F478054

General Info

Members Datasets Scaffolds Average Seq Length
732 604 1464 316

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0067097|Ga0496117_0067097_57_1133
Length 353
Sequence MVSRLWQSDIEKRIIITKLHEEQSNGKWPYRTHRKMETRMNLARTAMLLAFMTALFMGVGFLIGGQGGMMIALVIAAGMNLFSYWNSDKMVLSAYHAQEVDERNAPEFFTMIRDLSQNAGLPMPKVYIYESEQPNAFATGRNPENAAVAASTGLLQRLSPQEVAGVMAHELAHIQNRDTLTMTITATLAGAISMLGNFAFLFGGNRNNNNPLGFIGVLVAMIVAPVQMAISRTREYSADRRGAEICGNPLWLASALQKISGAAQRLHNEDAERNPATAHMFIINPLSGERMDNLFSTHPNTENRVAALQAMANEFSQPSTPPATNANAERKTRSVPSTGWGRGGNNERKGPWS

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
46 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
47 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
50 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
94 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
97 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
106 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
107 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
108 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
109 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
110 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
116 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
152 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
153 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
154 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
194 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
198 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
199 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
200 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
201 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
209 2509276019 Ensifer aridi TW10 Isolate Nodule
210 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
211 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
212 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
213 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
214 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
215 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
216 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
217 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
218 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
219 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
220 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
221 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
222 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
223 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
224 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
225 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
226 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
227 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
228 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
229 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
230 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
231 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
232 2516143018 Ensifer sp. BR816 Isolate Nodule
233 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
234 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
235 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
236 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
237 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
238 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
239 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
240 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
241 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
242 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
243 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
244 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
245 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
246 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
247 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
248 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
249 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
250 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
251 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
252 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
253 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
254 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
255 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
256 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
257 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
258 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
259 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
260 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
261 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
262 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
263 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
264 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
265 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
266 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
267 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
268 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
269 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
270 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
271 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
272 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
273 2643221557 Ensifer sp. Root558 Isolate Unclassified
274 2643221558 Rhizobium sp. Root149 Isolate Unclassified
275 2643221568 Rhizobium sp. Root564 Isolate Unclassified
276 2643221599 Rhizobium sp. Root708 Isolate Unclassified
277 2643221607 Rhizobium sp. Root73 Isolate Unclassified
278 2643221610 Ensifer sp. Root74 Isolate Unclassified
279 2643221618 Ensifer sp. Root231 Isolate Unclassified
280 2643221626 Ensifer sp. Root31 Isolate Unclassified
281 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
282 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
283 2643221655 Ensifer sp. Root1252 Isolate Unclassified
284 2643221668 Ensifer sp. Root423 Isolate Unclassified
285 2643221675 Ensifer sp. Root1298 Isolate Unclassified
286 2643221680 Ensifer sp. Root1312 Isolate Unclassified
287 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
288 2643221688 Rhizobium sp. Root482 Isolate Unclassified
289 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
290 2643221698 Ensifer sp. Root142 Isolate Unclassified
291 2643221712 Ensifer sp. Root258 Isolate Unclassified
292 2643221718 Rhizobium sp. Root268 Isolate Unclassified
293 2643221723 Ensifer sp. Root278 Isolate Unclassified
294 2643221726 Ensifer sp. Root954 Isolate Unclassified
295 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
296 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
297 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
298 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
299 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
300 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
301 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
302 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
303 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
304 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
305 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
306 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
307 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
308 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
309 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
310 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
311 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
312 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
313 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
314 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
315 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
316 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
317 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
318 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
319 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
320 2791355256 Rhizobium sp. M10 Isolate Nodule
321 2791355261 Rhizobium sp. J15 Isolate Nodule
322 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
323 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
324 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
325 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
326 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
327 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
328 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
329 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
330 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
331 2802429633 Rhizobium anhuiense J3 Isolate Nodule
332 2802429634 Rhizobium anhuiense S10 Isolate Nodule
333 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
334 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
335 2802429637 Rhizobium anhuiense C15 Isolate Nodule
336 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
337 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
338 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
339 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
340 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
341 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
342 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
343 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
344 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
345 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
346 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
347 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
348 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
349 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
350 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
351 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
352 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
353 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
354 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
355 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
356 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
357 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
358 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
359 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
360 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
361 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
362 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
363 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
364 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
365 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
366 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
367 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
368 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
369 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
370 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
371 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
372 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
373 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
374 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
375 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
376 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
377 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
378 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
379 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
380 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
381 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
382 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
383 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
384 2909042592 Labrys sp. LIt4 Isolate Nodule
385 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
386 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
387 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
388 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
389 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
390 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
391 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
392 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
393 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
394 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
395 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
396 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
397 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
398 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
399 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
400 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
401 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
402 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
403 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
404 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
405 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
406 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
407 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
408 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
409 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
410 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
411 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
412 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
413 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
414 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
415 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
416 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
417 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
418 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
419 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
420 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
421 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
422 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
423 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
424 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
425 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
426 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
427 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
428 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
429 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
430 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
431 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
432 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
433 2933599457 Rhizobium phaseoli M3 Isolate Nodule
434 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
435 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
436 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
437 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
438 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
439 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
440 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
441 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
442 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
443 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
444 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
445 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
446 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
447 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
448 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
449 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
450 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
451 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
452 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
453 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
454 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
455 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
456 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
457 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
458 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
459 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
460 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
461 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
462 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
463 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
464 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
465 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
466 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
467 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
468 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
469 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
470 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
471 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
472 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
473 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
474 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
475 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
476 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
477 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
478 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
479 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
480 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
481 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
482 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
483 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
484 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
485 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
486 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
487 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
488 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
489 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
490 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
491 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
492 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
493 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
494 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
495 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
496 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
497 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
498 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
499 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
500 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
501 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
502 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
503 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
504 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
505 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
506 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
507 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
508 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
509 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
510 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
511 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
512 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
513 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
514 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
515 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
516 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
517 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
518 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
519 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
520 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
521 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
522 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
523 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
524 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
525 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
526 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
527 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
528 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
529 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
530 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
531 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
532 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
533 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
534 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
535 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
536 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
537 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
538 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
539 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
540 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
541 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
542 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
543 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
544 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
545 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
546 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
547 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
548 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
549 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
550 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
551 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
552 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
553 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
554 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
555 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
556 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
557 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
558 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
559 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
560 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
561 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
562 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
563 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
564 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
565 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
566 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
567 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
568 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
569 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
570 2996893221 Rhizobium sp. R635 Isolate Nodule
571 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
572 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
573 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
574 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
575 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
576 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
577 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
578 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
579 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
580 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
581 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
582 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
583 8005382845 Rhizobium sp. R634 Isolate Nodule
584 8005395548 Rhizobium sp. R339 Isolate Nodule
585 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
586 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
587 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
588 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
589 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
590 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
591 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
592 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
593 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
594 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
595 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
596 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
597 8024501048 Rhizobium sp. H4 Isolate Nodule
598 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
599 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
600 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
601 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
602 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
603 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
604 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 45.22
Metatranscriptomes 0.27
Isolates 54.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 14.75
Nodule 42.62
Rhizoplane 1.09
Rhizosphere 24.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0067097 3300048920 Bacteria 2429
2 JGI24740J21852_10001569 3300001979 Bacteria 10488
3 JGI25155J39150_1000018 3300002704 Bacteria 157606
4 JGI25156J39149_1000055 3300002705 Bacteria 87733
5 JGI25162J39368_1000253 3300002737 Bacteria 51894
6 JGI25162J39368_1000524 3300002737 Bacteria 28601
7 JGI25154J39366_1000069 3300002738 Bacteria 96438
8 JGI25157J39369_1000076 3300002741 Bacteria 87678
9 JGI25159J45721_1000022 3300002987 Bacteria 119463
10 JGI25159J45721_1019021 3300002987 Bacteria 1365
11 JGI25151J46595_10004202 3300003187 Bacteria 7668
12 JGI25151J46595_10004375 3300003187 Bacteria 7488
13 JGI25165J46597_1000723 3300003214 Bacteria 25872
14 JGI25165J46597_1001404 3300003214 Bacteria 13109
15 JGI25153J46596_10001515 3300003215 Bacteria 13851
16 JGI25153J46596_10007129 3300003215 Bacteria 5546
17 JGI25160J50197_1000051 3300003354 Bacteria 132923
18 JGI25160J50197_1000056 3300003354 Bacteria 119463
19 JGI25160J50197_1000317 3300003354 Bacteria 33502
20 JGI25161J50226_1000011 3300003374 Bacteria 210140
21 JGI25161J50226_1000413 3300003374 Bacteria 20791
22 JGI25161J50226_1000646 3300003374 Bacteria 14020
23 JGI25161J50226_1002096 3300003374 Bacteria 5381
24 Ga0055526_1001154 3300003771 Bacteria 19133
25 Ga0055526_1003525 3300003771 Bacteria 9884
26 Ga0055524_1000763 3300003775 Bacteria 21654
27 Ga0055524_1006132 3300003775 Bacteria 5257
28 Ga0055536_1005618 3300003781 Bacteria 6076
29 Ga0055528_1001009 3300003790 Bacteria 18687
30 Ga0055528_1011854 3300003790 Bacteria 3425
31 Ga0055528_1016405 3300003790 Bacteria 2620
32 Ga0055540_1000835 3300003792 Bacteria 20687
33 Ga0055540_1027435 3300003792 Bacteria 1362
34 Ga0055531_10009729 3300003794 Bacteria 4880
35 Ga0055531_10020802 3300003794 Bacteria 2576
36 Ga0055543_1000041 3300004625 Bacteria 118501
37 Ga0055543_1000431 3300004625 Bacteria 26005
38 Ga0055543_1000682 3300004625 Bacteria 17718
39 Ga0065165_1000135 3300005262 Bacteria 127785
40 Ga0065165_1000155 3300005262 Bacteria 119501
41 Ga0065165_1002015 3300005262 Bacteria 18962
42 Ga0070670_100002528 3300005331 Bacteria 15081
43 Ga0068869_100229561 3300005334 Bacteria 1474
44 Ga0070665_100091719 3300005548 Bacteria 3043
45 Ga0068856_100173301 3300005614 Bacteria 2170
46 Ga0075365_10000409 3300006038 Bacteria 15775
47 Ga0075365_10002336 3300006038 Bacteria 9237
48 Ga0075365_10016899 3300006038 Bacteria 4452
49 Ga0075365_10034079 3300006038 Bacteria 3286
50 Ga0075365_10256611 3300006038 Bacteria 1229
51 Ga0075368_10018237 3300006042 Bacteria 2636
52 Ga0075364_10000006 3300006051 Bacteria 86571
53 Ga0075364_10002563 3300006051 Bacteria 10184
54 Ga0075362_10005557 3300006177 Bacteria 4627
55 Ga0075370_10000490 3300006353 Bacteria 14931
56 Ga0075370_10064995 3300006353 Bacteria 2081
57 Ga0079104_1000310 3300006946 Bacteria 61815
58 Ga0079104_1004373 3300006946 Bacteria 6093
59 Ga0079104_1013407 3300006946 Bacteria 2525
60 Ga0105244_10131016 3300009036 Bacteria 1210
61 Ga0105240_10000142 3300009093 Bacteria 146932
62 Ga0105240_10426616 3300009093 Bacteria 1489
63 Ga0105237_10008145 3300009545 Bacteria 11379
64 Ga0105249_10003472 3300009553 Bacteria 13652
65 Ga0123341_1000436 3300009765 Bacteria 25013
66 Ga0105239_10001079 3300010375 Bacteria 37830
67 Ga0105239_10586991 3300010375 Bacteria 1270
68 Ga0157371_10016970 3300013102 Bacteria 5421
69 Ga0157370_10000855 3300013104 Bacteria 38623
70 Ga0157369_10203701 3300013105 Bacteria 2076
71 Ga0157369_10256829 3300013105 Bacteria 1823
72 Ga0157369_10268785 3300013105 Bacteria 1777
73 Ga0171463_1004 3300013249 Bacteria 437207
74 Ga0157372_10306138 3300013307 Bacteria 1849
75 Ga0157372_10591622 3300013307 Bacteria 1293
76 Ga0182007_10004603 3300015262 Bacteria 6232
77 Ga0182005_1005520 3300015265 Bacteria 3945
78 Ga0183363_1139 3300015690 Bacteria 18545
79 Ga0214542_1005348 3300021321 Bacteria 24469
80 Ga0214542_1010983 3300021321 Bacteria 12744
81 Ga0214543_1000015 3300021327 Bacteria 305679
82 Ga0214543_1005096 3300021327 Bacteria 24495
83 Ga0213875_10020435 3300021388 Bacteria 3177
84 Ga0228711_1000004 3300022739 Bacteria 250146
85 Ga0228710_1000002 3300022740 Bacteria 287279
86 Ga0209435_100031 3300025206 Bacteria 164115
87 Ga0209760_103008 3300025207 Bacteria 1524
88 Ga0207427_105047 3300025231 Bacteria 1975
89 Ga0209437_100179 3300025233 Bacteria 134210
90 Ga0209437_100181 3300025233 Bacteria 132953
91 Ga0207425_1009883 3300025245 Bacteria 2349
92 Ga0209646_1000102 3300025246 Bacteria 164115
93 Ga0209646_1011065 3300025246 Bacteria 1402
94 Ga0209026_1000096 3300025250 Bacteria 164115
95 Ga0209677_100353 3300025253 Bacteria 28643
96 Ga0209759_1000090 3300025256 Bacteria 164115
97 Ga0209129_1001428 3300025258 Bacteria 13345
98 Ga0209233_1000185 3300025261 Bacteria 133788
99 Ga0209233_1000212 3300025261 Bacteria 110364
100 Ga0209233_1000263 3300025261 Bacteria 79293
101 Ga0209233_1002422 3300025261 Bacteria 6884
102 Ga0209673_1000476 3300025273 Bacteria 66898
103 Ga0209673_1001239 3300025273 Bacteria 26592
104 Ga0209673_1003238 3300025273 Bacteria 9839
105 Ga0209130_1000058 3300025284 Bacteria 210250
106 Ga0209130_1000133 3300025284 Bacteria 119561
107 Ga0209676_1012006 3300025292 Bacteria 3444
108 Ga0209025_1000042 3300025294 Bacteria 370577
109 Ga0209025_1000453 3300025294 Bacteria 80110
110 Ga0209025_1000536 3300025294 Bacteria 71932
111 Ga0209564_1000193 3300025295 Bacteria 141731
112 Ga0209564_1000894 3300025295 Bacteria 39163
113 Ga0209758_1000351 3300025297 Bacteria 83626
114 Ga0209758_1000406 3300025297 Bacteria 73962
115 Ga0209758_1000780 3300025297 Bacteria 45747
116 Ga0209758_1019587 3300025297 Bacteria 3255
117 Ga0209256_1001126 3300025299 Bacteria 30480
118 Ga0209256_1001816 3300025299 Bacteria 20054
119 Ga0209256_1003112 3300025299 Bacteria 12135
120 Ga0209256_1026651 3300025299 Bacteria 1661
121 Ga0207426_1000131 3300025302 Bacteria 210250
122 Ga0207426_1000214 3300025302 Bacteria 137296
123 Ga0207426_1000248 3300025302 Bacteria 119561
124 Ga0209051_1000118 3300025303 Bacteria 149426
125 Ga0209051_1000822 3300025303 Bacteria 32088
126 Ga0209051_1001422 3300025303 Bacteria 20512
127 Ga0209051_1030525 3300025303 Bacteria 2090
128 Ga0209257_1008317 3300025304 Bacteria 5941
129 Ga0209257_1010182 3300025304 Bacteria 4829
130 Ga0207647_10128232 3300025904 Bacteria 1492
131 Ga0207695_10000234 3300025913 Bacteria 146987
132 Ga0207671_10000043 3300025914 Bacteria 206915
133 Ga0207650_10001807 3300025925 Bacteria 15133
134 Ga0207706_10010561 3300025933 Bacteria 8433
135 Ga0207667_10254099 3300025949 Bacteria 1798
136 Ga0207712_10394471 3300025961 Bacteria 1162
137 Ga0207668_10308899 3300025972 Bacteria 1308
138 Ga0207702_10212176 3300026078 Bacteria 1800
139 Ga0207674_10279138 3300026116 Bacteria 1618
140 Ga0207698_10297934 3300026142 Bacteria 1500
141 Ga0209281_1000028 3300027111 Bacteria 440027
142 Ga0209281_1000030 3300027111 Bacteria 425931
143 Ga0209281_1000144 3300027111 Bacteria 172471
144 Ga0209371_1021560 3300027312 Bacteria 1558
145 Ga0209282_1000004 3300027666 Bacteria 425931
146 Ga0268266_10012935 3300028379 Bacteria 7198
147 Ga0268266_10069758 3300028379 Bacteria 3046
148 Ga0307515_10001049 3300028794 Bacteria 63286
149 Ga0307515_10002808 3300028794 Bacteria 37051
150 Ga0307515_10003215 3300028794 Bacteria 34578
151 Ga0268256_1014104 3300030500 Bacteria 2388
152 Ga0307513_10001726 3300031456 Bacteria 31179
153 Ga0307408_100014748 3300031548 Bacteria 5195
154 Ga0316579_10125700 3300031691 Bacteria 1234
155 Ga0265314_10029460 3300031711 Bacteria 4080
156 Ga0307516_10082433 3300031730 Bacteria 3058
157 Ga0315914_1000001 3300031967 Bacteria 416633
158 Ga0307416_100081775 3300032002 Bacteria 2733
159 Ga0315913_1000004 3300033430 Bacteria 192741
160 Ga0315915_1000002 3300033464 Bacteria 425854
161 Ga0373953_0046757 3300035117 Bacteria 1739
162 Ga0373954_0063538 3300035118 Bacteria 1745
163 Ga0373956_0039131 3300035119 Bacteria 2101
164 Ga0373943_0067484 3300035170 Bacteria 1804
165 Ga0373927_0001342 3300035695 Bacteria 18565
166 Ga0373925_0000830 3300037068 Bacteria 28511
167 Ga0436364_0154238 3300037853 Bacteria 9599
168 Ga0439436_0005093 3300041404 Bacteria 4026
169 Ga0439438_049890 3300041405 Bacteria 1067
170 Ga0439466_0037428 3300041411 Bacteria 1633
171 Ga0451845_0299746 3300041501 Bacteria 2091
172 Ga0451847_0601085 3300041503 Bacteria 1723
173 Ga0451851_0232026 3300041507 Bacteria 2028
174 Ga0451853_2638751 3300041512 Bacteria 2556
175 Ga0439431_0041950 3300041997 Bacteria 1168
176 Ga0439432_048534 3300042006 Bacteria 1329
177 Ga0439449_0007684 3300042007 Bacteria 4096
178 Ga0439449_0025555 3300042007 Bacteria 2207
179 Ga0439449_0031309 3300042007 Bacteria 1983
180 Ga0439462_0021917 3300042015 Bacteria 1671
181 Ga0450906_003965 3300042145 Bacteria 3132
182 Ga0466963_0013780 3300044694 Bacteria 4975
183 Ga0466970_0045160 3300044765 Bacteria 2345
184 Ga0495592_0099673 3300046454 Bacteria 2072
185 Ga0495590_0005422 3300046457 Bacteria 5063
186 Ga0495629_0173323 3300046459 Bacteria 1496
187 Ga0495638_0080656 3300046460 Bacteria 1976
188 Ga0495585_0032892 3300046492 Bacteria 2937
189 Ga0495607_0021613 3300046501 Bacteria 4047
190 Ga0495606_0013862 3300046507 Bacteria 6328
191 Ga0495610_0003473 3300046512 Bacteria 12266
192 Ga0495632_0003903 3300046519 Bacteria 10361
193 Ga0495648_0040268 3300046524 Bacteria 2965
194 Ga0495663_0037240 3300046525 Bacteria 1467
195 Ga0495652_0290885 3300046529 Bacteria 1192
196 Ga0495654_0000143 3300046530 Bacteria 74495
197 Ga0495640_0105301 3300046533 Bacteria 1848
198 Ga0495587_0140742 3300046536 Bacteria 1377
199 Ga0495621_0067290 3300046539 Bacteria 1312
200 Ga0495656_0003093 3300046615 Bacteria 5594
201 Ga0495656_0053137 3300046615 Bacteria 1740
202 Ga0495588_0002054 3300046674 Bacteria 8610
203 Ga0495657_0007569 3300046675 Bacteria 8384
204 Ga0495646_0162066 3300046680 Bacteria 1237
205 Ga0495658_0101250 3300046683 Bacteria 1720
206 Ga0495649_0013067 3300046694 Bacteria 4800
207 Ga0495600_0004789 3300046809 Bacteria 8122
208 Ga0495680_0391003 3300047322 Bacteria 962
209 Ga0495687_012206 3300047443 Bacteria 4558
210 Ga0495675_0317770 3300047444 Bacteria 922
211 Ga0495686_0001104 3300047472 Bacteria 32036
212 Ga0495686_0065021 3300047472 Bacteria 2256
213 Ga0495686_0097019 3300047472 Bacteria 1783
214 Ga0495626_0022058 3300048091 Bacteria 3149
215 Ga0496102_0017668 3300048905 Bacteria 6251
216 Ga0496110_0163159 3300048913 Bacteria 2020
217 Ga0496111_0004902 3300048914 Bacteria 8503
218 Ga0496116_0000057 3300048919 Bacteria 281652
219 Ga0496116_0009575 3300048919 Bacteria 8250
220 Ga0496117_0001716 3300048920 Bacteria 30323
221 Ga0496117_0013293 3300048920 Bacteria 7192
222 Ga0496118_0014418 3300048921 Bacteria 7403
223 Ga0496119_0024907 3300048922 Bacteria 4193
224 Ga0496119_0032392 3300048922 Bacteria 3484
225 Ga0496120_0023184 3300048923 Bacteria 3888
226 Ga0496120_0043257 3300048923 Bacteria 2625
227 Ga0496121_0000034 3300048924 Bacteria 377095
228 Ga0496121_0000888 3300048924 Bacteria 53958
229 Ga0496121_0016201 3300048924 Bacteria 7715
230 Ga0496121_0017709 3300048924 Bacteria 7252
231 Ga0496121_0018081 3300048924 Bacteria 7132
232 Ga0496121_0055116 3300048924 Bacteria 3315
233 Ga0496122_0000308 3300048925 Bacteria 107960
234 Ga0496122_0001941 3300048925 Bacteria 31047
235 Ga0496122_0008781 3300048925 Bacteria 10798
236 Ga0496122_0089164 3300048925 Bacteria 2110
237 Ga0496123_0000066 3300048926 Bacteria 210327
238 Ga0496123_0013756 3300048926 Bacteria 6763
239 Ga0496123_0050626 3300048926 Bacteria 2773
240 Ga0496124_0000294 3300048927 Bacteria 93153
241 Ga0496124_0001215 3300048927 Bacteria 39879
242 Ga0496124_0005671 3300048927 Bacteria 13921
243 Ga0496124_0016660 3300048927 Bacteria 6973
244 Ga0496124_0041830 3300048927 Bacteria 3950
245 Ga0496124_0125821 3300048927 Bacteria 2042
246 Ga0496124_0202058 3300048927 Bacteria 1510
247 Ga0496125_0000030 3300048928 Bacteria 375023
248 Ga0496125_0000288 3300048928 Bacteria 99681
249 Ga0496126_0000115 3300048929 Bacteria 188546
250 Ga0496126_0000258 3300048929 Bacteria 113843
251 Ga0496126_0027368 3300048929 Bacteria 5447
252 Ga0496126_0079175 3300048929 Bacteria 2909
253 Ga0495678_020781 3300049459 Bacteria 2900
254 Ga0501031_0012275 3300049568 Bacteria 5584
255 Ga0501032_0025600 3300049569 Bacteria 4067
256 Ga0501032_0089601 3300049569 Bacteria 2042
257 Ga0501033_0000293 3300049570 Bacteria 48186
258 Ga0501033_0103712 3300049570 Bacteria 2074
259 Ga0501033_0103999 3300049570 Bacteria 2070
260 Ga0501033_0143698 3300049570 Bacteria 1724
261 Ga0501033_0175645 3300049570 Bacteria 1537
262 Ga0501034_0000702 3300049571 Bacteria 50840
263 Ga0501034_0097002 3300049571 Bacteria 2944
264 Ga0501036_0081432 3300049572 Bacteria 2736
265 Ga0501036_0184911 3300049572 Bacteria 1754
266 Ga0501037_0000007 3300049573 Bacteria 215187
267 Ga0501037_0049865 3300049573 Bacteria 3065
268 Ga0501038_0163671 3300049574 Bacteria 1806
269 Ga0501038_0252931 3300049574 Bacteria 1395
270 Ga0501043_0000034 3300049579 Bacteria 133724
271 Ga0501043_0117934 3300049579 Bacteria 2082
272 Ga0501043_0119842 3300049579 Bacteria 2063
273 Ga0501046_0000241 3300049580 Bacteria 56231
274 Ga0501047_0053950 3300049581 Bacteria 3889
275 Ga0501067_0051112 3300049583 Bacteria 2292
276 Ga0501068_0148679 3300049584 Bacteria 1471
277 Ga0501069_0000017 3300049585 Bacteria 141492
278 Ga0501069_0052457 3300049585 Bacteria 2271
279 Ga0501069_0055997 3300049585 Bacteria 2196
280 Ga0501070_0001269 3300049586 Bacteria 22673
281 Ga0501070_0009951 3300049586 Bacteria 8040
282 Ga0501070_0101494 3300049586 Bacteria 2380
283 Ga0501070_0183761 3300049586 Bacteria 1720
284 Ga0501070_0186592 3300049586 Bacteria 1705
285 Ga0501070_0428024 3300049586 Bacteria 1068
286 Ga0501071_0003548 3300049587 Bacteria 9765
287 Ga0501073_0014200 3300049589 Bacteria 5784
288 Ga0501074_0000060 3300049590 Bacteria 54314
289 Ga0501076_0111779 3300049592 Bacteria 2209
290 Ga0501076_0399997 3300049592 Bacteria 1129
291 Ga0501080_0001013 3300049742 Bacteria 23083
292 Ga0501080_0072218 3300049742 Bacteria 3211
293 Ga0501083_0000511 3300049744 Bacteria 24743
294 Ga0501083_0064213 3300049744 Bacteria 2447
295 Ga0501241_014837 3300049758 Bacteria 1417
296 Ga0501280_002847 3300049776 Bacteria 2782
297 Ga0501035_0000159 3300049822 Bacteria 82264
298 Ga0501035_0000772 3300049822 Bacteria 34369
299 Ga0501035_0107540 3300049822 Bacteria 2445
300 Ga0501035_0258909 3300049822 Bacteria 1475
301 Ga0501044_0000010 3300049823 Bacteria 260121
302 Ga0501044_0013069 3300049823 Bacteria 8984
303 Ga0501044_0102271 3300049823 Bacteria 2881
304 Ga0501044_0103971 3300049823 Bacteria 2854
305 Ga0501044_0248726 3300049823 Bacteria 1720
306 nmdc:mga00v17_65314_c1 3300050491 Bacteria 2245
307 nmdc:mga00v17_89_c1 3300050491 Bacteria 55686
308 nmdc:mga0yw44_1851_c1 3300050492 Bacteria 8685
309 nmdc:mga04h51_3008_c1 3300050495 Bacteria 4056
310 nmdc:mga0sz30_62040_c1 3300050516 Bacteria 1598
311 Ga0495601_0037926 3300053077 Bacteria 3012
312 Ga0495612_0014539 3300053078 Bacteria 3164
313 Ga0500643_007497 3300053087 Bacteria 4388
314 Ga0500556_0032151 3300053104 Bacteria 1791
315 Ga0500557_003125 3300053105 Bacteria 3220
316 Ga0500560_006406 3300053107 Bacteria 2692
317 Ga0500594_0005292 3300053118 Bacteria 2860
318 Ga0500568_0044554 3300053139 Bacteria 1769
319 Ga0500573_0001866 3300053140 Bacteria 10267
320 Ga0500573_0010900 3300053140 Bacteria 5079
321 Ga0500588_0059056 3300053146 Bacteria 1223
322 Ga0500604_0028078 3300053151 Bacteria 1632
323 Ga0500616_0000448 3300053153 Bacteria 53998
324 Ga0500616_0079543 3300053153 Bacteria 1650
325 Ga0500620_000445 3300053155 Bacteria 7473
326 Ga0500622_0000169 3300053156 Bacteria 70224
327 Ga0500624_004046 3300053157 Bacteria 1922
328 Ga0500624_010039 3300053157 Bacteria 1357
329 Ga0500636_0000030 3300053177 Bacteria 77501
330 Ga0500636_0002620 3300053177 Bacteria 9993
331 Ga0587073_0011046 3300059492 Bacteria 1533
332 Ga0587106_015816 3300059605 Bacteria 1059
333 Ga0466962_0073795 3300061719 Bacteria 1630
334 2509108871 2508501122 Bacteria 6292184
335 2509378001 2509276019 Bacteria 6802256
336 2510135410 2510065019 Bacteria 6903379
337 2510305812 2510065057 Bacteria 6649661
338 2511135854 2510917022 Bacteria 6504556
339 2511172503 2510917026 Bacteria 7046020
340 2511388934 2511231027 Bacteria 5013807
341 2511498578 2511231052 Bacteria 6974333
342 2512534727 2512047086 Bacteria 6850303
343 2512973461 2512875026 Bacteria 6861065
344 2513572891 2513237084 Bacteria 7231967
345 2513586374 2513237086 Bacteria 7265287
346 2513602022 2513237089 Bacteria 6553624
347 2513615811 2513237091 Bacteria 6900273
348 2513634926 2513237093 Bacteria 7545552
349 2513711513 2513237103 Bacteria 7647401
350 2513885377 2513237140 Bacteria 7076289
351 2513904646 2513237143 Bacteria 6664116
352 2513983476 2513237156 Bacteria 6402557
353 2513998289 2513237159 Bacteria 6810126
354 2514003380 2513237160 Bacteria 6650282
355 2514586796 2513237351 Bacteria 6968952
356 2515114582 2515075009 Bacteria 7288508
357 2515612442 2515154107 Bacteria 6795637
358 2516205683 2516143018 Bacteria 6951533
359 2516894855 2516653046 Bacteria 6989037
360 2517038225 2516653077 Bacteria 7555578
361 2517097242 2517093000 Bacteria 7412387
362 2517571536 2517487022 Bacteria 7227575
363 2524450328 2524023207 Bacteria 6813453
364 2524461175 2524023209 Bacteria 6679728
365 2551680660 2551306084 Bacteria 8942552
366 2551685164 2551306085 Bacteria 7347181
367 2551691054 2551306086 Bacteria 6843938
368 2551697616 2551306087 Bacteria 7351905
369 2551710788 2551306089 Bacteria 7162724
370 2551724586 2551306091 Bacteria 7086830
371 2551729196 2551306091 Bacteria 7086830
372 2551731311 2551306091 Bacteria 7086830
373 2551736228 2551306092 Bacteria 6992595
374 2551745950 2551306093 Bacteria 7064773
375 2558867497 2558860100 Bacteria 8458965
376 2585166516 2582581283 Bacteria 6030556
377 2585267162 2582581306 Bacteria 6450535
378 2585272056 2582581307 Bacteria 6597605
379 2585279640 2582581308 Bacteria 7413247
380 2585327478 2582581315 Bacteria 7318924
381 2585333985 2582581316 Bacteria 7774528
382 2585388213 2582581865 Bacteria 6644329
383 2585396190 2582581866 Bacteria 6859583
384 2585535720 2585427527 Bacteria 7273426
385 2585543015 2585427528 Bacteria 6842387
386 2585551097 2585427530 Bacteria 7383882
387 2585563399 2585427531 Bacteria 6992870
388 2585839216 2585427593 Bacteria 7141551
389 2585897179 2585427608 Bacteria 6544331
390 2585909094 2585427609 Bacteria 6667127
391 2585998065 2585427633 Bacteria 6413184
392 2586002645 2585427634 Bacteria 6455027
393 2587984508 2585428125 Bacteria 6662905
394 2599335758 2599185156 Bacteria 5403036
395 2599722627 2599185236 Bacteria 6875203
396 2600193963 2599185352 Bacteria 7228948
397 2600377431 2600254933 Bacteria 4750527
398 2616306428 2615840626 Bacteria 7921970
399 2616551084 2615840698 Bacteria 7319877
400 2617382317 2617270742 Bacteria 6808054
401 2643807951 2643221557 Bacteria 7184309
402 2643814834 2643221558 Bacteria 5460675
403 2643854825 2643221568 Bacteria 5187270
404 2644002634 2643221599 Bacteria 6292121
405 2644052430 2643221607 Bacteria 6314006
406 2644068858 2643221610 Bacteria 7480339
407 2644105774 2643221618 Bacteria 7717186
408 2644146342 2643221626 Bacteria 8069654
409 2644201187 2643221636 Bacteria 6583769
410 2644209655 2643221637 Bacteria 5345260
411 2644310387 2643221655 Bacteria 7722067
412 2644378416 2643221668 Bacteria 7306521
413 2644419929 2643221675 Bacteria 7473456
414 2644453285 2643221680 Bacteria 7473610
415 2644484708 2643221686 Bacteria 6310811
416 2644492567 2643221688 Bacteria 5260751
417 2644501229 2643221689 Bacteria 6042950
418 2644544978 2643221698 Bacteria 7756764
419 2644615372 2643221712 Bacteria 7729434
420 2644653183 2643221718 Bacteria 5345506
421 2644675084 2643221723 Bacteria 7095460
422 2644688688 2643221726 Bacteria 7455827
423 2657682320 2657244999 Bacteria 5946535
424 2671116038 2667528174 Bacteria 6435400
425 2671693662 2671180139 Bacteria 4196045
426 2692319851 2690316117 Bacteria 6800650
427 2720633484 2718218235 Bacteria 6630699
428 2720777182 2718218269 Bacteria 6906114
429 2723028780 2721755556 Bacteria 6745503
430 2723562393 2721755684 Bacteria 6859907
431 2723569089 2721755685 Bacteria 6704835
432 2724091789 2721755819 Bacteria 6906405
433 2724106354 2721755822 Bacteria 6726041
434 2725945772 2724679232 Bacteria 7646494
435 2730109716 2728369352 Bacteria 6745171
436 2738947088 2738541317 Bacteria 5340176
437 2739037711 2738541333 Bacteria 7106503
438 2753458490 2751185821 Bacteria 6189929
439 2757571002 2757320392 Bacteria 3737298
440 2766064093 2765235942 Bacteria 7445910
441 2776269672 2775506902 Bacteria 6208009
442 2776282601 2775506904 Bacteria 5954060
443 2778179210 2775507266 Bacteria 7392367
444 2792582330 2791355082 Bacteria 5973319
445 2792621818 2791355091 Bacteria 6135441
446 2792628924 2791355092 Bacteria 6248105
447 2792640065 2791355094 Bacteria 7011481
448 2793295472 2791355256 Bacteria 6798008
449 2793327448 2791355261 Bacteria 6661293
450 2802717098 2802428858 Bacteria 6636079
451 2802724914 2802428859 Bacteria 6667919
452 2802729664 2802428860 Bacteria 6525526
453 2802737010 2802428861 Bacteria 6534206
454 2802743415 2802428862 Bacteria 6633353
455 2802749459 2802428863 Bacteria 6410669
456 2804753786 2802429268 Bacteria 6094027
457 2805926366 2802429605 Bacteria 6875453
458 2805934092 2802429606 Bacteria 6346811
459 2806047745 2802429633 Bacteria 7341974
460 2806055321 2802429634 Bacteria 7083200
461 2806062202 2802429635 Bacteria 7650140
462 2806070039 2802429636 Bacteria 7597525
463 2806076661 2802429637 Bacteria 7067217
464 2819611965 2818991448 Bacteria 6772224
465 2819638495 2818991453 Bacteria 7181617
466 2821129218 2821123053 Bacteria 7836056
467 2838034109 2838029111 Bacteria 6603031
468 2838072287 2838068647 Bacteria 6208656
469 2838078073 2838074704 Bacteria 6785777
470 2838672319 2838668709 Bacteria 6671819
471 2838704812 2838701080 Bacteria 6669771
472 2838742156 2838736955 Bacteria 5760694
473 2840766262 2840764183 Bacteria 6358399
474 2841846012 2841840854 Bacteria 5761912
475 2842116587 2842110456 Bacteria 7656360
476 2842145623 2842140634 Bacteria 5759631
477 2842148952 2842146304 Bacteria 5957337
478 2842194727 2842192696 Bacteria 6147454
479 2842221948 2842217011 Bacteria 7497767
480 2842254492 2842250916 Bacteria 6579627
481 2842302619 2842298080 Bacteria 6123127
482 2842321263 2842317721 Bacteria 6793725
483 2842358879 2842357229 Bacteria 6485165
484 2842425919 2842422224 Bacteria 6239196
485 2842480923 2842475841 Bacteria 6603183
486 2842485273 2842482326 Bacteria 7212537
487 2842491331 2842489311 Bacteria 6620893
488 2842498654 2842495871 Bacteria 6820686
489 2842507466 2842502639 Bacteria 6604161
490 2842514700 2842509118 Bacteria 6850950
491 2842524688 2842521101 Bacteria 6569494
492 2842873866 2842871566 Bacteria 4827117
493 2842926454 2842922631 Bacteria 5824079
494 2847420925 2847417321 Bacteria 6913799
495 2848995757 2848992105 Bacteria 6810864
496 2850082742 2850079185 Bacteria 6848280
497 2852392096 2852387548 Bacteria 8025568
498 2854897722 2854896431 Bacteria 5869725
499 2854922301 2854916844 Bacteria 5725939
500 2855827489 2855825444 Bacteria 6785811
501 2855842864 2855839649 Bacteria 7135830
502 2855873621 2855872281 Bacteria 6964271
503 2857510999 2857509624 Bacteria 7472071
504 2857536159 2857531043 Bacteria 6754041
505 2858803542 2858800743 Bacteria 6603254
506 2874102738 2874102143 Bacteria 6342645
507 2889791561 2889790730 Bacteria 5689708
508 2889917306 2889914905 Bacteria 5702301
509 2891377801 2891373044 Bacteria 5202277
510 2894821019 2894817345 Bacteria 4892941
511 2896390099 2896384573 Bacteria 7700774
512 2909047520 2909042592 Bacteria 6499737
513 2913300233 2913295892 Bacteria 6333755
514 2913312083 2913308742 Bacteria 5350706
515 2915981723 2915980308 Bacteria 6624279
516 2915991930 2915986958 Bacteria 6739310
517 2915999577 2915993759 Bacteria 7016183
518 2916004485 2916000859 Bacteria 6865702
519 2916009091 2916007675 Bacteria 6898660
520 2916019855 2916014648 Bacteria 6946486
521 2916023921 2916021584 Bacteria 6854472
522 2916031846 2916028427 Bacteria 6748433
523 2916040487 2916035215 Bacteria 6755766
524 2916043420 2916041962 Bacteria 6820487
525 2916050655 2916048683 Bacteria 6543552
526 2916058681 2916055098 Bacteria 6758838
527 2916066494 2916061851 Bacteria 6737736
528 2916071000 2916068649 Bacteria 6943657
529 2916082563 2916076590 Bacteria 6596108
530 2919170461 2919166419 Bacteria 4952238
531 2919176895 2919171160 Bacteria 6499771
532 2919411444 2919408235 Bacteria 6149349
533 2920760230 2920760137 Bacteria 7427611
534 2920826046 2920822456 Bacteria 6897201
535 2921204777 2921201388 Bacteria 6926299
536 2921212040 2921208531 Bacteria 6745326
537 2921240366 2921237296 Bacteria 6876710
538 2921245641 2921244191 Bacteria 6568419
539 2921252812 2921250672 Bacteria 6677771
540 2921260451 2921257292 Bacteria 6808382
541 2921267535 2921263974 Bacteria 6864552
542 2921287342 2921282425 Bacteria 6826397
543 2921293970 2921289301 Bacteria 7316391
544 2921302585 2921296804 Bacteria 7176999
545 2924144799 2924144063 Bacteria 6883928
546 2924157650 2924150972 Bacteria 7169444
547 2924158792 2924158325 Bacteria 7188855
548 2924168536 2924165586 Bacteria 7260590
549 2924175788 2924172951 Bacteria 6749356
550 2924183477 2924179722 Bacteria 6843264
551 2924190224 2924186466 Bacteria 6876637
552 2924193495 2924193448 Bacteria 6955718
553 2924201436 2924200457 Bacteria 6757188
554 2924207780 2924207177 Bacteria 6917007
555 2924214900 2924214083 Bacteria 7080103
556 2924227123 2924221636 Bacteria 7113495
557 2924234046 2924228884 Bacteria 6633132
558 2928522889 2928521798 Bacteria 4960112
559 2929141999 2929138655 Bacteria 5810547
560 2933592807 2933586486 Bacteria 7667493
561 2933602861 2933599457 Bacteria 5858799
562 2936370069 2936367885 Bacteria 7324495
563 2936379245 2936375103 Bacteria 6652732
564 2936997426 2936996657 Bacteria 6298727
565 2937004110 2937002841 Bacteria 6934057
566 2937010353 2937009748 Bacteria 6746052
567 2937020655 2937016420 Bacteria 6782579
568 2937023186 2937023124 Bacteria 6815156
569 2937031735 2937029754 Bacteria 6424026
570 2937037802 2937036028 Bacteria 6846469
571 2937049574 2937042894 Bacteria 6741576
572 2937055196 2937049772 Bacteria 6757901
573 2937059101 2937056579 Bacteria 7107896
574 2937070489 2937063883 Bacteria 7199456
575 2937076127 2937071275 Bacteria 6984483
576 2937081480 2937078374 Bacteria 6610289
577 2937090888 2937084907 Bacteria 6618516
578 2937098492 2937091812 Bacteria 6979387
579 2937104337 2937098957 Bacteria 7249374
580 2937113234 2937106411 Bacteria 6947143
581 2937114234 2937113482 Bacteria 6505872
582 2937120232 2937119839 Bacteria 6597547
583 2937129787 2937126314 Bacteria 6771275
584 2941501469 2941499720 Bacteria 7599444
585 2954013745 2954011201 Bacteria 4762601
586 2957376802 2957375807 Bacteria 6425588
587 2957384931 2957382221 Bacteria 6737050
588 2957395206 2957388812 Bacteria 6778072
589 2957399699 2957395598 Bacteria 6822399
590 2957405557 2957402308 Bacteria 6741770
591 2957411722 2957408893 Bacteria 6558585
592 2957417479 2957415311 Bacteria 6991633
593 2957422356 2957422303 Bacteria 7172205
594 2957430070 2957430029 Bacteria 7022557
595 2957441660 2957437181 Bacteria 6568994
596 2957447629 2957443900 Bacteria 6869977
597 2957454687 2957450854 Bacteria 6765715
598 2957460990 2957457609 Bacteria 6967680
599 2957466517 2957464669 Bacteria 6568877
600 2957471401 2957471148 Bacteria 6797643
601 2957481461 2957478035 Bacteria 6756658
602 2957485525 2957484790 Bacteria 6703082
603 2957494443 2957491536 Bacteria 6695180
604 2957505182 2957498199 Bacteria 7126688
605 2957508258 2957505466 Bacteria 7253085
606 2960585192 2960584000 Bacteria 6864594
607 2960592790 2960591022 Bacteria 6622873
608 2960597907 2960597568 Bacteria 6550735
609 2960607499 2960603979 Bacteria 6898737
610 2960613687 2960610863 Bacteria 6691244
611 2960619101 2960617483 Bacteria 6727748
612 2960625372 2960624210 Bacteria 6875384
613 2960634187 2960631154 Bacteria 6732508
614 2960645373 2960637947 Bacteria 7296468
615 2960650696 2960645483 Bacteria 7211087
616 2960659198 2960652885 Bacteria 7083688
617 2960663990 2960660292 Bacteria 7041660
618 2960673279 2960667422 Bacteria 6763020
619 2960674892 2960674078 Bacteria 6609048
620 2960681715 2960680706 Bacteria 6624464
621 2960689345 2960687367 Bacteria 6535474
622 2960700641 2960693952 Bacteria 6749742
623 2964608235 2964607997 Bacteria 7101408
624 2964621596 2964615318 Bacteria 6809089
625 2964625821 2964621998 Bacteria 6834995
626 2964629524 2964628898 Bacteria 7083044
627 2964639213 2964636051 Bacteria 7091832
628 2964643618 2964643177 Bacteria 6820887
629 2964655222 2964649959 Bacteria 6675118
630 2964659969 2964656573 Bacteria 7100150
631 2964669390 2964663802 Bacteria 7019362
632 2964676876 2964670856 Bacteria 6851364
633 2964679597 2964678106 Bacteria 6792020
634 2964687443 2964685014 Bacteria 6839111
635 2964695132 2964691889 Bacteria 6802758
636 2964699150 2964698721 Bacteria 6765331
637 2964711213 2964705432 Bacteria 7114648
638 2964712669 2964712639 Bacteria 6695970
639 2964726759 2964719344 Bacteria 7286602
640 2967671078 2967664464 Bacteria 6948836
641 2967675597 2967671571 Bacteria 7021409
642 2967681238 2967678726 Bacteria 7264382
643 2967692437 2967686174 Bacteria 6678622
644 2967699389 2967693043 Bacteria 6804451
645 2967703207 2967699805 Bacteria 6854538
646 2967713809 2967706974 Bacteria 7186053
647 2967721186 2967714385 Bacteria 7000047
648 2967724972 2967721400 Bacteria 7073753
649 2967731822 2967728569 Bacteria 6641507
650 2967738453 2967735183 Bacteria 6827012
651 2967745450 2967742019 Bacteria 6794534
652 2967752626 2967748971 Bacteria 6733771
653 2967757737 2967755722 Bacteria 6814706
654 2967765806 2967762386 Bacteria 6923502
655 2967770356 2967769361 Bacteria 6587838
656 2967780525 2967775926 Bacteria 6738189
657 2970021979 2970019648 Bacteria 7072033
658 2970028688 2970026789 Bacteria 6785236
659 2970038993 2970033650 Bacteria 7118744
660 2970046589 2970040964 Bacteria 6731123
661 2970049634 2970047711 Bacteria 7088379
662 2970058846 2970054988 Bacteria 6611507
663 2970066770 2970061556 Bacteria 7099761
664 2970071164 2970068827 Bacteria 7123112
665 2970076728 2970076120 Bacteria 6697332
666 2970083983 2970082768 Bacteria 6183754
667 2970092753 2970088815 Bacteria 6933825
668 2970101161 2970095765 Bacteria 6936963
669 2970104621 2970102677 Bacteria 6812532
670 2970111073 2970109326 Bacteria 6863976
671 2970118364 2970116247 Bacteria 6501857
672 2970124517 2970122695 Bacteria 6625855
673 2970133532 2970129317 Bacteria 6806560
674 2970140903 2970136068 Bacteria 7207982
675 2970147325 2970143518 Bacteria 6446480
676 2970151740 2970149975 Bacteria 6779706
677 2970158669 2970156795 Bacteria 7168044
678 2970170765 2970164137 Bacteria 6861252
679 2970174098 2970170962 Bacteria 6876229
680 2970182128 2970177841 Bacteria 6768001
681 2970189149 2970184632 Bacteria 7054431
682 2970197923 2970191845 Bacteria 7032787
683 2977520198 2977516862 Bacteria 6940108
684 2977525112 2977523885 Bacteria 6960446
685 2977531190 2977530762 Bacteria 6951399
686 2977544480 2977537788 Bacteria 6929320
687 2977547159 2977544691 Bacteria 6875412
688 2977558022 2977551784 Bacteria 7125765
689 2977564733 2977558990 Bacteria 6863948
690 2977571302 2977565890 Bacteria 6901543
691 2977573824 2977572785 Bacteria 6763888
692 2977583353 2977579622 Bacteria 6772100
693 2977863111 2977858184 Bacteria 6215359
694 2978972743 2978969890 Bacteria 5400756
695 2984590995 2984587000 Bacteria 5263363
696 2989355064 2989349275 Bacteria 6349068
697 2996315332 2996310559 Bacteria 6357320
698 2996897074 2996893221 Bacteria 5823108
699 3000020586 3000017691 Bacteria 3772574
700 3005415951 3005409236 Bacteria 7188837
701 3005416896 3005416602 Bacteria 7064308
702 639650602 639633055 Bacteria 7751309
703 648737298 648276728 Bacteria 6968865
704 8003995445 8003992118 Bacteria 7266902
705 8004003204 8003999396 Bacteria 7063185
706 8004446890 8004445564 Bacteria 6322258
707 8005286586 8005282627 Bacteria 6675747
708 8005306116 8005301065 Bacteria 6614431
709 8005315900 8005314921 Bacteria 7072929
710 8005381401 8005376324 Bacteria 6590079
711 8005387613 8005382845 Bacteria 6732062
712 8005400645 8005395548 Bacteria 6806915
713 8005465277 8005460587 Bacteria 7157962
714 8005486987 8005484373 Bacteria 6297373
715 8005561342 8005556819 Bacteria 6908598
716 8005565964 8005563573 Bacteria 7153261
717 8005572013 8005570704 Bacteria 6957481
718 8005645184 8005645114 Bacteria 6950293
719 8005687370 8005682033 Bacteria 6726518
720 8005694187 8005688590 Bacteria 6610080
721 8018155010 8018150411 Bacteria 5549903
722 8018164921 8018163183 Bacteria 7277977
723 8024484539 8024479707 Bacteria 6954785
724 8024491005 8024486573 Bacteria 6540512
725 8024502163 8024501048 Bacteria 6427847
726 8046768379 8046767195 Bacteria 7547379
727 8049296387 8049293176 Bacteria 6128433
728 8054463883 8054460903 Bacteria 4872905
729 8055432891 8055431914 Bacteria 4551896
730 8056878350 8056875544 Bacteria 4355797
731 8057581952 8057575449 Bacteria 7367519
732 8057879458 8057874678 Bacteria 7494653
733 Ga0496117_0067097
734 JGI24740J21852_10001569
735 JGI25155J39150_1000018
736 JGI25156J39149_1000055
737 JGI25162J39368_1000253
738 JGI25162J39368_1000524
739 JGI25154J39366_1000069
740 JGI25157J39369_1000076
741 JGI25159J45721_1000022
742 JGI25159J45721_1019021
743 JGI25151J46595_10004202
744 JGI25151J46595_10004375
745 JGI25165J46597_1000723
746 JGI25165J46597_1001404
747 JGI25153J46596_10001515
748 JGI25153J46596_10007129
749 JGI25160J50197_1000051
750 JGI25160J50197_1000056
751 JGI25160J50197_1000317
752 JGI25161J50226_1000011
753 JGI25161J50226_1000413
754 JGI25161J50226_1000646
755 JGI25161J50226_1002096
756 Ga0055526_1001154
757 Ga0055526_1003525
758 Ga0055524_1000763
759 Ga0055524_1006132
760 Ga0055536_1005618
761 Ga0055528_1001009
762 Ga0055528_1011854
763 Ga0055528_1016405
764 Ga0055540_1000835
765 Ga0055540_1027435
766 Ga0055531_10009729
767 Ga0055531_10020802
768 Ga0055543_1000041
769 Ga0055543_1000431
770 Ga0055543_1000682
771 Ga0065165_1000135
772 Ga0065165_1000155
773 Ga0065165_1002015
774 Ga0070670_100002528
775 Ga0068869_100229561
776 Ga0070665_100091719
777 Ga0068856_100173301
778 Ga0075365_10000409
779 Ga0075365_10002336
780 Ga0075365_10016899
781 Ga0075365_10034079
782 Ga0075365_10256611
783 Ga0075368_10018237
784 Ga0075364_10000006
785 Ga0075364_10002563
786 Ga0075362_10005557
787 Ga0075370_10000490
788 Ga0075370_10064995
789 Ga0079104_1000310
790 Ga0079104_1004373
791 Ga0079104_1013407
792 Ga0105244_10131016
793 Ga0105240_10000142
794 Ga0105240_10426616
795 Ga0105237_10008145
796 Ga0105249_10003472
797 Ga0123341_1000436
798 Ga0105239_10001079
799 Ga0105239_10586991
800 Ga0157371_10016970
801 Ga0157370_10000855
802 Ga0157369_10203701
803 Ga0157369_10256829
804 Ga0157369_10268785
805 Ga0171463_1004
806 Ga0157372_10306138
807 Ga0157372_10591622
808 Ga0182007_10004603
809 Ga0182005_1005520
810 Ga0183363_1139
811 Ga0214542_1005348
812 Ga0214542_1010983
813 Ga0214543_1000015
814 Ga0214543_1005096
815 Ga0213875_10020435
816 Ga0228711_1000004
817 Ga0228710_1000002
818 Ga0209435_100031
819 Ga0209760_103008
820 Ga0207427_105047
821 Ga0209437_100179
822 Ga0209437_100181
823 Ga0207425_1009883
824 Ga0209646_1000102
825 Ga0209646_1011065
826 Ga0209026_1000096
827 Ga0209677_100353
828 Ga0209759_1000090
829 Ga0209129_1001428
830 Ga0209233_1000185
831 Ga0209233_1000212
832 Ga0209233_1000263
833 Ga0209233_1002422
834 Ga0209673_1000476
835 Ga0209673_1001239
836 Ga0209673_1003238
837 Ga0209130_1000058
838 Ga0209130_1000133
839 Ga0209676_1012006
840 Ga0209025_1000042
841 Ga0209025_1000453
842 Ga0209025_1000536
843 Ga0209564_1000193
844 Ga0209564_1000894
845 Ga0209758_1000351
846 Ga0209758_1000406
847 Ga0209758_1000780
848 Ga0209758_1019587
849 Ga0209256_1001126
850 Ga0209256_1001816
851 Ga0209256_1003112
852 Ga0209256_1026651
853 Ga0207426_1000131
854 Ga0207426_1000214
855 Ga0207426_1000248
856 Ga0209051_1000118
857 Ga0209051_1000822
858 Ga0209051_1001422
859 Ga0209051_1030525
860 Ga0209257_1008317
861 Ga0209257_1010182
862 Ga0207647_10128232
863 Ga0207695_10000234
864 Ga0207671_10000043
865 Ga0207650_10001807
866 Ga0207706_10010561
867 Ga0207667_10254099
868 Ga0207712_10394471
869 Ga0207668_10308899
870 Ga0207702_10212176
871 Ga0207674_10279138
872 Ga0207698_10297934
873 Ga0209281_1000028
874 Ga0209281_1000030
875 Ga0209281_1000144
876 Ga0209371_1021560
877 Ga0209282_1000004
878 Ga0268266_10012935
879 Ga0268266_10069758
880 Ga0307515_10001049
881 Ga0307515_10002808
882 Ga0307515_10003215
883 Ga0268256_1014104
884 Ga0307513_10001726
885 Ga0307408_100014748
886 Ga0316579_10125700
887 Ga0265314_10029460
888 Ga0307516_10082433
889 Ga0315914_1000001
890 Ga0307416_100081775
891 Ga0315913_1000004
892 Ga0315915_1000002
893 Ga0373953_0046757
894 Ga0373954_0063538
895 Ga0373956_0039131
896 Ga0373943_0067484
897 Ga0373927_0001342
898 Ga0373925_0000830
899 Ga0436364_0154238
900 Ga0439436_0005093
901 Ga0439438_049890
902 Ga0439466_0037428
903 Ga0451845_0299746
904 Ga0451847_0601085
905 Ga0451851_0232026
906 Ga0451853_2638751
907 Ga0439431_0041950
908 Ga0439432_048534
909 Ga0439449_0007684
910 Ga0439449_0025555
911 Ga0439449_0031309
912 Ga0439462_0021917
913 Ga0450906_003965
914 Ga0466963_0013780
915 Ga0466970_0045160
916 Ga0495592_0099673
917 Ga0495590_0005422
918 Ga0495629_0173323
919 Ga0495638_0080656
920 Ga0495585_0032892
921 Ga0495607_0021613
922 Ga0495606_0013862
923 Ga0495610_0003473
924 Ga0495632_0003903
925 Ga0495648_0040268
926 Ga0495663_0037240
927 Ga0495652_0290885
928 Ga0495654_0000143
929 Ga0495640_0105301
930 Ga0495587_0140742
931 Ga0495621_0067290
932 Ga0495656_0003093
933 Ga0495656_0053137
934 Ga0495588_0002054
935 Ga0495657_0007569
936 Ga0495646_0162066
937 Ga0495658_0101250
938 Ga0495649_0013067
939 Ga0495600_0004789
940 Ga0495680_0391003
941 Ga0495687_012206
942 Ga0495675_0317770
943 Ga0495686_0001104
944 Ga0495686_0065021
945 Ga0495686_0097019
946 Ga0495626_0022058
947 Ga0496102_0017668
948 Ga0496110_0163159
949 Ga0496111_0004902
950 Ga0496116_0000057
951 Ga0496116_0009575
952 Ga0496117_0001716
953 Ga0496117_0013293
954 Ga0496118_0014418
955 Ga0496119_0024907
956 Ga0496119_0032392
957 Ga0496120_0023184
958 Ga0496120_0043257
959 Ga0496121_0000034
960 Ga0496121_0000888
961 Ga0496121_0016201
962 Ga0496121_0017709
963 Ga0496121_0018081
964 Ga0496121_0055116
965 Ga0496122_0000308
966 Ga0496122_0001941
967 Ga0496122_0008781
968 Ga0496122_0089164
969 Ga0496123_0000066
970 Ga0496123_0013756
971 Ga0496123_0050626
972 Ga0496124_0000294
973 Ga0496124_0001215
974 Ga0496124_0005671
975 Ga0496124_0016660
976 Ga0496124_0041830
977 Ga0496124_0125821
978 Ga0496124_0202058
979 Ga0496125_0000030
980 Ga0496125_0000288
981 Ga0496126_0000115
982 Ga0496126_0000258
983 Ga0496126_0027368
984 Ga0496126_0079175
985 Ga0495678_020781
986 Ga0501031_0012275
987 Ga0501032_0025600
988 Ga0501032_0089601
989 Ga0501033_0000293
990 Ga0501033_0103712
991 Ga0501033_0103999
992 Ga0501033_0143698
993 Ga0501033_0175645
994 Ga0501034_0000702
995 Ga0501034_0097002
996 Ga0501036_0081432
997 Ga0501036_0184911
998 Ga0501037_0000007
999 Ga0501037_0049865
1000 Ga0501038_0163671
1001 Ga0501038_0252931
1002 Ga0501043_0000034
1003 Ga0501043_0117934
1004 Ga0501043_0119842
1005 Ga0501046_0000241
1006 Ga0501047_0053950
1007 Ga0501067_0051112
1008 Ga0501068_0148679
1009 Ga0501069_0000017
1010 Ga0501069_0052457
1011 Ga0501069_0055997
1012 Ga0501070_0001269
1013 Ga0501070_0009951
1014 Ga0501070_0101494
1015 Ga0501070_0183761
1016 Ga0501070_0186592
1017 Ga0501070_0428024
1018 Ga0501071_0003548
1019 Ga0501073_0014200
1020 Ga0501074_0000060
1021 Ga0501076_0111779
1022 Ga0501076_0399997
1023 Ga0501080_0001013
1024 Ga0501080_0072218
1025 Ga0501083_0000511
1026 Ga0501083_0064213
1027 Ga0501241_014837
1028 Ga0501280_002847
1029 Ga0501035_0000159
1030 Ga0501035_0000772
1031 Ga0501035_0107540
1032 Ga0501035_0258909
1033 Ga0501044_0000010
1034 Ga0501044_0013069
1035 Ga0501044_0102271
1036 Ga0501044_0103971
1037 Ga0501044_0248726
1038 nmdc:mga00v17_65314_c1
1039 nmdc:mga00v17_89_c1
1040 nmdc:mga0yw44_1851_c1
1041 nmdc:mga04h51_3008_c1
1042 nmdc:mga0sz30_62040_c1
1043 Ga0495601_0037926
1044 Ga0495612_0014539
1045 Ga0500643_007497
1046 Ga0500556_0032151
1047 Ga0500557_003125
1048 Ga0500560_006406
1049 Ga0500594_0005292
1050 Ga0500568_0044554
1051 Ga0500573_0001866
1052 Ga0500573_0010900
1053 Ga0500588_0059056
1054 Ga0500604_0028078
1055 Ga0500616_0000448
1056 Ga0500616_0079543
1057 Ga0500620_000445
1058 Ga0500622_0000169
1059 Ga0500624_004046
1060 Ga0500624_010039
1061 Ga0500636_0000030
1062 Ga0500636_0002620
1063 Ga0587073_0011046
1064 Ga0587106_015816
1065 Ga0466962_0073795
1066 2509108871
1067 2509378001
1068 2510135410
1069 2510305812
1070 2511135854
1071 2511172503
1072 2511388934
1073 2511498578
1074 2512534727
1075 2512973461
1076 2513572891
1077 2513586374
1078 2513602022
1079 2513615811
1080 2513634926
1081 2513711513
1082 2513885377
1083 2513904646
1084 2513983476
1085 2513998289
1086 2514003380
1087 2514586796
1088 2515114582
1089 2515612442
1090 2516205683
1091 2516894855
1092 2517038225
1093 2517097242
1094 2517571536
1095 2524450328
1096 2524461175
1097 2551680660
1098 2551685164
1099 2551691054
1100 2551697616
1101 2551710788
1102 2551724586
1103 2551729196
1104 2551731311
1105 2551736228
1106 2551745950
1107 2558867497
1108 2585166516
1109 2585267162
1110 2585272056
1111 2585279640
1112 2585327478
1113 2585333985
1114 2585388213
1115 2585396190
1116 2585535720
1117 2585543015
1118 2585551097
1119 2585563399
1120 2585839216
1121 2585897179
1122 2585909094
1123 2585998065
1124 2586002645
1125 2587984508
1126 2599335758
1127 2599722627
1128 2600193963
1129 2600377431
1130 2616306428
1131 2616551084
1132 2617382317
1133 2643807951
1134 2643814834
1135 2643854825
1136 2644002634
1137 2644052430
1138 2644068858
1139 2644105774
1140 2644146342
1141 2644201187
1142 2644209655
1143 2644310387
1144 2644378416
1145 2644419929
1146 2644453285
1147 2644484708
1148 2644492567
1149 2644501229
1150 2644544978
1151 2644615372
1152 2644653183
1153 2644675084
1154 2644688688
1155 2657682320
1156 2671116038
1157 2671693662
1158 2692319851
1159 2720633484
1160 2720777182
1161 2723028780
1162 2723562393
1163 2723569089
1164 2724091789
1165 2724106354
1166 2725945772
1167 2730109716
1168 2738947088
1169 2739037711
1170 2753458490
1171 2757571002
1172 2766064093
1173 2776269672
1174 2776282601
1175 2778179210
1176 2792582330
1177 2792621818
1178 2792628924
1179 2792640065
1180 2793295472
1181 2793327448
1182 2802717098
1183 2802724914
1184 2802729664
1185 2802737010
1186 2802743415
1187 2802749459
1188 2804753786
1189 2805926366
1190 2805934092
1191 2806047745
1192 2806055321
1193 2806062202
1194 2806070039
1195 2806076661
1196 2819611965
1197 2819638495
1198 2821129218
1199 2838034109
1200 2838072287
1201 2838078073
1202 2838672319
1203 2838704812
1204 2838742156
1205 2840766262
1206 2841846012
1207 2842116587
1208 2842145623
1209 2842148952
1210 2842194727
1211 2842221948
1212 2842254492
1213 2842302619
1214 2842321263
1215 2842358879
1216 2842425919
1217 2842480923
1218 2842485273
1219 2842491331
1220 2842498654
1221 2842507466
1222 2842514700
1223 2842524688
1224 2842873866
1225 2842926454
1226 2847420925
1227 2848995757
1228 2850082742
1229 2852392096
1230 2854897722
1231 2854922301
1232 2855827489
1233 2855842864
1234 2855873621
1235 2857510999
1236 2857536159
1237 2858803542
1238 2874102738
1239 2889791561
1240 2889917306
1241 2891377801
1242 2894821019
1243 2896390099
1244 2909047520
1245 2913300233
1246 2913312083
1247 2915981723
1248 2915991930
1249 2915999577
1250 2916004485
1251 2916009091
1252 2916019855
1253 2916023921
1254 2916031846
1255 2916040487
1256 2916043420
1257 2916050655
1258 2916058681
1259 2916066494
1260 2916071000
1261 2916082563
1262 2919170461
1263 2919176895
1264 2919411444
1265 2920760230
1266 2920826046
1267 2921204777
1268 2921212040
1269 2921240366
1270 2921245641
1271 2921252812
1272 2921260451
1273 2921267535
1274 2921287342
1275 2921293970
1276 2921302585
1277 2924144799
1278 2924157650
1279 2924158792
1280 2924168536
1281 2924175788
1282 2924183477
1283 2924190224
1284 2924193495
1285 2924201436
1286 2924207780
1287 2924214900
1288 2924227123
1289 2924234046
1290 2928522889
1291 2929141999
1292 2933592807
1293 2933602861
1294 2936370069
1295 2936379245
1296 2936997426
1297 2937004110
1298 2937010353
1299 2937020655
1300 2937023186
1301 2937031735
1302 2937037802
1303 2937049574
1304 2937055196
1305 2937059101
1306 2937070489
1307 2937076127
1308 2937081480
1309 2937090888
1310 2937098492
1311 2937104337
1312 2937113234
1313 2937114234
1314 2937120232
1315 2937129787
1316 2941501469
1317 2954013745
1318 2957376802
1319 2957384931
1320 2957395206
1321 2957399699
1322 2957405557
1323 2957411722
1324 2957417479
1325 2957422356
1326 2957430070
1327 2957441660
1328 2957447629
1329 2957454687
1330 2957460990
1331 2957466517
1332 2957471401
1333 2957481461
1334 2957485525
1335 2957494443
1336 2957505182
1337 2957508258
1338 2960585192
1339 2960592790
1340 2960597907
1341 2960607499
1342 2960613687
1343 2960619101
1344 2960625372
1345 2960634187
1346 2960645373
1347 2960650696
1348 2960659198
1349 2960663990
1350 2960673279
1351 2960674892
1352 2960681715
1353 2960689345
1354 2960700641
1355 2964608235
1356 2964621596
1357 2964625821
1358 2964629524
1359 2964639213
1360 2964643618
1361 2964655222
1362 2964659969
1363 2964669390
1364 2964676876
1365 2964679597
1366 2964687443
1367 2964695132
1368 2964699150
1369 2964711213
1370 2964712669
1371 2964726759
1372 2967671078
1373 2967675597
1374 2967681238
1375 2967692437
1376 2967699389
1377 2967703207
1378 2967713809
1379 2967721186
1380 2967724972
1381 2967731822
1382 2967738453
1383 2967745450
1384 2967752626
1385 2967757737
1386 2967765806
1387 2967770356
1388 2967780525
1389 2970021979
1390 2970028688
1391 2970038993
1392 2970046589
1393 2970049634
1394 2970058846
1395 2970066770
1396 2970071164
1397 2970076728
1398 2970083983
1399 2970092753
1400 2970101161
1401 2970104621
1402 2970111073
1403 2970118364
1404 2970124517
1405 2970133532
1406 2970140903
1407 2970147325
1408 2970151740
1409 2970158669
1410 2970170765
1411 2970174098
1412 2970182128
1413 2970189149
1414 2970197923
1415 2977520198
1416 2977525112
1417 2977531190
1418 2977544480
1419 2977547159
1420 2977558022
1421 2977564733
1422 2977571302
1423 2977573824
1424 2977583353
1425 2977863111
1426 2978972743
1427 2984590995
1428 2989355064
1429 2996315332
1430 2996897074
1431 3000020586
1432 3005415951
1433 3005416896
1434 639650602
1435 648737298
1436 8003995445
1437 8004003204
1438 8004446890
1439 8005286586
1440 8005306116
1441 8005315900
1442 8005381401
1443 8005387613
1444 8005400645
1445 8005465277
1446 8005486987
1447 8005561342
1448 8005565964
1449 8005572013
1450 8005645184
1451 8005687370
1452 8005694187
1453 8018155010
1454 8018164921
1455 8024484539
1456 8024491005
1457 8024502163
1458 8046768379
1459 8049296387
1460 8054463883
1461 8055432891
1462 8056878350
1463 8057581952
1464 8057879458

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

102

312

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9044 70 140
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8672 52 135
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7253 52 135
4hx3-assembly1.cif.gz_A crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin 0.6585 66 135
6sar-assembly1.cif.gz_A e coli bepa/yfgc 0.6268 40 265
ID Description Score Start End Superfamily
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9795 58 141 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.957 59 147 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9366 59 147 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9303 64 140 3.30.2010.10
af_A0A1D6FHQ3_2_88_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9194 68 144 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9992 58 136 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6B3I2P7-F1-model_v4 M48 family metalloprotease 0.982 51 140 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A2H0X7T0-F1-model_v4 Peptidase M48 domain-containing protein 0.9574 5 127 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A2N2D9Q8-F1-model_v4 Protease HtpX 0.9445 1 115 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A528D7J6-F1-model_v4 Protease HtpX 0.9398 58 136 GO:0004222
GO:0005886
GO:0006508
GO:0046872

Map