F478054
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 604 | 1464 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300048920|Ga0496117_0067097|Ga0496117_0067097_57_1133 |
| Length | 353 |
| Sequence | MVSRLWQSDIEKRIIITKLHEEQSNGKWPYRTHRKMETRMNLARTAMLLAFMTALFMGVGFLIGGQGGMMIALVIAAGMNLFSYWNSDKMVLSAYHAQEVDERNAPEFFTMIRDLSQNAGLPMPKVYIYESEQPNAFATGRNPENAAVAASTGLLQRLSPQEVAGVMAHELAHIQNRDTLTMTITATLAGAISMLGNFAFLFGGNRNNNNPLGFIGVLVAMIVAPVQMAISRTREYSADRRGAEICGNPLWLASALQKISGAAQRLHNEDAERNPATAHMFIINPLSGERMDNLFSTHPNTENRVAALQAMANEFSQPSTPPATNANAERKTRSVPSTGWGRGGNNERKGPWS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 27 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 32 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 37 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 46 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 47 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 48 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 49 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 50 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 51 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 57 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 60 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 84 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 88 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 92 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 94 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 97 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 98 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 99 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 103 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 104 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 105 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 106 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 107 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 108 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 109 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 110 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 111 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 112 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 113 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 114 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 115 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 116 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 117 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 151 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 152 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 153 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 154 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 155 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 156 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 157 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 158 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 159 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 160 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 182 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 188 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 189 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 192 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 193 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 194 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 195 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 196 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 198 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 199 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 200 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 201 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 202 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 203 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 204 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 205 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 208 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 209 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 210 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 211 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 212 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 213 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 214 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 215 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 216 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 217 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 218 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 219 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 220 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 221 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 222 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 223 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 224 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 225 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 226 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 227 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 228 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 229 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 230 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 231 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 232 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 233 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 234 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 235 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 236 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 237 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 238 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 239 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 240 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 241 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 242 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 243 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 244 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 245 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 246 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 247 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 248 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 249 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 250 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 251 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 252 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 253 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 254 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 255 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 256 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 257 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 258 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 259 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 260 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 261 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 262 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 263 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 264 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 265 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 266 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 267 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 268 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 269 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 270 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 271 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 272 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 273 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 274 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 275 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 276 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 277 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 278 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 279 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 280 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 281 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 282 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 283 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 284 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 285 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 286 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 287 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 288 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 289 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 290 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 291 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 292 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 293 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 294 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 295 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 296 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 297 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 298 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 299 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 300 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 301 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 302 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 303 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 304 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 305 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 306 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 307 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 308 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 309 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 310 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 311 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 312 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 313 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 314 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 315 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 316 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 317 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 318 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 319 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 320 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 321 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 322 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 323 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 324 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 325 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 326 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 327 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 328 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 329 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 330 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 331 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 332 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 333 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 334 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 335 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 336 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 337 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 338 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 339 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 340 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 341 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 342 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 343 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 344 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 345 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 346 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 347 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 348 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 349 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 350 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 351 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 352 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 353 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 354 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 355 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 356 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 357 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 358 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 359 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 360 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 361 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 362 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 363 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 364 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 365 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 366 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 367 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 368 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 369 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 370 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 371 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 372 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 373 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 374 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 375 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 376 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 377 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 378 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 379 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 380 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 381 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 382 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 383 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 384 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 385 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 386 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 387 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 388 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 389 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 390 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 391 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 392 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 393 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 394 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 395 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 396 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 397 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 398 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 399 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 400 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 401 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 402 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 403 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 404 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 405 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 406 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 407 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 408 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 409 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 410 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 411 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 412 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 413 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 414 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 415 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 416 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 417 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 418 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 419 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 420 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 421 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 422 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 423 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 424 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 425 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 426 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 427 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 428 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 429 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 430 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 431 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 432 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 433 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 434 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 435 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 436 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 437 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 438 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 439 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 440 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 441 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 442 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 443 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 444 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 445 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 446 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 447 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 448 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 449 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 450 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 451 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 452 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 453 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 454 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 455 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 456 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 457 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 458 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 459 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 460 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 461 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 462 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 463 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 464 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 465 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 466 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 467 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 468 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 469 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 470 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 471 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 472 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 473 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 474 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 475 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 476 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 477 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 478 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 479 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 480 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 481 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 482 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 483 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 484 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 485 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 486 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 487 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 488 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 489 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 490 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 491 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 492 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 493 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 494 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 495 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 496 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 497 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 498 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 499 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 500 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 501 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 502 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 503 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 504 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 505 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 506 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 507 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 508 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 509 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 510 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 511 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 512 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 513 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 514 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 515 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 516 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 517 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 518 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 519 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 520 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 521 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 522 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 523 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 524 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 525 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 526 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 527 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 528 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 529 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 530 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 531 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 532 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 533 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 534 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 535 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 536 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 537 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 538 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 539 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 540 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 541 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 542 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 543 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 544 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 545 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 546 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 547 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 548 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 549 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 550 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 551 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 552 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 553 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 554 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 555 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 556 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 557 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 558 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 559 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 560 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 561 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 562 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 563 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 564 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 565 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 566 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 567 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 568 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 569 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 570 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 571 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 572 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 573 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 574 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 575 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 576 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 577 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 578 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 579 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 580 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 581 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 582 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 583 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 584 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 585 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 586 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 587 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 588 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 589 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 590 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 591 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 592 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 593 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 594 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 595 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 596 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 597 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 598 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 599 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 600 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 601 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 602 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 603 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 604 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 45.22 |
| Metatranscriptomes | 0.27 |
| Isolates | 54.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 14.75 |
| Nodule | 42.62 |
| Rhizoplane | 1.09 |
| Rhizosphere | 24.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496117_0067097 | 3300048920 | Bacteria | 2429 |
| 2 | JGI24740J21852_10001569 | 3300001979 | Bacteria | 10488 |
| 3 | JGI25155J39150_1000018 | 3300002704 | Bacteria | 157606 |
| 4 | JGI25156J39149_1000055 | 3300002705 | Bacteria | 87733 |
| 5 | JGI25162J39368_1000253 | 3300002737 | Bacteria | 51894 |
| 6 | JGI25162J39368_1000524 | 3300002737 | Bacteria | 28601 |
| 7 | JGI25154J39366_1000069 | 3300002738 | Bacteria | 96438 |
| 8 | JGI25157J39369_1000076 | 3300002741 | Bacteria | 87678 |
| 9 | JGI25159J45721_1000022 | 3300002987 | Bacteria | 119463 |
| 10 | JGI25159J45721_1019021 | 3300002987 | Bacteria | 1365 |
| 11 | JGI25151J46595_10004202 | 3300003187 | Bacteria | 7668 |
| 12 | JGI25151J46595_10004375 | 3300003187 | Bacteria | 7488 |
| 13 | JGI25165J46597_1000723 | 3300003214 | Bacteria | 25872 |
| 14 | JGI25165J46597_1001404 | 3300003214 | Bacteria | 13109 |
| 15 | JGI25153J46596_10001515 | 3300003215 | Bacteria | 13851 |
| 16 | JGI25153J46596_10007129 | 3300003215 | Bacteria | 5546 |
| 17 | JGI25160J50197_1000051 | 3300003354 | Bacteria | 132923 |
| 18 | JGI25160J50197_1000056 | 3300003354 | Bacteria | 119463 |
| 19 | JGI25160J50197_1000317 | 3300003354 | Bacteria | 33502 |
| 20 | JGI25161J50226_1000011 | 3300003374 | Bacteria | 210140 |
| 21 | JGI25161J50226_1000413 | 3300003374 | Bacteria | 20791 |
| 22 | JGI25161J50226_1000646 | 3300003374 | Bacteria | 14020 |
| 23 | JGI25161J50226_1002096 | 3300003374 | Bacteria | 5381 |
| 24 | Ga0055526_1001154 | 3300003771 | Bacteria | 19133 |
| 25 | Ga0055526_1003525 | 3300003771 | Bacteria | 9884 |
| 26 | Ga0055524_1000763 | 3300003775 | Bacteria | 21654 |
| 27 | Ga0055524_1006132 | 3300003775 | Bacteria | 5257 |
| 28 | Ga0055536_1005618 | 3300003781 | Bacteria | 6076 |
| 29 | Ga0055528_1001009 | 3300003790 | Bacteria | 18687 |
| 30 | Ga0055528_1011854 | 3300003790 | Bacteria | 3425 |
| 31 | Ga0055528_1016405 | 3300003790 | Bacteria | 2620 |
| 32 | Ga0055540_1000835 | 3300003792 | Bacteria | 20687 |
| 33 | Ga0055540_1027435 | 3300003792 | Bacteria | 1362 |
| 34 | Ga0055531_10009729 | 3300003794 | Bacteria | 4880 |
| 35 | Ga0055531_10020802 | 3300003794 | Bacteria | 2576 |
| 36 | Ga0055543_1000041 | 3300004625 | Bacteria | 118501 |
| 37 | Ga0055543_1000431 | 3300004625 | Bacteria | 26005 |
| 38 | Ga0055543_1000682 | 3300004625 | Bacteria | 17718 |
| 39 | Ga0065165_1000135 | 3300005262 | Bacteria | 127785 |
| 40 | Ga0065165_1000155 | 3300005262 | Bacteria | 119501 |
| 41 | Ga0065165_1002015 | 3300005262 | Bacteria | 18962 |
| 42 | Ga0070670_100002528 | 3300005331 | Bacteria | 15081 |
| 43 | Ga0068869_100229561 | 3300005334 | Bacteria | 1474 |
| 44 | Ga0070665_100091719 | 3300005548 | Bacteria | 3043 |
| 45 | Ga0068856_100173301 | 3300005614 | Bacteria | 2170 |
| 46 | Ga0075365_10000409 | 3300006038 | Bacteria | 15775 |
| 47 | Ga0075365_10002336 | 3300006038 | Bacteria | 9237 |
| 48 | Ga0075365_10016899 | 3300006038 | Bacteria | 4452 |
| 49 | Ga0075365_10034079 | 3300006038 | Bacteria | 3286 |
| 50 | Ga0075365_10256611 | 3300006038 | Bacteria | 1229 |
| 51 | Ga0075368_10018237 | 3300006042 | Bacteria | 2636 |
| 52 | Ga0075364_10000006 | 3300006051 | Bacteria | 86571 |
| 53 | Ga0075364_10002563 | 3300006051 | Bacteria | 10184 |
| 54 | Ga0075362_10005557 | 3300006177 | Bacteria | 4627 |
| 55 | Ga0075370_10000490 | 3300006353 | Bacteria | 14931 |
| 56 | Ga0075370_10064995 | 3300006353 | Bacteria | 2081 |
| 57 | Ga0079104_1000310 | 3300006946 | Bacteria | 61815 |
| 58 | Ga0079104_1004373 | 3300006946 | Bacteria | 6093 |
| 59 | Ga0079104_1013407 | 3300006946 | Bacteria | 2525 |
| 60 | Ga0105244_10131016 | 3300009036 | Bacteria | 1210 |
| 61 | Ga0105240_10000142 | 3300009093 | Bacteria | 146932 |
| 62 | Ga0105240_10426616 | 3300009093 | Bacteria | 1489 |
| 63 | Ga0105237_10008145 | 3300009545 | Bacteria | 11379 |
| 64 | Ga0105249_10003472 | 3300009553 | Bacteria | 13652 |
| 65 | Ga0123341_1000436 | 3300009765 | Bacteria | 25013 |
| 66 | Ga0105239_10001079 | 3300010375 | Bacteria | 37830 |
| 67 | Ga0105239_10586991 | 3300010375 | Bacteria | 1270 |
| 68 | Ga0157371_10016970 | 3300013102 | Bacteria | 5421 |
| 69 | Ga0157370_10000855 | 3300013104 | Bacteria | 38623 |
| 70 | Ga0157369_10203701 | 3300013105 | Bacteria | 2076 |
| 71 | Ga0157369_10256829 | 3300013105 | Bacteria | 1823 |
| 72 | Ga0157369_10268785 | 3300013105 | Bacteria | 1777 |
| 73 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 74 | Ga0157372_10306138 | 3300013307 | Bacteria | 1849 |
| 75 | Ga0157372_10591622 | 3300013307 | Bacteria | 1293 |
| 76 | Ga0182007_10004603 | 3300015262 | Bacteria | 6232 |
| 77 | Ga0182005_1005520 | 3300015265 | Bacteria | 3945 |
| 78 | Ga0183363_1139 | 3300015690 | Bacteria | 18545 |
| 79 | Ga0214542_1005348 | 3300021321 | Bacteria | 24469 |
| 80 | Ga0214542_1010983 | 3300021321 | Bacteria | 12744 |
| 81 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 82 | Ga0214543_1005096 | 3300021327 | Bacteria | 24495 |
| 83 | Ga0213875_10020435 | 3300021388 | Bacteria | 3177 |
| 84 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 85 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 86 | Ga0209435_100031 | 3300025206 | Bacteria | 164115 |
| 87 | Ga0209760_103008 | 3300025207 | Bacteria | 1524 |
| 88 | Ga0207427_105047 | 3300025231 | Bacteria | 1975 |
| 89 | Ga0209437_100179 | 3300025233 | Bacteria | 134210 |
| 90 | Ga0209437_100181 | 3300025233 | Bacteria | 132953 |
| 91 | Ga0207425_1009883 | 3300025245 | Bacteria | 2349 |
| 92 | Ga0209646_1000102 | 3300025246 | Bacteria | 164115 |
| 93 | Ga0209646_1011065 | 3300025246 | Bacteria | 1402 |
| 94 | Ga0209026_1000096 | 3300025250 | Bacteria | 164115 |
| 95 | Ga0209677_100353 | 3300025253 | Bacteria | 28643 |
| 96 | Ga0209759_1000090 | 3300025256 | Bacteria | 164115 |
| 97 | Ga0209129_1001428 | 3300025258 | Bacteria | 13345 |
| 98 | Ga0209233_1000185 | 3300025261 | Bacteria | 133788 |
| 99 | Ga0209233_1000212 | 3300025261 | Bacteria | 110364 |
| 100 | Ga0209233_1000263 | 3300025261 | Bacteria | 79293 |
| 101 | Ga0209233_1002422 | 3300025261 | Bacteria | 6884 |
| 102 | Ga0209673_1000476 | 3300025273 | Bacteria | 66898 |
| 103 | Ga0209673_1001239 | 3300025273 | Bacteria | 26592 |
| 104 | Ga0209673_1003238 | 3300025273 | Bacteria | 9839 |
| 105 | Ga0209130_1000058 | 3300025284 | Bacteria | 210250 |
| 106 | Ga0209130_1000133 | 3300025284 | Bacteria | 119561 |
| 107 | Ga0209676_1012006 | 3300025292 | Bacteria | 3444 |
| 108 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 109 | Ga0209025_1000453 | 3300025294 | Bacteria | 80110 |
| 110 | Ga0209025_1000536 | 3300025294 | Bacteria | 71932 |
| 111 | Ga0209564_1000193 | 3300025295 | Bacteria | 141731 |
| 112 | Ga0209564_1000894 | 3300025295 | Bacteria | 39163 |
| 113 | Ga0209758_1000351 | 3300025297 | Bacteria | 83626 |
| 114 | Ga0209758_1000406 | 3300025297 | Bacteria | 73962 |
| 115 | Ga0209758_1000780 | 3300025297 | Bacteria | 45747 |
| 116 | Ga0209758_1019587 | 3300025297 | Bacteria | 3255 |
| 117 | Ga0209256_1001126 | 3300025299 | Bacteria | 30480 |
| 118 | Ga0209256_1001816 | 3300025299 | Bacteria | 20054 |
| 119 | Ga0209256_1003112 | 3300025299 | Bacteria | 12135 |
| 120 | Ga0209256_1026651 | 3300025299 | Bacteria | 1661 |
| 121 | Ga0207426_1000131 | 3300025302 | Bacteria | 210250 |
| 122 | Ga0207426_1000214 | 3300025302 | Bacteria | 137296 |
| 123 | Ga0207426_1000248 | 3300025302 | Bacteria | 119561 |
| 124 | Ga0209051_1000118 | 3300025303 | Bacteria | 149426 |
| 125 | Ga0209051_1000822 | 3300025303 | Bacteria | 32088 |
| 126 | Ga0209051_1001422 | 3300025303 | Bacteria | 20512 |
| 127 | Ga0209051_1030525 | 3300025303 | Bacteria | 2090 |
| 128 | Ga0209257_1008317 | 3300025304 | Bacteria | 5941 |
| 129 | Ga0209257_1010182 | 3300025304 | Bacteria | 4829 |
| 130 | Ga0207647_10128232 | 3300025904 | Bacteria | 1492 |
| 131 | Ga0207695_10000234 | 3300025913 | Bacteria | 146987 |
| 132 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 133 | Ga0207650_10001807 | 3300025925 | Bacteria | 15133 |
| 134 | Ga0207706_10010561 | 3300025933 | Bacteria | 8433 |
| 135 | Ga0207667_10254099 | 3300025949 | Bacteria | 1798 |
| 136 | Ga0207712_10394471 | 3300025961 | Bacteria | 1162 |
| 137 | Ga0207668_10308899 | 3300025972 | Bacteria | 1308 |
| 138 | Ga0207702_10212176 | 3300026078 | Bacteria | 1800 |
| 139 | Ga0207674_10279138 | 3300026116 | Bacteria | 1618 |
| 140 | Ga0207698_10297934 | 3300026142 | Bacteria | 1500 |
| 141 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 142 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 143 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 144 | Ga0209371_1021560 | 3300027312 | Bacteria | 1558 |
| 145 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 146 | Ga0268266_10012935 | 3300028379 | Bacteria | 7198 |
| 147 | Ga0268266_10069758 | 3300028379 | Bacteria | 3046 |
| 148 | Ga0307515_10001049 | 3300028794 | Bacteria | 63286 |
| 149 | Ga0307515_10002808 | 3300028794 | Bacteria | 37051 |
| 150 | Ga0307515_10003215 | 3300028794 | Bacteria | 34578 |
| 151 | Ga0268256_1014104 | 3300030500 | Bacteria | 2388 |
| 152 | Ga0307513_10001726 | 3300031456 | Bacteria | 31179 |
| 153 | Ga0307408_100014748 | 3300031548 | Bacteria | 5195 |
| 154 | Ga0316579_10125700 | 3300031691 | Bacteria | 1234 |
| 155 | Ga0265314_10029460 | 3300031711 | Bacteria | 4080 |
| 156 | Ga0307516_10082433 | 3300031730 | Bacteria | 3058 |
| 157 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 158 | Ga0307416_100081775 | 3300032002 | Bacteria | 2733 |
| 159 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 160 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 161 | Ga0373953_0046757 | 3300035117 | Bacteria | 1739 |
| 162 | Ga0373954_0063538 | 3300035118 | Bacteria | 1745 |
| 163 | Ga0373956_0039131 | 3300035119 | Bacteria | 2101 |
| 164 | Ga0373943_0067484 | 3300035170 | Bacteria | 1804 |
| 165 | Ga0373927_0001342 | 3300035695 | Bacteria | 18565 |
| 166 | Ga0373925_0000830 | 3300037068 | Bacteria | 28511 |
| 167 | Ga0436364_0154238 | 3300037853 | Bacteria | 9599 |
| 168 | Ga0439436_0005093 | 3300041404 | Bacteria | 4026 |
| 169 | Ga0439438_049890 | 3300041405 | Bacteria | 1067 |
| 170 | Ga0439466_0037428 | 3300041411 | Bacteria | 1633 |
| 171 | Ga0451845_0299746 | 3300041501 | Bacteria | 2091 |
| 172 | Ga0451847_0601085 | 3300041503 | Bacteria | 1723 |
| 173 | Ga0451851_0232026 | 3300041507 | Bacteria | 2028 |
| 174 | Ga0451853_2638751 | 3300041512 | Bacteria | 2556 |
| 175 | Ga0439431_0041950 | 3300041997 | Bacteria | 1168 |
| 176 | Ga0439432_048534 | 3300042006 | Bacteria | 1329 |
| 177 | Ga0439449_0007684 | 3300042007 | Bacteria | 4096 |
| 178 | Ga0439449_0025555 | 3300042007 | Bacteria | 2207 |
| 179 | Ga0439449_0031309 | 3300042007 | Bacteria | 1983 |
| 180 | Ga0439462_0021917 | 3300042015 | Bacteria | 1671 |
| 181 | Ga0450906_003965 | 3300042145 | Bacteria | 3132 |
| 182 | Ga0466963_0013780 | 3300044694 | Bacteria | 4975 |
| 183 | Ga0466970_0045160 | 3300044765 | Bacteria | 2345 |
| 184 | Ga0495592_0099673 | 3300046454 | Bacteria | 2072 |
| 185 | Ga0495590_0005422 | 3300046457 | Bacteria | 5063 |
| 186 | Ga0495629_0173323 | 3300046459 | Bacteria | 1496 |
| 187 | Ga0495638_0080656 | 3300046460 | Bacteria | 1976 |
| 188 | Ga0495585_0032892 | 3300046492 | Bacteria | 2937 |
| 189 | Ga0495607_0021613 | 3300046501 | Bacteria | 4047 |
| 190 | Ga0495606_0013862 | 3300046507 | Bacteria | 6328 |
| 191 | Ga0495610_0003473 | 3300046512 | Bacteria | 12266 |
| 192 | Ga0495632_0003903 | 3300046519 | Bacteria | 10361 |
| 193 | Ga0495648_0040268 | 3300046524 | Bacteria | 2965 |
| 194 | Ga0495663_0037240 | 3300046525 | Bacteria | 1467 |
| 195 | Ga0495652_0290885 | 3300046529 | Bacteria | 1192 |
| 196 | Ga0495654_0000143 | 3300046530 | Bacteria | 74495 |
| 197 | Ga0495640_0105301 | 3300046533 | Bacteria | 1848 |
| 198 | Ga0495587_0140742 | 3300046536 | Bacteria | 1377 |
| 199 | Ga0495621_0067290 | 3300046539 | Bacteria | 1312 |
| 200 | Ga0495656_0003093 | 3300046615 | Bacteria | 5594 |
| 201 | Ga0495656_0053137 | 3300046615 | Bacteria | 1740 |
| 202 | Ga0495588_0002054 | 3300046674 | Bacteria | 8610 |
| 203 | Ga0495657_0007569 | 3300046675 | Bacteria | 8384 |
| 204 | Ga0495646_0162066 | 3300046680 | Bacteria | 1237 |
| 205 | Ga0495658_0101250 | 3300046683 | Bacteria | 1720 |
| 206 | Ga0495649_0013067 | 3300046694 | Bacteria | 4800 |
| 207 | Ga0495600_0004789 | 3300046809 | Bacteria | 8122 |
| 208 | Ga0495680_0391003 | 3300047322 | Bacteria | 962 |
| 209 | Ga0495687_012206 | 3300047443 | Bacteria | 4558 |
| 210 | Ga0495675_0317770 | 3300047444 | Bacteria | 922 |
| 211 | Ga0495686_0001104 | 3300047472 | Bacteria | 32036 |
| 212 | Ga0495686_0065021 | 3300047472 | Bacteria | 2256 |
| 213 | Ga0495686_0097019 | 3300047472 | Bacteria | 1783 |
| 214 | Ga0495626_0022058 | 3300048091 | Bacteria | 3149 |
| 215 | Ga0496102_0017668 | 3300048905 | Bacteria | 6251 |
| 216 | Ga0496110_0163159 | 3300048913 | Bacteria | 2020 |
| 217 | Ga0496111_0004902 | 3300048914 | Bacteria | 8503 |
| 218 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 219 | Ga0496116_0009575 | 3300048919 | Bacteria | 8250 |
| 220 | Ga0496117_0001716 | 3300048920 | Bacteria | 30323 |
| 221 | Ga0496117_0013293 | 3300048920 | Bacteria | 7192 |
| 222 | Ga0496118_0014418 | 3300048921 | Bacteria | 7403 |
| 223 | Ga0496119_0024907 | 3300048922 | Bacteria | 4193 |
| 224 | Ga0496119_0032392 | 3300048922 | Bacteria | 3484 |
| 225 | Ga0496120_0023184 | 3300048923 | Bacteria | 3888 |
| 226 | Ga0496120_0043257 | 3300048923 | Bacteria | 2625 |
| 227 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 228 | Ga0496121_0000888 | 3300048924 | Bacteria | 53958 |
| 229 | Ga0496121_0016201 | 3300048924 | Bacteria | 7715 |
| 230 | Ga0496121_0017709 | 3300048924 | Bacteria | 7252 |
| 231 | Ga0496121_0018081 | 3300048924 | Bacteria | 7132 |
| 232 | Ga0496121_0055116 | 3300048924 | Bacteria | 3315 |
| 233 | Ga0496122_0000308 | 3300048925 | Bacteria | 107960 |
| 234 | Ga0496122_0001941 | 3300048925 | Bacteria | 31047 |
| 235 | Ga0496122_0008781 | 3300048925 | Bacteria | 10798 |
| 236 | Ga0496122_0089164 | 3300048925 | Bacteria | 2110 |
| 237 | Ga0496123_0000066 | 3300048926 | Bacteria | 210327 |
| 238 | Ga0496123_0013756 | 3300048926 | Bacteria | 6763 |
| 239 | Ga0496123_0050626 | 3300048926 | Bacteria | 2773 |
| 240 | Ga0496124_0000294 | 3300048927 | Bacteria | 93153 |
| 241 | Ga0496124_0001215 | 3300048927 | Bacteria | 39879 |
| 242 | Ga0496124_0005671 | 3300048927 | Bacteria | 13921 |
| 243 | Ga0496124_0016660 | 3300048927 | Bacteria | 6973 |
| 244 | Ga0496124_0041830 | 3300048927 | Bacteria | 3950 |
| 245 | Ga0496124_0125821 | 3300048927 | Bacteria | 2042 |
| 246 | Ga0496124_0202058 | 3300048927 | Bacteria | 1510 |
| 247 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 248 | Ga0496125_0000288 | 3300048928 | Bacteria | 99681 |
| 249 | Ga0496126_0000115 | 3300048929 | Bacteria | 188546 |
| 250 | Ga0496126_0000258 | 3300048929 | Bacteria | 113843 |
| 251 | Ga0496126_0027368 | 3300048929 | Bacteria | 5447 |
| 252 | Ga0496126_0079175 | 3300048929 | Bacteria | 2909 |
| 253 | Ga0495678_020781 | 3300049459 | Bacteria | 2900 |
| 254 | Ga0501031_0012275 | 3300049568 | Bacteria | 5584 |
| 255 | Ga0501032_0025600 | 3300049569 | Bacteria | 4067 |
| 256 | Ga0501032_0089601 | 3300049569 | Bacteria | 2042 |
| 257 | Ga0501033_0000293 | 3300049570 | Bacteria | 48186 |
| 258 | Ga0501033_0103712 | 3300049570 | Bacteria | 2074 |
| 259 | Ga0501033_0103999 | 3300049570 | Bacteria | 2070 |
| 260 | Ga0501033_0143698 | 3300049570 | Bacteria | 1724 |
| 261 | Ga0501033_0175645 | 3300049570 | Bacteria | 1537 |
| 262 | Ga0501034_0000702 | 3300049571 | Bacteria | 50840 |
| 263 | Ga0501034_0097002 | 3300049571 | Bacteria | 2944 |
| 264 | Ga0501036_0081432 | 3300049572 | Bacteria | 2736 |
| 265 | Ga0501036_0184911 | 3300049572 | Bacteria | 1754 |
| 266 | Ga0501037_0000007 | 3300049573 | Bacteria | 215187 |
| 267 | Ga0501037_0049865 | 3300049573 | Bacteria | 3065 |
| 268 | Ga0501038_0163671 | 3300049574 | Bacteria | 1806 |
| 269 | Ga0501038_0252931 | 3300049574 | Bacteria | 1395 |
| 270 | Ga0501043_0000034 | 3300049579 | Bacteria | 133724 |
| 271 | Ga0501043_0117934 | 3300049579 | Bacteria | 2082 |
| 272 | Ga0501043_0119842 | 3300049579 | Bacteria | 2063 |
| 273 | Ga0501046_0000241 | 3300049580 | Bacteria | 56231 |
| 274 | Ga0501047_0053950 | 3300049581 | Bacteria | 3889 |
| 275 | Ga0501067_0051112 | 3300049583 | Bacteria | 2292 |
| 276 | Ga0501068_0148679 | 3300049584 | Bacteria | 1471 |
| 277 | Ga0501069_0000017 | 3300049585 | Bacteria | 141492 |
| 278 | Ga0501069_0052457 | 3300049585 | Bacteria | 2271 |
| 279 | Ga0501069_0055997 | 3300049585 | Bacteria | 2196 |
| 280 | Ga0501070_0001269 | 3300049586 | Bacteria | 22673 |
| 281 | Ga0501070_0009951 | 3300049586 | Bacteria | 8040 |
| 282 | Ga0501070_0101494 | 3300049586 | Bacteria | 2380 |
| 283 | Ga0501070_0183761 | 3300049586 | Bacteria | 1720 |
| 284 | Ga0501070_0186592 | 3300049586 | Bacteria | 1705 |
| 285 | Ga0501070_0428024 | 3300049586 | Bacteria | 1068 |
| 286 | Ga0501071_0003548 | 3300049587 | Bacteria | 9765 |
| 287 | Ga0501073_0014200 | 3300049589 | Bacteria | 5784 |
| 288 | Ga0501074_0000060 | 3300049590 | Bacteria | 54314 |
| 289 | Ga0501076_0111779 | 3300049592 | Bacteria | 2209 |
| 290 | Ga0501076_0399997 | 3300049592 | Bacteria | 1129 |
| 291 | Ga0501080_0001013 | 3300049742 | Bacteria | 23083 |
| 292 | Ga0501080_0072218 | 3300049742 | Bacteria | 3211 |
| 293 | Ga0501083_0000511 | 3300049744 | Bacteria | 24743 |
| 294 | Ga0501083_0064213 | 3300049744 | Bacteria | 2447 |
| 295 | Ga0501241_014837 | 3300049758 | Bacteria | 1417 |
| 296 | Ga0501280_002847 | 3300049776 | Bacteria | 2782 |
| 297 | Ga0501035_0000159 | 3300049822 | Bacteria | 82264 |
| 298 | Ga0501035_0000772 | 3300049822 | Bacteria | 34369 |
| 299 | Ga0501035_0107540 | 3300049822 | Bacteria | 2445 |
| 300 | Ga0501035_0258909 | 3300049822 | Bacteria | 1475 |
| 301 | Ga0501044_0000010 | 3300049823 | Bacteria | 260121 |
| 302 | Ga0501044_0013069 | 3300049823 | Bacteria | 8984 |
| 303 | Ga0501044_0102271 | 3300049823 | Bacteria | 2881 |
| 304 | Ga0501044_0103971 | 3300049823 | Bacteria | 2854 |
| 305 | Ga0501044_0248726 | 3300049823 | Bacteria | 1720 |
| 306 | nmdc:mga00v17_65314_c1 | 3300050491 | Bacteria | 2245 |
| 307 | nmdc:mga00v17_89_c1 | 3300050491 | Bacteria | 55686 |
| 308 | nmdc:mga0yw44_1851_c1 | 3300050492 | Bacteria | 8685 |
| 309 | nmdc:mga04h51_3008_c1 | 3300050495 | Bacteria | 4056 |
| 310 | nmdc:mga0sz30_62040_c1 | 3300050516 | Bacteria | 1598 |
| 311 | Ga0495601_0037926 | 3300053077 | Bacteria | 3012 |
| 312 | Ga0495612_0014539 | 3300053078 | Bacteria | 3164 |
| 313 | Ga0500643_007497 | 3300053087 | Bacteria | 4388 |
| 314 | Ga0500556_0032151 | 3300053104 | Bacteria | 1791 |
| 315 | Ga0500557_003125 | 3300053105 | Bacteria | 3220 |
| 316 | Ga0500560_006406 | 3300053107 | Bacteria | 2692 |
| 317 | Ga0500594_0005292 | 3300053118 | Bacteria | 2860 |
| 318 | Ga0500568_0044554 | 3300053139 | Bacteria | 1769 |
| 319 | Ga0500573_0001866 | 3300053140 | Bacteria | 10267 |
| 320 | Ga0500573_0010900 | 3300053140 | Bacteria | 5079 |
| 321 | Ga0500588_0059056 | 3300053146 | Bacteria | 1223 |
| 322 | Ga0500604_0028078 | 3300053151 | Bacteria | 1632 |
| 323 | Ga0500616_0000448 | 3300053153 | Bacteria | 53998 |
| 324 | Ga0500616_0079543 | 3300053153 | Bacteria | 1650 |
| 325 | Ga0500620_000445 | 3300053155 | Bacteria | 7473 |
| 326 | Ga0500622_0000169 | 3300053156 | Bacteria | 70224 |
| 327 | Ga0500624_004046 | 3300053157 | Bacteria | 1922 |
| 328 | Ga0500624_010039 | 3300053157 | Bacteria | 1357 |
| 329 | Ga0500636_0000030 | 3300053177 | Bacteria | 77501 |
| 330 | Ga0500636_0002620 | 3300053177 | Bacteria | 9993 |
| 331 | Ga0587073_0011046 | 3300059492 | Bacteria | 1533 |
| 332 | Ga0587106_015816 | 3300059605 | Bacteria | 1059 |
| 333 | Ga0466962_0073795 | 3300061719 | Bacteria | 1630 |
| 334 | 2509108871 | 2508501122 | Bacteria | 6292184 |
| 335 | 2509378001 | 2509276019 | Bacteria | 6802256 |
| 336 | 2510135410 | 2510065019 | Bacteria | 6903379 |
| 337 | 2510305812 | 2510065057 | Bacteria | 6649661 |
| 338 | 2511135854 | 2510917022 | Bacteria | 6504556 |
| 339 | 2511172503 | 2510917026 | Bacteria | 7046020 |
| 340 | 2511388934 | 2511231027 | Bacteria | 5013807 |
| 341 | 2511498578 | 2511231052 | Bacteria | 6974333 |
| 342 | 2512534727 | 2512047086 | Bacteria | 6850303 |
| 343 | 2512973461 | 2512875026 | Bacteria | 6861065 |
| 344 | 2513572891 | 2513237084 | Bacteria | 7231967 |
| 345 | 2513586374 | 2513237086 | Bacteria | 7265287 |
| 346 | 2513602022 | 2513237089 | Bacteria | 6553624 |
| 347 | 2513615811 | 2513237091 | Bacteria | 6900273 |
| 348 | 2513634926 | 2513237093 | Bacteria | 7545552 |
| 349 | 2513711513 | 2513237103 | Bacteria | 7647401 |
| 350 | 2513885377 | 2513237140 | Bacteria | 7076289 |
| 351 | 2513904646 | 2513237143 | Bacteria | 6664116 |
| 352 | 2513983476 | 2513237156 | Bacteria | 6402557 |
| 353 | 2513998289 | 2513237159 | Bacteria | 6810126 |
| 354 | 2514003380 | 2513237160 | Bacteria | 6650282 |
| 355 | 2514586796 | 2513237351 | Bacteria | 6968952 |
| 356 | 2515114582 | 2515075009 | Bacteria | 7288508 |
| 357 | 2515612442 | 2515154107 | Bacteria | 6795637 |
| 358 | 2516205683 | 2516143018 | Bacteria | 6951533 |
| 359 | 2516894855 | 2516653046 | Bacteria | 6989037 |
| 360 | 2517038225 | 2516653077 | Bacteria | 7555578 |
| 361 | 2517097242 | 2517093000 | Bacteria | 7412387 |
| 362 | 2517571536 | 2517487022 | Bacteria | 7227575 |
| 363 | 2524450328 | 2524023207 | Bacteria | 6813453 |
| 364 | 2524461175 | 2524023209 | Bacteria | 6679728 |
| 365 | 2551680660 | 2551306084 | Bacteria | 8942552 |
| 366 | 2551685164 | 2551306085 | Bacteria | 7347181 |
| 367 | 2551691054 | 2551306086 | Bacteria | 6843938 |
| 368 | 2551697616 | 2551306087 | Bacteria | 7351905 |
| 369 | 2551710788 | 2551306089 | Bacteria | 7162724 |
| 370 | 2551724586 | 2551306091 | Bacteria | 7086830 |
| 371 | 2551729196 | 2551306091 | Bacteria | 7086830 |
| 372 | 2551731311 | 2551306091 | Bacteria | 7086830 |
| 373 | 2551736228 | 2551306092 | Bacteria | 6992595 |
| 374 | 2551745950 | 2551306093 | Bacteria | 7064773 |
| 375 | 2558867497 | 2558860100 | Bacteria | 8458965 |
| 376 | 2585166516 | 2582581283 | Bacteria | 6030556 |
| 377 | 2585267162 | 2582581306 | Bacteria | 6450535 |
| 378 | 2585272056 | 2582581307 | Bacteria | 6597605 |
| 379 | 2585279640 | 2582581308 | Bacteria | 7413247 |
| 380 | 2585327478 | 2582581315 | Bacteria | 7318924 |
| 381 | 2585333985 | 2582581316 | Bacteria | 7774528 |
| 382 | 2585388213 | 2582581865 | Bacteria | 6644329 |
| 383 | 2585396190 | 2582581866 | Bacteria | 6859583 |
| 384 | 2585535720 | 2585427527 | Bacteria | 7273426 |
| 385 | 2585543015 | 2585427528 | Bacteria | 6842387 |
| 386 | 2585551097 | 2585427530 | Bacteria | 7383882 |
| 387 | 2585563399 | 2585427531 | Bacteria | 6992870 |
| 388 | 2585839216 | 2585427593 | Bacteria | 7141551 |
| 389 | 2585897179 | 2585427608 | Bacteria | 6544331 |
| 390 | 2585909094 | 2585427609 | Bacteria | 6667127 |
| 391 | 2585998065 | 2585427633 | Bacteria | 6413184 |
| 392 | 2586002645 | 2585427634 | Bacteria | 6455027 |
| 393 | 2587984508 | 2585428125 | Bacteria | 6662905 |
| 394 | 2599335758 | 2599185156 | Bacteria | 5403036 |
| 395 | 2599722627 | 2599185236 | Bacteria | 6875203 |
| 396 | 2600193963 | 2599185352 | Bacteria | 7228948 |
| 397 | 2600377431 | 2600254933 | Bacteria | 4750527 |
| 398 | 2616306428 | 2615840626 | Bacteria | 7921970 |
| 399 | 2616551084 | 2615840698 | Bacteria | 7319877 |
| 400 | 2617382317 | 2617270742 | Bacteria | 6808054 |
| 401 | 2643807951 | 2643221557 | Bacteria | 7184309 |
| 402 | 2643814834 | 2643221558 | Bacteria | 5460675 |
| 403 | 2643854825 | 2643221568 | Bacteria | 5187270 |
| 404 | 2644002634 | 2643221599 | Bacteria | 6292121 |
| 405 | 2644052430 | 2643221607 | Bacteria | 6314006 |
| 406 | 2644068858 | 2643221610 | Bacteria | 7480339 |
| 407 | 2644105774 | 2643221618 | Bacteria | 7717186 |
| 408 | 2644146342 | 2643221626 | Bacteria | 8069654 |
| 409 | 2644201187 | 2643221636 | Bacteria | 6583769 |
| 410 | 2644209655 | 2643221637 | Bacteria | 5345260 |
| 411 | 2644310387 | 2643221655 | Bacteria | 7722067 |
| 412 | 2644378416 | 2643221668 | Bacteria | 7306521 |
| 413 | 2644419929 | 2643221675 | Bacteria | 7473456 |
| 414 | 2644453285 | 2643221680 | Bacteria | 7473610 |
| 415 | 2644484708 | 2643221686 | Bacteria | 6310811 |
| 416 | 2644492567 | 2643221688 | Bacteria | 5260751 |
| 417 | 2644501229 | 2643221689 | Bacteria | 6042950 |
| 418 | 2644544978 | 2643221698 | Bacteria | 7756764 |
| 419 | 2644615372 | 2643221712 | Bacteria | 7729434 |
| 420 | 2644653183 | 2643221718 | Bacteria | 5345506 |
| 421 | 2644675084 | 2643221723 | Bacteria | 7095460 |
| 422 | 2644688688 | 2643221726 | Bacteria | 7455827 |
| 423 | 2657682320 | 2657244999 | Bacteria | 5946535 |
| 424 | 2671116038 | 2667528174 | Bacteria | 6435400 |
| 425 | 2671693662 | 2671180139 | Bacteria | 4196045 |
| 426 | 2692319851 | 2690316117 | Bacteria | 6800650 |
| 427 | 2720633484 | 2718218235 | Bacteria | 6630699 |
| 428 | 2720777182 | 2718218269 | Bacteria | 6906114 |
| 429 | 2723028780 | 2721755556 | Bacteria | 6745503 |
| 430 | 2723562393 | 2721755684 | Bacteria | 6859907 |
| 431 | 2723569089 | 2721755685 | Bacteria | 6704835 |
| 432 | 2724091789 | 2721755819 | Bacteria | 6906405 |
| 433 | 2724106354 | 2721755822 | Bacteria | 6726041 |
| 434 | 2725945772 | 2724679232 | Bacteria | 7646494 |
| 435 | 2730109716 | 2728369352 | Bacteria | 6745171 |
| 436 | 2738947088 | 2738541317 | Bacteria | 5340176 |
| 437 | 2739037711 | 2738541333 | Bacteria | 7106503 |
| 438 | 2753458490 | 2751185821 | Bacteria | 6189929 |
| 439 | 2757571002 | 2757320392 | Bacteria | 3737298 |
| 440 | 2766064093 | 2765235942 | Bacteria | 7445910 |
| 441 | 2776269672 | 2775506902 | Bacteria | 6208009 |
| 442 | 2776282601 | 2775506904 | Bacteria | 5954060 |
| 443 | 2778179210 | 2775507266 | Bacteria | 7392367 |
| 444 | 2792582330 | 2791355082 | Bacteria | 5973319 |
| 445 | 2792621818 | 2791355091 | Bacteria | 6135441 |
| 446 | 2792628924 | 2791355092 | Bacteria | 6248105 |
| 447 | 2792640065 | 2791355094 | Bacteria | 7011481 |
| 448 | 2793295472 | 2791355256 | Bacteria | 6798008 |
| 449 | 2793327448 | 2791355261 | Bacteria | 6661293 |
| 450 | 2802717098 | 2802428858 | Bacteria | 6636079 |
| 451 | 2802724914 | 2802428859 | Bacteria | 6667919 |
| 452 | 2802729664 | 2802428860 | Bacteria | 6525526 |
| 453 | 2802737010 | 2802428861 | Bacteria | 6534206 |
| 454 | 2802743415 | 2802428862 | Bacteria | 6633353 |
| 455 | 2802749459 | 2802428863 | Bacteria | 6410669 |
| 456 | 2804753786 | 2802429268 | Bacteria | 6094027 |
| 457 | 2805926366 | 2802429605 | Bacteria | 6875453 |
| 458 | 2805934092 | 2802429606 | Bacteria | 6346811 |
| 459 | 2806047745 | 2802429633 | Bacteria | 7341974 |
| 460 | 2806055321 | 2802429634 | Bacteria | 7083200 |
| 461 | 2806062202 | 2802429635 | Bacteria | 7650140 |
| 462 | 2806070039 | 2802429636 | Bacteria | 7597525 |
| 463 | 2806076661 | 2802429637 | Bacteria | 7067217 |
| 464 | 2819611965 | 2818991448 | Bacteria | 6772224 |
| 465 | 2819638495 | 2818991453 | Bacteria | 7181617 |
| 466 | 2821129218 | 2821123053 | Bacteria | 7836056 |
| 467 | 2838034109 | 2838029111 | Bacteria | 6603031 |
| 468 | 2838072287 | 2838068647 | Bacteria | 6208656 |
| 469 | 2838078073 | 2838074704 | Bacteria | 6785777 |
| 470 | 2838672319 | 2838668709 | Bacteria | 6671819 |
| 471 | 2838704812 | 2838701080 | Bacteria | 6669771 |
| 472 | 2838742156 | 2838736955 | Bacteria | 5760694 |
| 473 | 2840766262 | 2840764183 | Bacteria | 6358399 |
| 474 | 2841846012 | 2841840854 | Bacteria | 5761912 |
| 475 | 2842116587 | 2842110456 | Bacteria | 7656360 |
| 476 | 2842145623 | 2842140634 | Bacteria | 5759631 |
| 477 | 2842148952 | 2842146304 | Bacteria | 5957337 |
| 478 | 2842194727 | 2842192696 | Bacteria | 6147454 |
| 479 | 2842221948 | 2842217011 | Bacteria | 7497767 |
| 480 | 2842254492 | 2842250916 | Bacteria | 6579627 |
| 481 | 2842302619 | 2842298080 | Bacteria | 6123127 |
| 482 | 2842321263 | 2842317721 | Bacteria | 6793725 |
| 483 | 2842358879 | 2842357229 | Bacteria | 6485165 |
| 484 | 2842425919 | 2842422224 | Bacteria | 6239196 |
| 485 | 2842480923 | 2842475841 | Bacteria | 6603183 |
| 486 | 2842485273 | 2842482326 | Bacteria | 7212537 |
| 487 | 2842491331 | 2842489311 | Bacteria | 6620893 |
| 488 | 2842498654 | 2842495871 | Bacteria | 6820686 |
| 489 | 2842507466 | 2842502639 | Bacteria | 6604161 |
| 490 | 2842514700 | 2842509118 | Bacteria | 6850950 |
| 491 | 2842524688 | 2842521101 | Bacteria | 6569494 |
| 492 | 2842873866 | 2842871566 | Bacteria | 4827117 |
| 493 | 2842926454 | 2842922631 | Bacteria | 5824079 |
| 494 | 2847420925 | 2847417321 | Bacteria | 6913799 |
| 495 | 2848995757 | 2848992105 | Bacteria | 6810864 |
| 496 | 2850082742 | 2850079185 | Bacteria | 6848280 |
| 497 | 2852392096 | 2852387548 | Bacteria | 8025568 |
| 498 | 2854897722 | 2854896431 | Bacteria | 5869725 |
| 499 | 2854922301 | 2854916844 | Bacteria | 5725939 |
| 500 | 2855827489 | 2855825444 | Bacteria | 6785811 |
| 501 | 2855842864 | 2855839649 | Bacteria | 7135830 |
| 502 | 2855873621 | 2855872281 | Bacteria | 6964271 |
| 503 | 2857510999 | 2857509624 | Bacteria | 7472071 |
| 504 | 2857536159 | 2857531043 | Bacteria | 6754041 |
| 505 | 2858803542 | 2858800743 | Bacteria | 6603254 |
| 506 | 2874102738 | 2874102143 | Bacteria | 6342645 |
| 507 | 2889791561 | 2889790730 | Bacteria | 5689708 |
| 508 | 2889917306 | 2889914905 | Bacteria | 5702301 |
| 509 | 2891377801 | 2891373044 | Bacteria | 5202277 |
| 510 | 2894821019 | 2894817345 | Bacteria | 4892941 |
| 511 | 2896390099 | 2896384573 | Bacteria | 7700774 |
| 512 | 2909047520 | 2909042592 | Bacteria | 6499737 |
| 513 | 2913300233 | 2913295892 | Bacteria | 6333755 |
| 514 | 2913312083 | 2913308742 | Bacteria | 5350706 |
| 515 | 2915981723 | 2915980308 | Bacteria | 6624279 |
| 516 | 2915991930 | 2915986958 | Bacteria | 6739310 |
| 517 | 2915999577 | 2915993759 | Bacteria | 7016183 |
| 518 | 2916004485 | 2916000859 | Bacteria | 6865702 |
| 519 | 2916009091 | 2916007675 | Bacteria | 6898660 |
| 520 | 2916019855 | 2916014648 | Bacteria | 6946486 |
| 521 | 2916023921 | 2916021584 | Bacteria | 6854472 |
| 522 | 2916031846 | 2916028427 | Bacteria | 6748433 |
| 523 | 2916040487 | 2916035215 | Bacteria | 6755766 |
| 524 | 2916043420 | 2916041962 | Bacteria | 6820487 |
| 525 | 2916050655 | 2916048683 | Bacteria | 6543552 |
| 526 | 2916058681 | 2916055098 | Bacteria | 6758838 |
| 527 | 2916066494 | 2916061851 | Bacteria | 6737736 |
| 528 | 2916071000 | 2916068649 | Bacteria | 6943657 |
| 529 | 2916082563 | 2916076590 | Bacteria | 6596108 |
| 530 | 2919170461 | 2919166419 | Bacteria | 4952238 |
| 531 | 2919176895 | 2919171160 | Bacteria | 6499771 |
| 532 | 2919411444 | 2919408235 | Bacteria | 6149349 |
| 533 | 2920760230 | 2920760137 | Bacteria | 7427611 |
| 534 | 2920826046 | 2920822456 | Bacteria | 6897201 |
| 535 | 2921204777 | 2921201388 | Bacteria | 6926299 |
| 536 | 2921212040 | 2921208531 | Bacteria | 6745326 |
| 537 | 2921240366 | 2921237296 | Bacteria | 6876710 |
| 538 | 2921245641 | 2921244191 | Bacteria | 6568419 |
| 539 | 2921252812 | 2921250672 | Bacteria | 6677771 |
| 540 | 2921260451 | 2921257292 | Bacteria | 6808382 |
| 541 | 2921267535 | 2921263974 | Bacteria | 6864552 |
| 542 | 2921287342 | 2921282425 | Bacteria | 6826397 |
| 543 | 2921293970 | 2921289301 | Bacteria | 7316391 |
| 544 | 2921302585 | 2921296804 | Bacteria | 7176999 |
| 545 | 2924144799 | 2924144063 | Bacteria | 6883928 |
| 546 | 2924157650 | 2924150972 | Bacteria | 7169444 |
| 547 | 2924158792 | 2924158325 | Bacteria | 7188855 |
| 548 | 2924168536 | 2924165586 | Bacteria | 7260590 |
| 549 | 2924175788 | 2924172951 | Bacteria | 6749356 |
| 550 | 2924183477 | 2924179722 | Bacteria | 6843264 |
| 551 | 2924190224 | 2924186466 | Bacteria | 6876637 |
| 552 | 2924193495 | 2924193448 | Bacteria | 6955718 |
| 553 | 2924201436 | 2924200457 | Bacteria | 6757188 |
| 554 | 2924207780 | 2924207177 | Bacteria | 6917007 |
| 555 | 2924214900 | 2924214083 | Bacteria | 7080103 |
| 556 | 2924227123 | 2924221636 | Bacteria | 7113495 |
| 557 | 2924234046 | 2924228884 | Bacteria | 6633132 |
| 558 | 2928522889 | 2928521798 | Bacteria | 4960112 |
| 559 | 2929141999 | 2929138655 | Bacteria | 5810547 |
| 560 | 2933592807 | 2933586486 | Bacteria | 7667493 |
| 561 | 2933602861 | 2933599457 | Bacteria | 5858799 |
| 562 | 2936370069 | 2936367885 | Bacteria | 7324495 |
| 563 | 2936379245 | 2936375103 | Bacteria | 6652732 |
| 564 | 2936997426 | 2936996657 | Bacteria | 6298727 |
| 565 | 2937004110 | 2937002841 | Bacteria | 6934057 |
| 566 | 2937010353 | 2937009748 | Bacteria | 6746052 |
| 567 | 2937020655 | 2937016420 | Bacteria | 6782579 |
| 568 | 2937023186 | 2937023124 | Bacteria | 6815156 |
| 569 | 2937031735 | 2937029754 | Bacteria | 6424026 |
| 570 | 2937037802 | 2937036028 | Bacteria | 6846469 |
| 571 | 2937049574 | 2937042894 | Bacteria | 6741576 |
| 572 | 2937055196 | 2937049772 | Bacteria | 6757901 |
| 573 | 2937059101 | 2937056579 | Bacteria | 7107896 |
| 574 | 2937070489 | 2937063883 | Bacteria | 7199456 |
| 575 | 2937076127 | 2937071275 | Bacteria | 6984483 |
| 576 | 2937081480 | 2937078374 | Bacteria | 6610289 |
| 577 | 2937090888 | 2937084907 | Bacteria | 6618516 |
| 578 | 2937098492 | 2937091812 | Bacteria | 6979387 |
| 579 | 2937104337 | 2937098957 | Bacteria | 7249374 |
| 580 | 2937113234 | 2937106411 | Bacteria | 6947143 |
| 581 | 2937114234 | 2937113482 | Bacteria | 6505872 |
| 582 | 2937120232 | 2937119839 | Bacteria | 6597547 |
| 583 | 2937129787 | 2937126314 | Bacteria | 6771275 |
| 584 | 2941501469 | 2941499720 | Bacteria | 7599444 |
| 585 | 2954013745 | 2954011201 | Bacteria | 4762601 |
| 586 | 2957376802 | 2957375807 | Bacteria | 6425588 |
| 587 | 2957384931 | 2957382221 | Bacteria | 6737050 |
| 588 | 2957395206 | 2957388812 | Bacteria | 6778072 |
| 589 | 2957399699 | 2957395598 | Bacteria | 6822399 |
| 590 | 2957405557 | 2957402308 | Bacteria | 6741770 |
| 591 | 2957411722 | 2957408893 | Bacteria | 6558585 |
| 592 | 2957417479 | 2957415311 | Bacteria | 6991633 |
| 593 | 2957422356 | 2957422303 | Bacteria | 7172205 |
| 594 | 2957430070 | 2957430029 | Bacteria | 7022557 |
| 595 | 2957441660 | 2957437181 | Bacteria | 6568994 |
| 596 | 2957447629 | 2957443900 | Bacteria | 6869977 |
| 597 | 2957454687 | 2957450854 | Bacteria | 6765715 |
| 598 | 2957460990 | 2957457609 | Bacteria | 6967680 |
| 599 | 2957466517 | 2957464669 | Bacteria | 6568877 |
| 600 | 2957471401 | 2957471148 | Bacteria | 6797643 |
| 601 | 2957481461 | 2957478035 | Bacteria | 6756658 |
| 602 | 2957485525 | 2957484790 | Bacteria | 6703082 |
| 603 | 2957494443 | 2957491536 | Bacteria | 6695180 |
| 604 | 2957505182 | 2957498199 | Bacteria | 7126688 |
| 605 | 2957508258 | 2957505466 | Bacteria | 7253085 |
| 606 | 2960585192 | 2960584000 | Bacteria | 6864594 |
| 607 | 2960592790 | 2960591022 | Bacteria | 6622873 |
| 608 | 2960597907 | 2960597568 | Bacteria | 6550735 |
| 609 | 2960607499 | 2960603979 | Bacteria | 6898737 |
| 610 | 2960613687 | 2960610863 | Bacteria | 6691244 |
| 611 | 2960619101 | 2960617483 | Bacteria | 6727748 |
| 612 | 2960625372 | 2960624210 | Bacteria | 6875384 |
| 613 | 2960634187 | 2960631154 | Bacteria | 6732508 |
| 614 | 2960645373 | 2960637947 | Bacteria | 7296468 |
| 615 | 2960650696 | 2960645483 | Bacteria | 7211087 |
| 616 | 2960659198 | 2960652885 | Bacteria | 7083688 |
| 617 | 2960663990 | 2960660292 | Bacteria | 7041660 |
| 618 | 2960673279 | 2960667422 | Bacteria | 6763020 |
| 619 | 2960674892 | 2960674078 | Bacteria | 6609048 |
| 620 | 2960681715 | 2960680706 | Bacteria | 6624464 |
| 621 | 2960689345 | 2960687367 | Bacteria | 6535474 |
| 622 | 2960700641 | 2960693952 | Bacteria | 6749742 |
| 623 | 2964608235 | 2964607997 | Bacteria | 7101408 |
| 624 | 2964621596 | 2964615318 | Bacteria | 6809089 |
| 625 | 2964625821 | 2964621998 | Bacteria | 6834995 |
| 626 | 2964629524 | 2964628898 | Bacteria | 7083044 |
| 627 | 2964639213 | 2964636051 | Bacteria | 7091832 |
| 628 | 2964643618 | 2964643177 | Bacteria | 6820887 |
| 629 | 2964655222 | 2964649959 | Bacteria | 6675118 |
| 630 | 2964659969 | 2964656573 | Bacteria | 7100150 |
| 631 | 2964669390 | 2964663802 | Bacteria | 7019362 |
| 632 | 2964676876 | 2964670856 | Bacteria | 6851364 |
| 633 | 2964679597 | 2964678106 | Bacteria | 6792020 |
| 634 | 2964687443 | 2964685014 | Bacteria | 6839111 |
| 635 | 2964695132 | 2964691889 | Bacteria | 6802758 |
| 636 | 2964699150 | 2964698721 | Bacteria | 6765331 |
| 637 | 2964711213 | 2964705432 | Bacteria | 7114648 |
| 638 | 2964712669 | 2964712639 | Bacteria | 6695970 |
| 639 | 2964726759 | 2964719344 | Bacteria | 7286602 |
| 640 | 2967671078 | 2967664464 | Bacteria | 6948836 |
| 641 | 2967675597 | 2967671571 | Bacteria | 7021409 |
| 642 | 2967681238 | 2967678726 | Bacteria | 7264382 |
| 643 | 2967692437 | 2967686174 | Bacteria | 6678622 |
| 644 | 2967699389 | 2967693043 | Bacteria | 6804451 |
| 645 | 2967703207 | 2967699805 | Bacteria | 6854538 |
| 646 | 2967713809 | 2967706974 | Bacteria | 7186053 |
| 647 | 2967721186 | 2967714385 | Bacteria | 7000047 |
| 648 | 2967724972 | 2967721400 | Bacteria | 7073753 |
| 649 | 2967731822 | 2967728569 | Bacteria | 6641507 |
| 650 | 2967738453 | 2967735183 | Bacteria | 6827012 |
| 651 | 2967745450 | 2967742019 | Bacteria | 6794534 |
| 652 | 2967752626 | 2967748971 | Bacteria | 6733771 |
| 653 | 2967757737 | 2967755722 | Bacteria | 6814706 |
| 654 | 2967765806 | 2967762386 | Bacteria | 6923502 |
| 655 | 2967770356 | 2967769361 | Bacteria | 6587838 |
| 656 | 2967780525 | 2967775926 | Bacteria | 6738189 |
| 657 | 2970021979 | 2970019648 | Bacteria | 7072033 |
| 658 | 2970028688 | 2970026789 | Bacteria | 6785236 |
| 659 | 2970038993 | 2970033650 | Bacteria | 7118744 |
| 660 | 2970046589 | 2970040964 | Bacteria | 6731123 |
| 661 | 2970049634 | 2970047711 | Bacteria | 7088379 |
| 662 | 2970058846 | 2970054988 | Bacteria | 6611507 |
| 663 | 2970066770 | 2970061556 | Bacteria | 7099761 |
| 664 | 2970071164 | 2970068827 | Bacteria | 7123112 |
| 665 | 2970076728 | 2970076120 | Bacteria | 6697332 |
| 666 | 2970083983 | 2970082768 | Bacteria | 6183754 |
| 667 | 2970092753 | 2970088815 | Bacteria | 6933825 |
| 668 | 2970101161 | 2970095765 | Bacteria | 6936963 |
| 669 | 2970104621 | 2970102677 | Bacteria | 6812532 |
| 670 | 2970111073 | 2970109326 | Bacteria | 6863976 |
| 671 | 2970118364 | 2970116247 | Bacteria | 6501857 |
| 672 | 2970124517 | 2970122695 | Bacteria | 6625855 |
| 673 | 2970133532 | 2970129317 | Bacteria | 6806560 |
| 674 | 2970140903 | 2970136068 | Bacteria | 7207982 |
| 675 | 2970147325 | 2970143518 | Bacteria | 6446480 |
| 676 | 2970151740 | 2970149975 | Bacteria | 6779706 |
| 677 | 2970158669 | 2970156795 | Bacteria | 7168044 |
| 678 | 2970170765 | 2970164137 | Bacteria | 6861252 |
| 679 | 2970174098 | 2970170962 | Bacteria | 6876229 |
| 680 | 2970182128 | 2970177841 | Bacteria | 6768001 |
| 681 | 2970189149 | 2970184632 | Bacteria | 7054431 |
| 682 | 2970197923 | 2970191845 | Bacteria | 7032787 |
| 683 | 2977520198 | 2977516862 | Bacteria | 6940108 |
| 684 | 2977525112 | 2977523885 | Bacteria | 6960446 |
| 685 | 2977531190 | 2977530762 | Bacteria | 6951399 |
| 686 | 2977544480 | 2977537788 | Bacteria | 6929320 |
| 687 | 2977547159 | 2977544691 | Bacteria | 6875412 |
| 688 | 2977558022 | 2977551784 | Bacteria | 7125765 |
| 689 | 2977564733 | 2977558990 | Bacteria | 6863948 |
| 690 | 2977571302 | 2977565890 | Bacteria | 6901543 |
| 691 | 2977573824 | 2977572785 | Bacteria | 6763888 |
| 692 | 2977583353 | 2977579622 | Bacteria | 6772100 |
| 693 | 2977863111 | 2977858184 | Bacteria | 6215359 |
| 694 | 2978972743 | 2978969890 | Bacteria | 5400756 |
| 695 | 2984590995 | 2984587000 | Bacteria | 5263363 |
| 696 | 2989355064 | 2989349275 | Bacteria | 6349068 |
| 697 | 2996315332 | 2996310559 | Bacteria | 6357320 |
| 698 | 2996897074 | 2996893221 | Bacteria | 5823108 |
| 699 | 3000020586 | 3000017691 | Bacteria | 3772574 |
| 700 | 3005415951 | 3005409236 | Bacteria | 7188837 |
| 701 | 3005416896 | 3005416602 | Bacteria | 7064308 |
| 702 | 639650602 | 639633055 | Bacteria | 7751309 |
| 703 | 648737298 | 648276728 | Bacteria | 6968865 |
| 704 | 8003995445 | 8003992118 | Bacteria | 7266902 |
| 705 | 8004003204 | 8003999396 | Bacteria | 7063185 |
| 706 | 8004446890 | 8004445564 | Bacteria | 6322258 |
| 707 | 8005286586 | 8005282627 | Bacteria | 6675747 |
| 708 | 8005306116 | 8005301065 | Bacteria | 6614431 |
| 709 | 8005315900 | 8005314921 | Bacteria | 7072929 |
| 710 | 8005381401 | 8005376324 | Bacteria | 6590079 |
| 711 | 8005387613 | 8005382845 | Bacteria | 6732062 |
| 712 | 8005400645 | 8005395548 | Bacteria | 6806915 |
| 713 | 8005465277 | 8005460587 | Bacteria | 7157962 |
| 714 | 8005486987 | 8005484373 | Bacteria | 6297373 |
| 715 | 8005561342 | 8005556819 | Bacteria | 6908598 |
| 716 | 8005565964 | 8005563573 | Bacteria | 7153261 |
| 717 | 8005572013 | 8005570704 | Bacteria | 6957481 |
| 718 | 8005645184 | 8005645114 | Bacteria | 6950293 |
| 719 | 8005687370 | 8005682033 | Bacteria | 6726518 |
| 720 | 8005694187 | 8005688590 | Bacteria | 6610080 |
| 721 | 8018155010 | 8018150411 | Bacteria | 5549903 |
| 722 | 8018164921 | 8018163183 | Bacteria | 7277977 |
| 723 | 8024484539 | 8024479707 | Bacteria | 6954785 |
| 724 | 8024491005 | 8024486573 | Bacteria | 6540512 |
| 725 | 8024502163 | 8024501048 | Bacteria | 6427847 |
| 726 | 8046768379 | 8046767195 | Bacteria | 7547379 |
| 727 | 8049296387 | 8049293176 | Bacteria | 6128433 |
| 728 | 8054463883 | 8054460903 | Bacteria | 4872905 |
| 729 | 8055432891 | 8055431914 | Bacteria | 4551896 |
| 730 | 8056878350 | 8056875544 | Bacteria | 4355797 |
| 731 | 8057581952 | 8057575449 | Bacteria | 7367519 |
| 732 | 8057879458 | 8057874678 | Bacteria | 7494653 |
| 733 | Ga0496117_0067097 | |||
| 734 | JGI24740J21852_10001569 | |||
| 735 | JGI25155J39150_1000018 | |||
| 736 | JGI25156J39149_1000055 | |||
| 737 | JGI25162J39368_1000253 | |||
| 738 | JGI25162J39368_1000524 | |||
| 739 | JGI25154J39366_1000069 | |||
| 740 | JGI25157J39369_1000076 | |||
| 741 | JGI25159J45721_1000022 | |||
| 742 | JGI25159J45721_1019021 | |||
| 743 | JGI25151J46595_10004202 | |||
| 744 | JGI25151J46595_10004375 | |||
| 745 | JGI25165J46597_1000723 | |||
| 746 | JGI25165J46597_1001404 | |||
| 747 | JGI25153J46596_10001515 | |||
| 748 | JGI25153J46596_10007129 | |||
| 749 | JGI25160J50197_1000051 | |||
| 750 | JGI25160J50197_1000056 | |||
| 751 | JGI25160J50197_1000317 | |||
| 752 | JGI25161J50226_1000011 | |||
| 753 | JGI25161J50226_1000413 | |||
| 754 | JGI25161J50226_1000646 | |||
| 755 | JGI25161J50226_1002096 | |||
| 756 | Ga0055526_1001154 | |||
| 757 | Ga0055526_1003525 | |||
| 758 | Ga0055524_1000763 | |||
| 759 | Ga0055524_1006132 | |||
| 760 | Ga0055536_1005618 | |||
| 761 | Ga0055528_1001009 | |||
| 762 | Ga0055528_1011854 | |||
| 763 | Ga0055528_1016405 | |||
| 764 | Ga0055540_1000835 | |||
| 765 | Ga0055540_1027435 | |||
| 766 | Ga0055531_10009729 | |||
| 767 | Ga0055531_10020802 | |||
| 768 | Ga0055543_1000041 | |||
| 769 | Ga0055543_1000431 | |||
| 770 | Ga0055543_1000682 | |||
| 771 | Ga0065165_1000135 | |||
| 772 | Ga0065165_1000155 | |||
| 773 | Ga0065165_1002015 | |||
| 774 | Ga0070670_100002528 | |||
| 775 | Ga0068869_100229561 | |||
| 776 | Ga0070665_100091719 | |||
| 777 | Ga0068856_100173301 | |||
| 778 | Ga0075365_10000409 | |||
| 779 | Ga0075365_10002336 | |||
| 780 | Ga0075365_10016899 | |||
| 781 | Ga0075365_10034079 | |||
| 782 | Ga0075365_10256611 | |||
| 783 | Ga0075368_10018237 | |||
| 784 | Ga0075364_10000006 | |||
| 785 | Ga0075364_10002563 | |||
| 786 | Ga0075362_10005557 | |||
| 787 | Ga0075370_10000490 | |||
| 788 | Ga0075370_10064995 | |||
| 789 | Ga0079104_1000310 | |||
| 790 | Ga0079104_1004373 | |||
| 791 | Ga0079104_1013407 | |||
| 792 | Ga0105244_10131016 | |||
| 793 | Ga0105240_10000142 | |||
| 794 | Ga0105240_10426616 | |||
| 795 | Ga0105237_10008145 | |||
| 796 | Ga0105249_10003472 | |||
| 797 | Ga0123341_1000436 | |||
| 798 | Ga0105239_10001079 | |||
| 799 | Ga0105239_10586991 | |||
| 800 | Ga0157371_10016970 | |||
| 801 | Ga0157370_10000855 | |||
| 802 | Ga0157369_10203701 | |||
| 803 | Ga0157369_10256829 | |||
| 804 | Ga0157369_10268785 | |||
| 805 | Ga0171463_1004 | |||
| 806 | Ga0157372_10306138 | |||
| 807 | Ga0157372_10591622 | |||
| 808 | Ga0182007_10004603 | |||
| 809 | Ga0182005_1005520 | |||
| 810 | Ga0183363_1139 | |||
| 811 | Ga0214542_1005348 | |||
| 812 | Ga0214542_1010983 | |||
| 813 | Ga0214543_1000015 | |||
| 814 | Ga0214543_1005096 | |||
| 815 | Ga0213875_10020435 | |||
| 816 | Ga0228711_1000004 | |||
| 817 | Ga0228710_1000002 | |||
| 818 | Ga0209435_100031 | |||
| 819 | Ga0209760_103008 | |||
| 820 | Ga0207427_105047 | |||
| 821 | Ga0209437_100179 | |||
| 822 | Ga0209437_100181 | |||
| 823 | Ga0207425_1009883 | |||
| 824 | Ga0209646_1000102 | |||
| 825 | Ga0209646_1011065 | |||
| 826 | Ga0209026_1000096 | |||
| 827 | Ga0209677_100353 | |||
| 828 | Ga0209759_1000090 | |||
| 829 | Ga0209129_1001428 | |||
| 830 | Ga0209233_1000185 | |||
| 831 | Ga0209233_1000212 | |||
| 832 | Ga0209233_1000263 | |||
| 833 | Ga0209233_1002422 | |||
| 834 | Ga0209673_1000476 | |||
| 835 | Ga0209673_1001239 | |||
| 836 | Ga0209673_1003238 | |||
| 837 | Ga0209130_1000058 | |||
| 838 | Ga0209130_1000133 | |||
| 839 | Ga0209676_1012006 | |||
| 840 | Ga0209025_1000042 | |||
| 841 | Ga0209025_1000453 | |||
| 842 | Ga0209025_1000536 | |||
| 843 | Ga0209564_1000193 | |||
| 844 | Ga0209564_1000894 | |||
| 845 | Ga0209758_1000351 | |||
| 846 | Ga0209758_1000406 | |||
| 847 | Ga0209758_1000780 | |||
| 848 | Ga0209758_1019587 | |||
| 849 | Ga0209256_1001126 | |||
| 850 | Ga0209256_1001816 | |||
| 851 | Ga0209256_1003112 | |||
| 852 | Ga0209256_1026651 | |||
| 853 | Ga0207426_1000131 | |||
| 854 | Ga0207426_1000214 | |||
| 855 | Ga0207426_1000248 | |||
| 856 | Ga0209051_1000118 | |||
| 857 | Ga0209051_1000822 | |||
| 858 | Ga0209051_1001422 | |||
| 859 | Ga0209051_1030525 | |||
| 860 | Ga0209257_1008317 | |||
| 861 | Ga0209257_1010182 | |||
| 862 | Ga0207647_10128232 | |||
| 863 | Ga0207695_10000234 | |||
| 864 | Ga0207671_10000043 | |||
| 865 | Ga0207650_10001807 | |||
| 866 | Ga0207706_10010561 | |||
| 867 | Ga0207667_10254099 | |||
| 868 | Ga0207712_10394471 | |||
| 869 | Ga0207668_10308899 | |||
| 870 | Ga0207702_10212176 | |||
| 871 | Ga0207674_10279138 | |||
| 872 | Ga0207698_10297934 | |||
| 873 | Ga0209281_1000028 | |||
| 874 | Ga0209281_1000030 | |||
| 875 | Ga0209281_1000144 | |||
| 876 | Ga0209371_1021560 | |||
| 877 | Ga0209282_1000004 | |||
| 878 | Ga0268266_10012935 | |||
| 879 | Ga0268266_10069758 | |||
| 880 | Ga0307515_10001049 | |||
| 881 | Ga0307515_10002808 | |||
| 882 | Ga0307515_10003215 | |||
| 883 | Ga0268256_1014104 | |||
| 884 | Ga0307513_10001726 | |||
| 885 | Ga0307408_100014748 | |||
| 886 | Ga0316579_10125700 | |||
| 887 | Ga0265314_10029460 | |||
| 888 | Ga0307516_10082433 | |||
| 889 | Ga0315914_1000001 | |||
| 890 | Ga0307416_100081775 | |||
| 891 | Ga0315913_1000004 | |||
| 892 | Ga0315915_1000002 | |||
| 893 | Ga0373953_0046757 | |||
| 894 | Ga0373954_0063538 | |||
| 895 | Ga0373956_0039131 | |||
| 896 | Ga0373943_0067484 | |||
| 897 | Ga0373927_0001342 | |||
| 898 | Ga0373925_0000830 | |||
| 899 | Ga0436364_0154238 | |||
| 900 | Ga0439436_0005093 | |||
| 901 | Ga0439438_049890 | |||
| 902 | Ga0439466_0037428 | |||
| 903 | Ga0451845_0299746 | |||
| 904 | Ga0451847_0601085 | |||
| 905 | Ga0451851_0232026 | |||
| 906 | Ga0451853_2638751 | |||
| 907 | Ga0439431_0041950 | |||
| 908 | Ga0439432_048534 | |||
| 909 | Ga0439449_0007684 | |||
| 910 | Ga0439449_0025555 | |||
| 911 | Ga0439449_0031309 | |||
| 912 | Ga0439462_0021917 | |||
| 913 | Ga0450906_003965 | |||
| 914 | Ga0466963_0013780 | |||
| 915 | Ga0466970_0045160 | |||
| 916 | Ga0495592_0099673 | |||
| 917 | Ga0495590_0005422 | |||
| 918 | Ga0495629_0173323 | |||
| 919 | Ga0495638_0080656 | |||
| 920 | Ga0495585_0032892 | |||
| 921 | Ga0495607_0021613 | |||
| 922 | Ga0495606_0013862 | |||
| 923 | Ga0495610_0003473 | |||
| 924 | Ga0495632_0003903 | |||
| 925 | Ga0495648_0040268 | |||
| 926 | Ga0495663_0037240 | |||
| 927 | Ga0495652_0290885 | |||
| 928 | Ga0495654_0000143 | |||
| 929 | Ga0495640_0105301 | |||
| 930 | Ga0495587_0140742 | |||
| 931 | Ga0495621_0067290 | |||
| 932 | Ga0495656_0003093 | |||
| 933 | Ga0495656_0053137 | |||
| 934 | Ga0495588_0002054 | |||
| 935 | Ga0495657_0007569 | |||
| 936 | Ga0495646_0162066 | |||
| 937 | Ga0495658_0101250 | |||
| 938 | Ga0495649_0013067 | |||
| 939 | Ga0495600_0004789 | |||
| 940 | Ga0495680_0391003 | |||
| 941 | Ga0495687_012206 | |||
| 942 | Ga0495675_0317770 | |||
| 943 | Ga0495686_0001104 | |||
| 944 | Ga0495686_0065021 | |||
| 945 | Ga0495686_0097019 | |||
| 946 | Ga0495626_0022058 | |||
| 947 | Ga0496102_0017668 | |||
| 948 | Ga0496110_0163159 | |||
| 949 | Ga0496111_0004902 | |||
| 950 | Ga0496116_0000057 | |||
| 951 | Ga0496116_0009575 | |||
| 952 | Ga0496117_0001716 | |||
| 953 | Ga0496117_0013293 | |||
| 954 | Ga0496118_0014418 | |||
| 955 | Ga0496119_0024907 | |||
| 956 | Ga0496119_0032392 | |||
| 957 | Ga0496120_0023184 | |||
| 958 | Ga0496120_0043257 | |||
| 959 | Ga0496121_0000034 | |||
| 960 | Ga0496121_0000888 | |||
| 961 | Ga0496121_0016201 | |||
| 962 | Ga0496121_0017709 | |||
| 963 | Ga0496121_0018081 | |||
| 964 | Ga0496121_0055116 | |||
| 965 | Ga0496122_0000308 | |||
| 966 | Ga0496122_0001941 | |||
| 967 | Ga0496122_0008781 | |||
| 968 | Ga0496122_0089164 | |||
| 969 | Ga0496123_0000066 | |||
| 970 | Ga0496123_0013756 | |||
| 971 | Ga0496123_0050626 | |||
| 972 | Ga0496124_0000294 | |||
| 973 | Ga0496124_0001215 | |||
| 974 | Ga0496124_0005671 | |||
| 975 | Ga0496124_0016660 | |||
| 976 | Ga0496124_0041830 | |||
| 977 | Ga0496124_0125821 | |||
| 978 | Ga0496124_0202058 | |||
| 979 | Ga0496125_0000030 | |||
| 980 | Ga0496125_0000288 | |||
| 981 | Ga0496126_0000115 | |||
| 982 | Ga0496126_0000258 | |||
| 983 | Ga0496126_0027368 | |||
| 984 | Ga0496126_0079175 | |||
| 985 | Ga0495678_020781 | |||
| 986 | Ga0501031_0012275 | |||
| 987 | Ga0501032_0025600 | |||
| 988 | Ga0501032_0089601 | |||
| 989 | Ga0501033_0000293 | |||
| 990 | Ga0501033_0103712 | |||
| 991 | Ga0501033_0103999 | |||
| 992 | Ga0501033_0143698 | |||
| 993 | Ga0501033_0175645 | |||
| 994 | Ga0501034_0000702 | |||
| 995 | Ga0501034_0097002 | |||
| 996 | Ga0501036_0081432 | |||
| 997 | Ga0501036_0184911 | |||
| 998 | Ga0501037_0000007 | |||
| 999 | Ga0501037_0049865 | |||
| 1000 | Ga0501038_0163671 | |||
| 1001 | Ga0501038_0252931 | |||
| 1002 | Ga0501043_0000034 | |||
| 1003 | Ga0501043_0117934 | |||
| 1004 | Ga0501043_0119842 | |||
| 1005 | Ga0501046_0000241 | |||
| 1006 | Ga0501047_0053950 | |||
| 1007 | Ga0501067_0051112 | |||
| 1008 | Ga0501068_0148679 | |||
| 1009 | Ga0501069_0000017 | |||
| 1010 | Ga0501069_0052457 | |||
| 1011 | Ga0501069_0055997 | |||
| 1012 | Ga0501070_0001269 | |||
| 1013 | Ga0501070_0009951 | |||
| 1014 | Ga0501070_0101494 | |||
| 1015 | Ga0501070_0183761 | |||
| 1016 | Ga0501070_0186592 | |||
| 1017 | Ga0501070_0428024 | |||
| 1018 | Ga0501071_0003548 | |||
| 1019 | Ga0501073_0014200 | |||
| 1020 | Ga0501074_0000060 | |||
| 1021 | Ga0501076_0111779 | |||
| 1022 | Ga0501076_0399997 | |||
| 1023 | Ga0501080_0001013 | |||
| 1024 | Ga0501080_0072218 | |||
| 1025 | Ga0501083_0000511 | |||
| 1026 | Ga0501083_0064213 | |||
| 1027 | Ga0501241_014837 | |||
| 1028 | Ga0501280_002847 | |||
| 1029 | Ga0501035_0000159 | |||
| 1030 | Ga0501035_0000772 | |||
| 1031 | Ga0501035_0107540 | |||
| 1032 | Ga0501035_0258909 | |||
| 1033 | Ga0501044_0000010 | |||
| 1034 | Ga0501044_0013069 | |||
| 1035 | Ga0501044_0102271 | |||
| 1036 | Ga0501044_0103971 | |||
| 1037 | Ga0501044_0248726 | |||
| 1038 | nmdc:mga00v17_65314_c1 | |||
| 1039 | nmdc:mga00v17_89_c1 | |||
| 1040 | nmdc:mga0yw44_1851_c1 | |||
| 1041 | nmdc:mga04h51_3008_c1 | |||
| 1042 | nmdc:mga0sz30_62040_c1 | |||
| 1043 | Ga0495601_0037926 | |||
| 1044 | Ga0495612_0014539 | |||
| 1045 | Ga0500643_007497 | |||
| 1046 | Ga0500556_0032151 | |||
| 1047 | Ga0500557_003125 | |||
| 1048 | Ga0500560_006406 | |||
| 1049 | Ga0500594_0005292 | |||
| 1050 | Ga0500568_0044554 | |||
| 1051 | Ga0500573_0001866 | |||
| 1052 | Ga0500573_0010900 | |||
| 1053 | Ga0500588_0059056 | |||
| 1054 | Ga0500604_0028078 | |||
| 1055 | Ga0500616_0000448 | |||
| 1056 | Ga0500616_0079543 | |||
| 1057 | Ga0500620_000445 | |||
| 1058 | Ga0500622_0000169 | |||
| 1059 | Ga0500624_004046 | |||
| 1060 | Ga0500624_010039 | |||
| 1061 | Ga0500636_0000030 | |||
| 1062 | Ga0500636_0002620 | |||
| 1063 | Ga0587073_0011046 | |||
| 1064 | Ga0587106_015816 | |||
| 1065 | Ga0466962_0073795 | |||
| 1066 | 2509108871 | |||
| 1067 | 2509378001 | |||
| 1068 | 2510135410 | |||
| 1069 | 2510305812 | |||
| 1070 | 2511135854 | |||
| 1071 | 2511172503 | |||
| 1072 | 2511388934 | |||
| 1073 | 2511498578 | |||
| 1074 | 2512534727 | |||
| 1075 | 2512973461 | |||
| 1076 | 2513572891 | |||
| 1077 | 2513586374 | |||
| 1078 | 2513602022 | |||
| 1079 | 2513615811 | |||
| 1080 | 2513634926 | |||
| 1081 | 2513711513 | |||
| 1082 | 2513885377 | |||
| 1083 | 2513904646 | |||
| 1084 | 2513983476 | |||
| 1085 | 2513998289 | |||
| 1086 | 2514003380 | |||
| 1087 | 2514586796 | |||
| 1088 | 2515114582 | |||
| 1089 | 2515612442 | |||
| 1090 | 2516205683 | |||
| 1091 | 2516894855 | |||
| 1092 | 2517038225 | |||
| 1093 | 2517097242 | |||
| 1094 | 2517571536 | |||
| 1095 | 2524450328 | |||
| 1096 | 2524461175 | |||
| 1097 | 2551680660 | |||
| 1098 | 2551685164 | |||
| 1099 | 2551691054 | |||
| 1100 | 2551697616 | |||
| 1101 | 2551710788 | |||
| 1102 | 2551724586 | |||
| 1103 | 2551729196 | |||
| 1104 | 2551731311 | |||
| 1105 | 2551736228 | |||
| 1106 | 2551745950 | |||
| 1107 | 2558867497 | |||
| 1108 | 2585166516 | |||
| 1109 | 2585267162 | |||
| 1110 | 2585272056 | |||
| 1111 | 2585279640 | |||
| 1112 | 2585327478 | |||
| 1113 | 2585333985 | |||
| 1114 | 2585388213 | |||
| 1115 | 2585396190 | |||
| 1116 | 2585535720 | |||
| 1117 | 2585543015 | |||
| 1118 | 2585551097 | |||
| 1119 | 2585563399 | |||
| 1120 | 2585839216 | |||
| 1121 | 2585897179 | |||
| 1122 | 2585909094 | |||
| 1123 | 2585998065 | |||
| 1124 | 2586002645 | |||
| 1125 | 2587984508 | |||
| 1126 | 2599335758 | |||
| 1127 | 2599722627 | |||
| 1128 | 2600193963 | |||
| 1129 | 2600377431 | |||
| 1130 | 2616306428 | |||
| 1131 | 2616551084 | |||
| 1132 | 2617382317 | |||
| 1133 | 2643807951 | |||
| 1134 | 2643814834 | |||
| 1135 | 2643854825 | |||
| 1136 | 2644002634 | |||
| 1137 | 2644052430 | |||
| 1138 | 2644068858 | |||
| 1139 | 2644105774 | |||
| 1140 | 2644146342 | |||
| 1141 | 2644201187 | |||
| 1142 | 2644209655 | |||
| 1143 | 2644310387 | |||
| 1144 | 2644378416 | |||
| 1145 | 2644419929 | |||
| 1146 | 2644453285 | |||
| 1147 | 2644484708 | |||
| 1148 | 2644492567 | |||
| 1149 | 2644501229 | |||
| 1150 | 2644544978 | |||
| 1151 | 2644615372 | |||
| 1152 | 2644653183 | |||
| 1153 | 2644675084 | |||
| 1154 | 2644688688 | |||
| 1155 | 2657682320 | |||
| 1156 | 2671116038 | |||
| 1157 | 2671693662 | |||
| 1158 | 2692319851 | |||
| 1159 | 2720633484 | |||
| 1160 | 2720777182 | |||
| 1161 | 2723028780 | |||
| 1162 | 2723562393 | |||
| 1163 | 2723569089 | |||
| 1164 | 2724091789 | |||
| 1165 | 2724106354 | |||
| 1166 | 2725945772 | |||
| 1167 | 2730109716 | |||
| 1168 | 2738947088 | |||
| 1169 | 2739037711 | |||
| 1170 | 2753458490 | |||
| 1171 | 2757571002 | |||
| 1172 | 2766064093 | |||
| 1173 | 2776269672 | |||
| 1174 | 2776282601 | |||
| 1175 | 2778179210 | |||
| 1176 | 2792582330 | |||
| 1177 | 2792621818 | |||
| 1178 | 2792628924 | |||
| 1179 | 2792640065 | |||
| 1180 | 2793295472 | |||
| 1181 | 2793327448 | |||
| 1182 | 2802717098 | |||
| 1183 | 2802724914 | |||
| 1184 | 2802729664 | |||
| 1185 | 2802737010 | |||
| 1186 | 2802743415 | |||
| 1187 | 2802749459 | |||
| 1188 | 2804753786 | |||
| 1189 | 2805926366 | |||
| 1190 | 2805934092 | |||
| 1191 | 2806047745 | |||
| 1192 | 2806055321 | |||
| 1193 | 2806062202 | |||
| 1194 | 2806070039 | |||
| 1195 | 2806076661 | |||
| 1196 | 2819611965 | |||
| 1197 | 2819638495 | |||
| 1198 | 2821129218 | |||
| 1199 | 2838034109 | |||
| 1200 | 2838072287 | |||
| 1201 | 2838078073 | |||
| 1202 | 2838672319 | |||
| 1203 | 2838704812 | |||
| 1204 | 2838742156 | |||
| 1205 | 2840766262 | |||
| 1206 | 2841846012 | |||
| 1207 | 2842116587 | |||
| 1208 | 2842145623 | |||
| 1209 | 2842148952 | |||
| 1210 | 2842194727 | |||
| 1211 | 2842221948 | |||
| 1212 | 2842254492 | |||
| 1213 | 2842302619 | |||
| 1214 | 2842321263 | |||
| 1215 | 2842358879 | |||
| 1216 | 2842425919 | |||
| 1217 | 2842480923 | |||
| 1218 | 2842485273 | |||
| 1219 | 2842491331 | |||
| 1220 | 2842498654 | |||
| 1221 | 2842507466 | |||
| 1222 | 2842514700 | |||
| 1223 | 2842524688 | |||
| 1224 | 2842873866 | |||
| 1225 | 2842926454 | |||
| 1226 | 2847420925 | |||
| 1227 | 2848995757 | |||
| 1228 | 2850082742 | |||
| 1229 | 2852392096 | |||
| 1230 | 2854897722 | |||
| 1231 | 2854922301 | |||
| 1232 | 2855827489 | |||
| 1233 | 2855842864 | |||
| 1234 | 2855873621 | |||
| 1235 | 2857510999 | |||
| 1236 | 2857536159 | |||
| 1237 | 2858803542 | |||
| 1238 | 2874102738 | |||
| 1239 | 2889791561 | |||
| 1240 | 2889917306 | |||
| 1241 | 2891377801 | |||
| 1242 | 2894821019 | |||
| 1243 | 2896390099 | |||
| 1244 | 2909047520 | |||
| 1245 | 2913300233 | |||
| 1246 | 2913312083 | |||
| 1247 | 2915981723 | |||
| 1248 | 2915991930 | |||
| 1249 | 2915999577 | |||
| 1250 | 2916004485 | |||
| 1251 | 2916009091 | |||
| 1252 | 2916019855 | |||
| 1253 | 2916023921 | |||
| 1254 | 2916031846 | |||
| 1255 | 2916040487 | |||
| 1256 | 2916043420 | |||
| 1257 | 2916050655 | |||
| 1258 | 2916058681 | |||
| 1259 | 2916066494 | |||
| 1260 | 2916071000 | |||
| 1261 | 2916082563 | |||
| 1262 | 2919170461 | |||
| 1263 | 2919176895 | |||
| 1264 | 2919411444 | |||
| 1265 | 2920760230 | |||
| 1266 | 2920826046 | |||
| 1267 | 2921204777 | |||
| 1268 | 2921212040 | |||
| 1269 | 2921240366 | |||
| 1270 | 2921245641 | |||
| 1271 | 2921252812 | |||
| 1272 | 2921260451 | |||
| 1273 | 2921267535 | |||
| 1274 | 2921287342 | |||
| 1275 | 2921293970 | |||
| 1276 | 2921302585 | |||
| 1277 | 2924144799 | |||
| 1278 | 2924157650 | |||
| 1279 | 2924158792 | |||
| 1280 | 2924168536 | |||
| 1281 | 2924175788 | |||
| 1282 | 2924183477 | |||
| 1283 | 2924190224 | |||
| 1284 | 2924193495 | |||
| 1285 | 2924201436 | |||
| 1286 | 2924207780 | |||
| 1287 | 2924214900 | |||
| 1288 | 2924227123 | |||
| 1289 | 2924234046 | |||
| 1290 | 2928522889 | |||
| 1291 | 2929141999 | |||
| 1292 | 2933592807 | |||
| 1293 | 2933602861 | |||
| 1294 | 2936370069 | |||
| 1295 | 2936379245 | |||
| 1296 | 2936997426 | |||
| 1297 | 2937004110 | |||
| 1298 | 2937010353 | |||
| 1299 | 2937020655 | |||
| 1300 | 2937023186 | |||
| 1301 | 2937031735 | |||
| 1302 | 2937037802 | |||
| 1303 | 2937049574 | |||
| 1304 | 2937055196 | |||
| 1305 | 2937059101 | |||
| 1306 | 2937070489 | |||
| 1307 | 2937076127 | |||
| 1308 | 2937081480 | |||
| 1309 | 2937090888 | |||
| 1310 | 2937098492 | |||
| 1311 | 2937104337 | |||
| 1312 | 2937113234 | |||
| 1313 | 2937114234 | |||
| 1314 | 2937120232 | |||
| 1315 | 2937129787 | |||
| 1316 | 2941501469 | |||
| 1317 | 2954013745 | |||
| 1318 | 2957376802 | |||
| 1319 | 2957384931 | |||
| 1320 | 2957395206 | |||
| 1321 | 2957399699 | |||
| 1322 | 2957405557 | |||
| 1323 | 2957411722 | |||
| 1324 | 2957417479 | |||
| 1325 | 2957422356 | |||
| 1326 | 2957430070 | |||
| 1327 | 2957441660 | |||
| 1328 | 2957447629 | |||
| 1329 | 2957454687 | |||
| 1330 | 2957460990 | |||
| 1331 | 2957466517 | |||
| 1332 | 2957471401 | |||
| 1333 | 2957481461 | |||
| 1334 | 2957485525 | |||
| 1335 | 2957494443 | |||
| 1336 | 2957505182 | |||
| 1337 | 2957508258 | |||
| 1338 | 2960585192 | |||
| 1339 | 2960592790 | |||
| 1340 | 2960597907 | |||
| 1341 | 2960607499 | |||
| 1342 | 2960613687 | |||
| 1343 | 2960619101 | |||
| 1344 | 2960625372 | |||
| 1345 | 2960634187 | |||
| 1346 | 2960645373 | |||
| 1347 | 2960650696 | |||
| 1348 | 2960659198 | |||
| 1349 | 2960663990 | |||
| 1350 | 2960673279 | |||
| 1351 | 2960674892 | |||
| 1352 | 2960681715 | |||
| 1353 | 2960689345 | |||
| 1354 | 2960700641 | |||
| 1355 | 2964608235 | |||
| 1356 | 2964621596 | |||
| 1357 | 2964625821 | |||
| 1358 | 2964629524 | |||
| 1359 | 2964639213 | |||
| 1360 | 2964643618 | |||
| 1361 | 2964655222 | |||
| 1362 | 2964659969 | |||
| 1363 | 2964669390 | |||
| 1364 | 2964676876 | |||
| 1365 | 2964679597 | |||
| 1366 | 2964687443 | |||
| 1367 | 2964695132 | |||
| 1368 | 2964699150 | |||
| 1369 | 2964711213 | |||
| 1370 | 2964712669 | |||
| 1371 | 2964726759 | |||
| 1372 | 2967671078 | |||
| 1373 | 2967675597 | |||
| 1374 | 2967681238 | |||
| 1375 | 2967692437 | |||
| 1376 | 2967699389 | |||
| 1377 | 2967703207 | |||
| 1378 | 2967713809 | |||
| 1379 | 2967721186 | |||
| 1380 | 2967724972 | |||
| 1381 | 2967731822 | |||
| 1382 | 2967738453 | |||
| 1383 | 2967745450 | |||
| 1384 | 2967752626 | |||
| 1385 | 2967757737 | |||
| 1386 | 2967765806 | |||
| 1387 | 2967770356 | |||
| 1388 | 2967780525 | |||
| 1389 | 2970021979 | |||
| 1390 | 2970028688 | |||
| 1391 | 2970038993 | |||
| 1392 | 2970046589 | |||
| 1393 | 2970049634 | |||
| 1394 | 2970058846 | |||
| 1395 | 2970066770 | |||
| 1396 | 2970071164 | |||
| 1397 | 2970076728 | |||
| 1398 | 2970083983 | |||
| 1399 | 2970092753 | |||
| 1400 | 2970101161 | |||
| 1401 | 2970104621 | |||
| 1402 | 2970111073 | |||
| 1403 | 2970118364 | |||
| 1404 | 2970124517 | |||
| 1405 | 2970133532 | |||
| 1406 | 2970140903 | |||
| 1407 | 2970147325 | |||
| 1408 | 2970151740 | |||
| 1409 | 2970158669 | |||
| 1410 | 2970170765 | |||
| 1411 | 2970174098 | |||
| 1412 | 2970182128 | |||
| 1413 | 2970189149 | |||
| 1414 | 2970197923 | |||
| 1415 | 2977520198 | |||
| 1416 | 2977525112 | |||
| 1417 | 2977531190 | |||
| 1418 | 2977544480 | |||
| 1419 | 2977547159 | |||
| 1420 | 2977558022 | |||
| 1421 | 2977564733 | |||
| 1422 | 2977571302 | |||
| 1423 | 2977573824 | |||
| 1424 | 2977583353 | |||
| 1425 | 2977863111 | |||
| 1426 | 2978972743 | |||
| 1427 | 2984590995 | |||
| 1428 | 2989355064 | |||
| 1429 | 2996315332 | |||
| 1430 | 2996897074 | |||
| 1431 | 3000020586 | |||
| 1432 | 3005415951 | |||
| 1433 | 3005416896 | |||
| 1434 | 639650602 | |||
| 1435 | 648737298 | |||
| 1436 | 8003995445 | |||
| 1437 | 8004003204 | |||
| 1438 | 8004446890 | |||
| 1439 | 8005286586 | |||
| 1440 | 8005306116 | |||
| 1441 | 8005315900 | |||
| 1442 | 8005381401 | |||
| 1443 | 8005387613 | |||
| 1444 | 8005400645 | |||
| 1445 | 8005465277 | |||
| 1446 | 8005486987 | |||
| 1447 | 8005561342 | |||
| 1448 | 8005565964 | |||
| 1449 | 8005572013 | |||
| 1450 | 8005645184 | |||
| 1451 | 8005687370 | |||
| 1452 | 8005694187 | |||
| 1453 | 8018155010 | |||
| 1454 | 8018164921 | |||
| 1455 | 8024484539 | |||
| 1456 | 8024491005 | |||
| 1457 | 8024502163 | |||
| 1458 | 8046768379 | |||
| 1459 | 8049296387 | |||
| 1460 | 8054463883 | |||
| 1461 | 8055432891 | |||
| 1462 | 8056878350 | |||
| 1463 | 8057581952 | |||
| 1464 | 8057879458 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3cqb-assembly1.cif.gz_A | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.9044 | 70 | 140 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.8672 | 52 | 135 |
| 3cqb-assembly1.cif.gz_B | crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 | 0.7253 | 52 | 135 |
| 4hx3-assembly1.cif.gz_A | crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin | 0.6585 | 66 | 135 |
| 6sar-assembly1.cif.gz_A | e coli bepa/yfgc | 0.6268 | 40 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS5_62_152_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9795 | 58 | 141 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.957 | 59 | 147 | 3.30.2010.10 |
| af_Q59076_58_147_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9366 | 59 | 147 | 3.30.2010.10 |
| af_O53978_67_150_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9303 | 64 | 140 | 3.30.2010.10 |
| af_A0A1D6FHQ3_2_88_3.30.2010.10 | "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" | 0.9194 | 68 | 144 | 3.30.2010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528D7J6-F1-model_v4 | Protease HtpX | 0.9992 | 58 | 136 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A6B3I2P7-F1-model_v4 | M48 family metalloprotease | 0.982 | 51 | 140 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A2H0X7T0-F1-model_v4 | Peptidase M48 domain-containing protein | 0.9574 | 5 | 127 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A2N2D9Q8-F1-model_v4 | Protease HtpX | 0.9445 | 1 | 115 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |
| AF-A0A528D7J6-F1-model_v4 | Protease HtpX | 0.9398 | 58 | 136 |
GO:0004222
GO:0005886 GO:0006508 GO:0046872 |