
| 699 | 2124908027 | MRS2a_Contig_222 | MRS2a_00124630 | 458 |
| 700 | 3300005563 | Ga0068855_100194899 | Ga0068855_1001948992 | 458 |
| 701 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013226 | 458 |
| 702 | 3300009545 | Ga0105237_10005220 | Ga0105237_1000522011 | 458 |
| 703 | 3300010375 | Ga0105239_10004443 | Ga0105239_1000444317 | 458 |
| 704 | 3300013104 | Ga0157370_10003433 | Ga0157370_1000343310 | 458 |
| 705 | 3300015262 | Ga0182007_10002371 | Ga0182007_100023714 | 458 |
| 706 | 3300025253 | Ga0209677_100382 | Ga0209677_10038211 | 458 |
| 707 | 3300025261 | Ga0209233_1000358 | Ga0209233_100035823 | 458 |
| 708 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044183 | 458 |
| 709 | 3300025914 | Ga0207671_10000400 | Ga0207671_1000040049 | 458 |
| 710 | 3300048903 | Ga0496100_0006646 | Ga0496100_0006646_1831_3291 | 458 |
| 711 | 3300048905 | Ga0496102_0041392 | Ga0496102_0041392_1042_2502 | 458 |
| 712 | 3300048906 | Ga0496103_0012713 | Ga0496103_0012713_449_1909 | 458 |
| 713 | 3300048916 | Ga0496113_0059542 | Ga0496113_0059542_860_2320 | 458 |
| 714 | 3300048919 | Ga0496116_0026740 | Ga0496116_0026740_411_1994 | 458 |
| 715 | 3300048920 | Ga0496117_0011833 | Ga0496117_0011833_2028_3488 | 458 |
| 716 | 3300048921 | Ga0496118_0013506 | Ga0496118_0013506_1978_3438 | 458 |
| 717 | 3300048923 | Ga0496120_0011566 | Ga0496120_0011566_4479_5939 | 458 |
| 718 | 3300048924 | Ga0496121_0049280 | Ga0496121_0049280_122_1582 | 458 |
| 719 | 3300048925 | Ga0496122_0045378 | Ga0496122_0045378_1155_2615 | 458 |
| 720 | 3300048926 | Ga0496123_0014523 | Ga0496123_0014523_3023_4483 | 458 |
| 721 | 3300048928 | Ga0496125_0019592 | Ga0496125_0019592_1904_3364 | 458 |
| 722 | 3300053125 | Ga0500618_005740 | Ga0500618_005740_1898_3358 | 458 |
| 723 | iso_pu_bacteria | 2582581308 | 2585280736 | 458 |
| 724 | iso_pu_bacteria | 2582581316 | 2585334129 | 458 |
| 725 | iso_pu_bacteria | 2585427527 | 2585531669 | 458 |
| 726 | iso_pu_bacteria | 2585427530 | 2585551384 | 458 |
| 727 | iso_pu_bacteria | 2615840626 | 2616306719 | 458 |
| 728 | iso_pu_bacteria | 2617270742 | 2617386383 | 458 |
| 729 | iso_pu_bacteria | 2808606982 | 2811842972 | 458 |
| 730 | iso_pu_bacteria | 2818991453 | 2819638814 | 458 |
| 731 | iso_pu_bacteria | 2842482326 | 2842484987 | 458 |
| 732 | iso_pu_bacteria | 3005416602 | 3005421607 | 458 |
| 733 | iso_pu_bacteria | 8005314921 | 8005319688 | 458 |
| 734 | iso_pu_bacteria | 8005484373 | 8005490312 | 458 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y58-assembly1.cif.gz_A | cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus | 0.9137 | 20 | 425 |
| 8pnl-assembly2.cif.gz_C | outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody | 0.8993 | 16 | 426 |
| 8pnl-assembly1.cif.gz_A | outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody | 0.8973 | 16 | 426 |
| 7d5p-assembly1.cif.gz_A | structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.8738 | 19 | 442 |
| 7d5p-assembly2.cif.gz_B | structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody | 0.8665 | 20 | 442 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG87_21_208_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9535 | 22 | 203 | 1.20.1250.20 |
| af_Q04301_34_211_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9521 | 20 | 191 | 1.20.1250.20 |
| af_P76269_18_258_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9492 | 21 | 259 | 1.20.1250.20 |
| af_P9WJX3_18_194_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9478 | 19 | 193 | 1.20.1250.20 |
| af_Q9HE13_92_349_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9396 | 23 | 268 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257QZJ3-F1-model_v4 | EmrB/QacA family drug resistance transporter | 0.9744 | 16 | 189 |
GO:0005886
GO:0022857 |
| AF-A0A537NMT5-F1-model_v4 | MFS transporter | 0.9657 | 19 | 169 |
GO:0005886
GO:0022857 |
| AF-A0A3S1U0X0-F1-model_v4 | MFS transporter | 0.956 | 25 | 161 |
GO:0005886
GO:0022857 |
| AF-A0A242MTR8-F1-model_v4 | MFS permease | 0.9547 | 19 | 167 |
GO:0016020
GO:0022857 |
| AF-A0A1S4CMP2-F1-model_v4 | Monosaccharide-sensing protein 1-like | 0.9403 | 14 | 136 |
GO:0016020
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar