F478035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 269 | 1464 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10451920|Ga0207661_104519203 |
| Length | 114 |
| Sequence | MNQRAQELHLAPAREGDSLRPMHRVIVLYEQEPDADSYAEHVEICKQVPGGIFRHGKVTGAPMGEPAHAYYAEWEFADQQAFDSAVRSEEFMASGKDAYKRGFPTPSVEFAEFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 72 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 78 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 118 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 120 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 122 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 123 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 124 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 128 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 131 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 133 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 134 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 137 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 138 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 139 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 142 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 143 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 144 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 146 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 147 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 148 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 149 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 153 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 154 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 155 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 156 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 161 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 162 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 168 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 169 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 227 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 228 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 252 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.08 |
| Metatranscriptomes | 4.92 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 12.3 |
| Rhizosphere | 87.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207661_10451920 | 3300025944 | Bacteria | 1170 |
| 2 | rootH2_10242497 | 3300003320 | Bacteria | 1356 |
| 3 | Ga0070658_10165264 | 3300005327 | Bacteria | 1858 |
| 4 | Ga0070658_10285233 | 3300005327 | Bacteria | 1406 |
| 5 | Ga0070658_10533998 | 3300005327 | Bacteria | 1014 |
| 6 | Ga0070658_10827512 | 3300005327 | Bacteria | 804 |
| 7 | Ga0070683_100057022 | 3300005329 | Bacteria | 3628 |
| 8 | Ga0070683_100502911 | 3300005329 | Bacteria | 1158 |
| 9 | Ga0070683_100644605 | 3300005329 | Unclassified | 1014 |
| 10 | Ga0070680_100797262 | 3300005336 | Bacteria | 814 |
| 11 | Ga0070680_101824412 | 3300005336 | Bacteria | 527 |
| 12 | Ga0070680_102004643 | 3300005336 | Unclassified | 502 |
| 13 | Ga0070682_100236095 | 3300005337 | Bacteria | 1310 |
| 14 | Ga0070682_101030193 | 3300005337 | Bacteria | 685 |
| 15 | Ga0068868_101402631 | 3300005338 | Bacteria | 652 |
| 16 | Ga0070660_100014749 | 3300005339 | Bacteria | 5637 |
| 17 | Ga0070660_100493382 | 3300005339 | Bacteria | 1018 |
| 18 | Ga0070660_100581076 | 3300005339 | Bacteria | 936 |
| 19 | Ga0070660_101291891 | 3300005339 | Bacteria | 619 |
| 20 | Ga0070691_10470561 | 3300005341 | Bacteria | 721 |
| 21 | Ga0070661_100102660 | 3300005344 | Bacteria | 2129 |
| 22 | Ga0070661_100850671 | 3300005344 | Bacteria | 751 |
| 23 | Ga0070671_100262684 | 3300005355 | Bacteria | 1467 |
| 24 | Ga0070673_100433353 | 3300005364 | Bacteria | 1180 |
| 25 | Ga0070659_100507150 | 3300005366 | Bacteria | 1029 |
| 26 | Ga0070667_102340795 | 3300005367 | Unclassified | 503 |
| 27 | Ga0070709_10009852 | 3300005434 | Bacteria | 5279 |
| 28 | Ga0070709_10119175 | 3300005434 | Bacteria | 1786 |
| 29 | Ga0070709_10610163 | 3300005434 | Unclassified | 841 |
| 30 | Ga0070709_11026629 | 3300005434 | Bacteria | 657 |
| 31 | Ga0070714_100009556 | 3300005435 | Bacteria | 7631 |
| 32 | Ga0070714_100013451 | 3300005435 | Bacteria | 6558 |
| 33 | Ga0070714_100016784 | 3300005435 | Bacteria | 5920 |
| 34 | Ga0070714_100091422 | 3300005435 | Bacteria | 2667 |
| 35 | Ga0070714_100464538 | 3300005435 | Bacteria | 1203 |
| 36 | Ga0070714_100680885 | 3300005435 | Bacteria | 991 |
| 37 | Ga0070714_100742323 | 3300005435 | Bacteria | 949 |
| 38 | Ga0070714_101623656 | 3300005435 | Bacteria | 632 |
| 39 | Ga0070713_100018202 | 3300005436 | Bacteria | 5337 |
| 40 | Ga0070713_100066952 | 3300005436 | Bacteria | 3022 |
| 41 | Ga0070713_100144307 | 3300005436 | Bacteria | 2111 |
| 42 | Ga0070713_100864383 | 3300005436 | Bacteria | 869 |
| 43 | Ga0070710_10004489 | 3300005437 | Bacteria | 6600 |
| 44 | Ga0070710_10015865 | 3300005437 | Bacteria | 3821 |
| 45 | Ga0070711_100009830 | 3300005439 | Bacteria | 5899 |
| 46 | Ga0070711_100103479 | 3300005439 | Bacteria | 2075 |
| 47 | Ga0070711_101961789 | 3300005439 | Bacteria | 515 |
| 48 | Ga0070711_101982945 | 3300005439 | Unclassified | 512 |
| 49 | Ga0070708_102163272 | 3300005445 | Unclassified | 514 |
| 50 | Ga0070663_100753443 | 3300005455 | Bacteria | 832 |
| 51 | Ga0070678_100387042 | 3300005456 | Bacteria | 1211 |
| 52 | Ga0070681_10122844 | 3300005458 | Bacteria | 2529 |
| 53 | Ga0070681_10263204 | 3300005458 | Bacteria | 1636 |
| 54 | Ga0070681_10325630 | 3300005458 | Bacteria | 1446 |
| 55 | Ga0070681_10455229 | 3300005458 | Bacteria | 1192 |
| 56 | Ga0070681_10691158 | 3300005458 | Bacteria | 936 |
| 57 | Ga0070681_11205607 | 3300005458 | Unclassified | 679 |
| 58 | Ga0070706_100444898 | 3300005467 | Bacteria | 1206 |
| 59 | Ga0070707_100027516 | 3300005468 | Bacteria | 5410 |
| 60 | Ga0070707_100437140 | 3300005468 | Bacteria | 1269 |
| 61 | Ga0070707_101899631 | 3300005468 | Unclassified | 563 |
| 62 | Ga0070698_100037982 | 3300005471 | Bacteria | 4964 |
| 63 | Ga0070698_100294250 | 3300005471 | Bacteria | 1555 |
| 64 | Ga0070698_100669878 | 3300005471 | Unclassified | 979 |
| 65 | Ga0070699_100059619 | 3300005518 | Bacteria | 3306 |
| 66 | Ga0070679_100273046 | 3300005530 | Bacteria | 1644 |
| 67 | Ga0070679_100366936 | 3300005530 | Bacteria | 1387 |
| 68 | Ga0070679_101106015 | 3300005530 | Bacteria | 737 |
| 69 | Ga0070679_101145457 | 3300005530 | Unclassified | 723 |
| 70 | Ga0070684_100023525 | 3300005535 | Bacteria | 5156 |
| 71 | Ga0070684_100077503 | 3300005535 | Bacteria | 2935 |
| 72 | Ga0070684_100475811 | 3300005535 | Bacteria | 1156 |
| 73 | Ga0070697_100417963 | 3300005536 | Bacteria | 1165 |
| 74 | Ga0070697_101070117 | 3300005536 | Unclassified | 717 |
| 75 | Ga0068853_100086737 | 3300005539 | Bacteria | 2745 |
| 76 | Ga0070695_100396879 | 3300005545 | Unclassified | 1045 |
| 77 | Ga0070695_100901717 | 3300005545 | Bacteria | 714 |
| 78 | Ga0070695_101009387 | 3300005545 | Unclassified | 677 |
| 79 | Ga0070696_100267827 | 3300005546 | Bacteria | 1298 |
| 80 | Ga0070665_100740264 | 3300005548 | Bacteria | 996 |
| 81 | Ga0070704_100027480 | 3300005549 | Bacteria | 3775 |
| 82 | Ga0068855_100949609 | 3300005563 | Bacteria | 906 |
| 83 | Ga0068855_101180815 | 3300005563 | Bacteria | 797 |
| 84 | Ga0068855_102335757 | 3300005563 | Unclassified | 535 |
| 85 | Ga0068856_100084012 | 3300005614 | Bacteria | 3162 |
| 86 | Ga0068856_102126569 | 3300005614 | Bacteria | 571 |
| 87 | Ga0068852_100235342 | 3300005616 | Bacteria | 1748 |
| 88 | Ga0068864_102691603 | 3300005618 | Bacteria | 503 |
| 89 | Ga0068866_10466455 | 3300005718 | Unclassified | 829 |
| 90 | Ga0068863_100334169 | 3300005841 | Bacteria | 1473 |
| 91 | Ga0068863_100683010 | 3300005841 | Bacteria | 1020 |
| 92 | Ga0068858_101934521 | 3300005842 | Bacteria | 583 |
| 93 | Ga0070717_10001309 | 3300006028 | Bacteria | 17038 |
| 94 | Ga0070717_10002987 | 3300006028 | Bacteria | 12039 |
| 95 | Ga0070717_10006721 | 3300006028 | Bacteria | 8483 |
| 96 | Ga0070717_10012873 | 3300006028 | Bacteria | 6388 |
| 97 | Ga0070717_10058761 | 3300006028 | Bacteria | 3180 |
| 98 | Ga0070715_10000128 | 3300006163 | Bacteria | 18010 |
| 99 | Ga0070716_100018752 | 3300006173 | Bacteria | 3608 |
| 100 | Ga0070716_100237638 | 3300006173 | Bacteria | 1234 |
| 101 | Ga0070716_100270202 | 3300006173 | Bacteria | 1168 |
| 102 | Ga0070716_101466096 | 3300006173 | Bacteria | 557 |
| 103 | Ga0070712_100046418 | 3300006175 | Bacteria | 3003 |
| 104 | Ga0070712_100139545 | 3300006175 | Bacteria | 1848 |
| 105 | Ga0070712_100369112 | 3300006175 | Bacteria | 1179 |
| 106 | Ga0070712_100625706 | 3300006175 | Bacteria | 913 |
| 107 | Ga0070712_100675348 | 3300006175 | Unclassified | 879 |
| 108 | Ga0070712_101444311 | 3300006175 | Bacteria | 601 |
| 109 | Ga0068871_100300373 | 3300006358 | Bacteria | 1409 |
| 110 | Ga0075433_10062389 | 3300006852 | Bacteria | 3264 |
| 111 | Ga0075434_100052927 | 3300006871 | Bacteria | 4034 |
| 112 | Ga0068865_100332247 | 3300006881 | Bacteria | 1226 |
| 113 | Ga0075436_100122419 | 3300006914 | Bacteria | 1821 |
| 114 | Ga0075436_100383296 | 3300006914 | Bacteria | 1017 |
| 115 | Ga0105240_10040447 | 3300009093 | Bacteria | 5962 |
| 116 | Ga0105240_11485853 | 3300009093 | Unclassified | 711 |
| 117 | Ga0111539_10435828 | 3300009094 | Bacteria | 1526 |
| 118 | Ga0105245_10056263 | 3300009098 | Bacteria | 3535 |
| 119 | Ga0105245_10360289 | 3300009098 | Bacteria | 1443 |
| 120 | Ga0105247_10444176 | 3300009101 | Bacteria | 933 |
| 121 | Ga0105243_12936970 | 3300009148 | Bacteria | 517 |
| 122 | Ga0105242_10945001 | 3300009176 | Bacteria | 866 |
| 123 | Ga0105248_10128263 | 3300009177 | Bacteria | 2862 |
| 124 | Ga0105248_10643864 | 3300009177 | Bacteria | 1196 |
| 125 | Ga0105237_10013009 | 3300009545 | Bacteria | 8739 |
| 126 | Ga0105238_10070118 | 3300009551 | Bacteria | 3505 |
| 127 | Ga0105238_10932210 | 3300009551 | Bacteria | 888 |
| 128 | Ga0105238_11429616 | 3300009551 | Bacteria | 719 |
| 129 | Ga0105239_12484029 | 3300010375 | Bacteria | 604 |
| 130 | Ga0157373_10747666 | 3300013100 | Bacteria | 719 |
| 131 | Ga0157373_10969027 | 3300013100 | Unclassified | 633 |
| 132 | Ga0157373_11321126 | 3300013100 | Unclassified | 546 |
| 133 | Ga0157370_10044813 | 3300013104 | Bacteria | 4248 |
| 134 | Ga0157370_10211925 | 3300013104 | Bacteria | 1795 |
| 135 | Ga0157370_10223079 | 3300013104 | Bacteria | 1746 |
| 136 | Ga0157369_10007929 | 3300013105 | Bacteria | 12209 |
| 137 | Ga0157369_10201450 | 3300013105 | Bacteria | 2089 |
| 138 | Ga0157369_10438060 | 3300013105 | Bacteria | 1354 |
| 139 | Ga0157369_12046922 | 3300013105 | Unclassified | 581 |
| 140 | Ga0157374_10015556 | 3300013296 | Bacteria | 6675 |
| 141 | Ga0163162_10378448 | 3300013306 | Bacteria | 1549 |
| 142 | Ga0157372_10090949 | 3300013307 | Bacteria | 3470 |
| 143 | Ga0157372_12158510 | 3300013307 | Bacteria | 640 |
| 144 | Ga0157372_12375241 | 3300013307 | Unclassified | 609 |
| 145 | Ga0157375_11465055 | 3300013308 | Unclassified | 805 |
| 146 | Ga0163163_10236022 | 3300014325 | Bacteria | 1878 |
| 147 | Ga0157380_10697635 | 3300014326 | Bacteria | 1019 |
| 148 | Ga0182008_10125148 | 3300014497 | Bacteria | 1279 |
| 149 | Ga0182008_10235020 | 3300014497 | Bacteria | 941 |
| 150 | Ga0182008_10278497 | 3300014497 | Bacteria | 870 |
| 151 | Ga0157377_10115554 | 3300014745 | Bacteria | 1619 |
| 152 | Ga0157377_10560323 | 3300014745 | Bacteria | 809 |
| 153 | Ga0157379_11642913 | 3300014968 | Bacteria | 628 |
| 154 | Ga0157379_12147933 | 3300014968 | Bacteria | 554 |
| 155 | Ga0157376_10135273 | 3300014969 | Bacteria | 2205 |
| 156 | Ga0157376_11127080 | 3300014969 | Bacteria | 811 |
| 157 | Ga0197907_10658307 | 3300020069 | Unclassified | 518 |
| 158 | Ga0197907_10930357 | 3300020069 | Unclassified | 911 |
| 159 | Ga0197907_11490104 | 3300020069 | Bacteria | 1278 |
| 160 | Ga0206356_10315597 | 3300020070 | Bacteria | 1824 |
| 161 | Ga0206356_10592217 | 3300020070 | Bacteria | 1043 |
| 162 | Ga0206356_11558539 | 3300020070 | Bacteria | 1069 |
| 163 | Ga0206354_11269589 | 3300020081 | Bacteria | 1403 |
| 164 | Ga0206354_11673090 | 3300020081 | Bacteria | 1059 |
| 165 | Ga0206353_10800247 | 3300020082 | Bacteria | 1024 |
| 166 | Ga0206353_11130274 | 3300020082 | Bacteria | 4920 |
| 167 | Ga0206353_11636931 | 3300020082 | Bacteria | 5725 |
| 168 | Ga0154015_1293283 | 3300020610 | Unclassified | 719 |
| 169 | Ga0224712_10029772 | 3300022467 | Bacteria | 1964 |
| 170 | Ga0224712_10241706 | 3300022467 | Unclassified | 832 |
| 171 | Ga0207692_10028233 | 3300025898 | Bacteria | 2651 |
| 172 | Ga0207692_10068704 | 3300025898 | Bacteria | 1859 |
| 173 | Ga0207692_10382714 | 3300025898 | Bacteria | 874 |
| 174 | Ga0207642_10393663 | 3300025899 | Unclassified | 827 |
| 175 | Ga0207710_10563866 | 3300025900 | Bacteria | 594 |
| 176 | Ga0207685_10001914 | 3300025905 | Bacteria | 4595 |
| 177 | Ga0207699_10033221 | 3300025906 | Bacteria | 2915 |
| 178 | Ga0207699_10102253 | 3300025906 | Bacteria | 1821 |
| 179 | Ga0207699_11080158 | 3300025906 | Bacteria | 594 |
| 180 | Ga0207705_10050078 | 3300025909 | Bacteria | 3006 |
| 181 | Ga0207705_10659118 | 3300025909 | Bacteria | 814 |
| 182 | Ga0207684_10211748 | 3300025910 | Bacteria | 1672 |
| 183 | Ga0207707_10039266 | 3300025912 | Bacteria | 4138 |
| 184 | Ga0207707_10156923 | 3300025912 | Bacteria | 1990 |
| 185 | Ga0207707_10181760 | 3300025912 | Bacteria | 1836 |
| 186 | Ga0207707_10372190 | 3300025912 | Bacteria | 1229 |
| 187 | Ga0207707_10443114 | 3300025912 | Bacteria | 1112 |
| 188 | Ga0207695_10221153 | 3300025913 | Bacteria | 1801 |
| 189 | Ga0207693_10001852 | 3300025915 | Bacteria | 18530 |
| 190 | Ga0207693_10002202 | 3300025915 | Bacteria | 16996 |
| 191 | Ga0207693_10261452 | 3300025915 | Bacteria | 1357 |
| 192 | Ga0207693_10387199 | 3300025915 | Bacteria | 1093 |
| 193 | Ga0207693_10392841 | 3300025915 | Bacteria | 1085 |
| 194 | Ga0207693_10609387 | 3300025915 | Bacteria | 850 |
| 195 | Ga0207693_11304383 | 3300025915 | Unclassified | 543 |
| 196 | Ga0207663_10003571 | 3300025916 | Bacteria | 7630 |
| 197 | Ga0207663_10006777 | 3300025916 | Bacteria | 5895 |
| 198 | Ga0207663_10364123 | 3300025916 | Bacteria | 1098 |
| 199 | Ga0207660_10065540 | 3300025917 | Bacteria | 2625 |
| 200 | Ga0207660_10543471 | 3300025917 | Bacteria | 945 |
| 201 | Ga0207660_10716263 | 3300025917 | Unclassified | 816 |
| 202 | Ga0207660_11482922 | 3300025917 | Unclassified | 548 |
| 203 | Ga0207657_10024027 | 3300025919 | Bacteria | 5659 |
| 204 | Ga0207657_10218386 | 3300025919 | Bacteria | 1528 |
| 205 | Ga0207657_10277518 | 3300025919 | Bacteria | 1331 |
| 206 | Ga0207657_10546189 | 3300025919 | Bacteria | 906 |
| 207 | Ga0207657_10589688 | 3300025919 | Bacteria | 868 |
| 208 | Ga0207649_10081336 | 3300025920 | Bacteria | 2097 |
| 209 | Ga0207652_10020914 | 3300025921 | Bacteria | 5395 |
| 210 | Ga0207652_10051514 | 3300025921 | Bacteria | 3529 |
| 211 | Ga0207652_10564496 | 3300025921 | Bacteria | 1022 |
| 212 | Ga0207652_10919581 | 3300025921 | Unclassified | 772 |
| 213 | Ga0207652_11875598 | 3300025921 | Bacteria | 505 |
| 214 | Ga0207646_10002470 | 3300025922 | Bacteria | 21835 |
| 215 | Ga0207646_10144468 | 3300025922 | Unclassified | 2144 |
| 216 | Ga0207646_10208876 | 3300025922 | Bacteria | 1763 |
| 217 | Ga0207687_10080371 | 3300025927 | Bacteria | 2353 |
| 218 | Ga0207687_10254123 | 3300025927 | Bacteria | 1398 |
| 219 | Ga0207700_10024718 | 3300025928 | Bacteria | 4161 |
| 220 | Ga0207700_10219661 | 3300025928 | Bacteria | 1610 |
| 221 | Ga0207700_10890208 | 3300025928 | Unclassified | 796 |
| 222 | Ga0207700_11171900 | 3300025928 | Bacteria | 686 |
| 223 | Ga0207700_11552531 | 3300025928 | Bacteria | 587 |
| 224 | Ga0207664_10004974 | 3300025929 | Bacteria | 9035 |
| 225 | Ga0207664_10025030 | 3300025929 | Bacteria | 4489 |
| 226 | Ga0207664_10036123 | 3300025929 | Bacteria | 3817 |
| 227 | Ga0207664_10090502 | 3300025929 | Bacteria | 2507 |
| 228 | Ga0207664_10148476 | 3300025929 | Bacteria | 1990 |
| 229 | Ga0207664_10155850 | 3300025929 | Bacteria | 1944 |
| 230 | Ga0207664_10183927 | 3300025929 | Bacteria | 1795 |
| 231 | Ga0207664_10291142 | 3300025929 | Bacteria | 1435 |
| 232 | Ga0207664_10317772 | 3300025929 | Bacteria | 1373 |
| 233 | Ga0207664_10455319 | 3300025929 | Bacteria | 1142 |
| 234 | Ga0207664_10475102 | 3300025929 | Bacteria | 1118 |
| 235 | Ga0207664_11058804 | 3300025929 | Unclassified | 726 |
| 236 | Ga0207644_10189502 | 3300025931 | Bacteria | 1616 |
| 237 | Ga0207690_10093928 | 3300025932 | Bacteria | 2127 |
| 238 | Ga0207686_10580547 | 3300025934 | Bacteria | 880 |
| 239 | Ga0207704_10267739 | 3300025938 | Bacteria | 1292 |
| 240 | Ga0207665_10001140 | 3300025939 | Bacteria | 17874 |
| 241 | Ga0207665_10184865 | 3300025939 | Bacteria | 1511 |
| 242 | Ga0207665_10781820 | 3300025939 | Bacteria | 754 |
| 243 | Ga0207711_10433726 | 3300025941 | Bacteria | 1223 |
| 244 | Ga0207661_10076588 | 3300025944 | Bacteria | 2748 |
| 245 | Ga0207661_10120352 | 3300025944 | Bacteria | 2234 |
| 246 | Ga0207661_11874339 | 3300025944 | Unclassified | 545 |
| 247 | Ga0207667_10382017 | 3300025949 | Bacteria | 1435 |
| 248 | Ga0207667_10582644 | 3300025949 | Bacteria | 1129 |
| 249 | Ga0207667_11464360 | 3300025949 | Bacteria | 655 |
| 250 | Ga0207640_11353799 | 3300025981 | Bacteria | 637 |
| 251 | Ga0207658_11960730 | 3300025986 | Unclassified | 533 |
| 252 | Ga0207639_11131418 | 3300026041 | Bacteria | 734 |
| 253 | Ga0207702_12515138 | 3300026078 | Unclassified | 501 |
| 254 | Ga0207683_11164028 | 3300026121 | Bacteria | 715 |
| 255 | Ga0207698_10094247 | 3300026142 | Bacteria | 2461 |
| 256 | Ga0207698_10921616 | 3300026142 | Bacteria | 882 |
| 257 | Ga0207698_12237236 | 3300026142 | Bacteria | 559 |
| 258 | Ga0207428_10321631 | 3300027907 | Bacteria | 1142 |
| 259 | Ga0268266_10643785 | 3300028379 | Bacteria | 1020 |
| 260 | Ga0265337_1037492 | 3300028556 | Bacteria | 1410 |
| 261 | Ga0265334_10150591 | 3300028573 | Bacteria | 821 |
| 262 | Ga0265318_10085108 | 3300028577 | Bacteria | 1166 |
| 263 | Ga0265336_10031965 | 3300028666 | Bacteria | 1634 |
| 264 | Ga0265336_10084073 | 3300028666 | Bacteria | 949 |
| 265 | Ga0265338_10003515 | 3300028800 | Bacteria | 21949 |
| 266 | Ga0265338_10005836 | 3300028800 | Bacteria | 15891 |
| 267 | Ga0265338_10270543 | 3300028800 | Bacteria | 1245 |
| 268 | Ga0265330_10020448 | 3300031235 | Bacteria | 3024 |
| 269 | Ga0265325_10130880 | 3300031241 | Bacteria | 1201 |
| 270 | Ga0265325_10235078 | 3300031241 | Unclassified | 834 |
| 271 | Ga0265329_10126386 | 3300031242 | Unclassified | 822 |
| 272 | Ga0265340_10207618 | 3300031247 | Unclassified | 880 |
| 273 | Ga0265339_10014897 | 3300031249 | Bacteria | 4675 |
| 274 | Ga0265339_10283430 | 3300031249 | Unclassified | 794 |
| 275 | Ga0265331_10044132 | 3300031250 | Bacteria | 2157 |
| 276 | Ga0265316_10110084 | 3300031344 | Bacteria | 2086 |
| 277 | Ga0265313_10121675 | 3300031595 | Bacteria | 1137 |
| 278 | Ga0265342_10139239 | 3300031712 | Bacteria | 1355 |
| 279 | Ga0373936_0092530 | 3300035113 | Bacteria | 1269 |
| 280 | Ga0373936_0242939 | 3300035113 | Bacteria | 803 |
| 281 | Ga0373939_0094469 | 3300035114 | Bacteria | 1016 |
| 282 | Ga0373945_0060945 | 3300035116 | Bacteria | 1408 |
| 283 | Ga0373954_0139041 | 3300035118 | Bacteria | 1184 |
| 284 | Ga0373954_0327090 | 3300035118 | Bacteria | 757 |
| 285 | Ga0373956_0276603 | 3300035119 | Bacteria | 799 |
| 286 | Ga0373960_0135159 | 3300035121 | Bacteria | 830 |
| 287 | Ga0373943_0007035 | 3300035170 | Bacteria | 5047 |
| 288 | Ga0373943_0912893 | 3300035170 | Bacteria | 525 |
| 289 | Ga0373946_0651163 | 3300035171 | Bacteria | 549 |
| 290 | Ga0373955_0894893 | 3300035172 | Bacteria | 546 |
| 291 | Ga0373924_0215326 | 3300035410 | Bacteria | 848 |
| 292 | Ga0373931_0016344 | 3300035691 | Bacteria | 3652 |
| 293 | Ga0373931_0777757 | 3300035691 | Bacteria | 637 |
| 294 | Ga0373935_0227728 | 3300035692 | Bacteria | 1297 |
| 295 | Ga0373935_1514840 | 3300035692 | Bacteria | 502 |
| 296 | Ga0373927_0309532 | 3300035695 | Bacteria | 1040 |
| 297 | Ga0373933_1102737 | 3300035724 | Bacteria | 523 |
| 298 | Ga0373933_1138113 | 3300035724 | Bacteria | 514 |
| 299 | Ga0373947_0012958 | 3300035725 | Bacteria | 4780 |
| 300 | Ga0373937_0918629 | 3300036401 | Bacteria | 824 |
| 301 | Ga0373937_1044691 | 3300036401 | Unclassified | 766 |
| 302 | Ga0373925_0001504 | 3300037068 | Bacteria | 19959 |
| 303 | Ga0373925_0931338 | 3300037068 | Bacteria | 716 |
| 304 | Ga0395899_0221288 | 3300037312 | Bacteria | 1311 |
| 305 | Ga0395899_0738319 | 3300037312 | Bacteria | 614 |
| 306 | Ga0395900_1014480 | 3300037418 | Bacteria | 749 |
| 307 | Ga0395900_1119187 | 3300037418 | Unclassified | 704 |
| 308 | Ga0395898_0026348 | 3300037466 | Bacteria | 5852 |
| 309 | Ga0395898_0303511 | 3300037466 | Bacteria | 1523 |
| 310 | Ga0395905_0263269 | 3300037471 | Bacteria | 1610 |
| 311 | Ga0395905_0805580 | 3300037471 | Bacteria | 842 |
| 312 | Ga0395901_0244976 | 3300038443 | Bacteria | 1869 |
| 313 | Ga0395901_0261248 | 3300038443 | Bacteria | 1802 |
| 314 | Ga0395901_1088225 | 3300038443 | Bacteria | 770 |
| 315 | Ga0451807_0172388 | 3300041486 | Unclassified | 671 |
| 316 | Ga0451853_2907895 | 3300041512 | Unclassified | 517 |
| 317 | Ga0451853_3352851 | 3300041512 | Bacteria | 508 |
| 318 | Ga0439459_0071253 | 3300042438 | Bacteria | 804 |
| 319 | Ga0466969_0001728 | 3300044656 | Bacteria | 11667 |
| 320 | Ga0466969_0014328 | 3300044656 | Bacteria | 4168 |
| 321 | Ga0466969_0289061 | 3300044656 | Bacteria | 742 |
| 322 | Ga0466969_0570390 | 3300044656 | Bacteria | 518 |
| 323 | Ga0466972_0003611 | 3300044658 | Bacteria | 7689 |
| 324 | Ga0466965_0022263 | 3300044683 | Bacteria | 3056 |
| 325 | Ga0466965_0024918 | 3300044683 | Bacteria | 2895 |
| 326 | Ga0466965_0057541 | 3300044683 | Bacteria | 1938 |
| 327 | Ga0466965_0074413 | 3300044683 | Bacteria | 1711 |
| 328 | Ga0466965_0371919 | 3300044683 | Unclassified | 786 |
| 329 | Ga0466966_0021143 | 3300044684 | Bacteria | 4273 |
| 330 | Ga0466966_0054866 | 3300044684 | Bacteria | 2524 |
| 331 | Ga0466966_0067455 | 3300044684 | Bacteria | 2247 |
| 332 | Ga0466966_0077354 | 3300044684 | Bacteria | 2076 |
| 333 | Ga0466966_0361168 | 3300044684 | Bacteria | 872 |
| 334 | Ga0466966_0376078 | 3300044684 | Bacteria | 853 |
| 335 | Ga0466966_1013604 | 3300044684 | Bacteria | 501 |
| 336 | Ga0466961_0012267 | 3300044693 | Bacteria | 5480 |
| 337 | Ga0466961_0012971 | 3300044693 | Bacteria | 5331 |
| 338 | Ga0466961_0020428 | 3300044693 | Bacteria | 4260 |
| 339 | Ga0466961_0052103 | 3300044693 | Bacteria | 2612 |
| 340 | Ga0466961_0248860 | 3300044693 | Bacteria | 1091 |
| 341 | Ga0466961_0273387 | 3300044693 | Bacteria | 1035 |
| 342 | Ga0466961_0790877 | 3300044693 | Bacteria | 566 |
| 343 | Ga0466963_0002677 | 3300044694 | Bacteria | 10032 |
| 344 | Ga0466963_0003734 | 3300044694 | Bacteria | 8764 |
| 345 | Ga0466963_0003889 | 3300044694 | Bacteria | 8623 |
| 346 | Ga0466963_0004523 | 3300044694 | Bacteria | 8096 |
| 347 | Ga0466963_0017986 | 3300044694 | Bacteria | 4410 |
| 348 | Ga0466963_0024454 | 3300044694 | Bacteria | 3846 |
| 349 | Ga0466963_0029057 | 3300044694 | Bacteria | 3555 |
| 350 | Ga0466963_0049994 | 3300044694 | Bacteria | 2766 |
| 351 | Ga0466963_0060809 | 3300044694 | Bacteria | 2524 |
| 352 | Ga0466963_0062243 | 3300044694 | Bacteria | 2496 |
| 353 | Ga0466963_0066702 | 3300044694 | Bacteria | 2414 |
| 354 | Ga0466963_0088349 | 3300044694 | Bacteria | 2108 |
| 355 | Ga0466963_0154117 | 3300044694 | Bacteria | 1596 |
| 356 | Ga0466963_0971554 | 3300044694 | Unclassified | 598 |
| 357 | Ga0466963_1141781 | 3300044694 | Unclassified | 548 |
| 358 | Ga0466964_0000362 | 3300044706 | Bacteria | 13664 |
| 359 | Ga0466964_0003274 | 3300044706 | Bacteria | 5892 |
| 360 | Ga0466964_0005636 | 3300044706 | Bacteria | 4653 |
| 361 | Ga0466964_0013029 | 3300044706 | Bacteria | 3150 |
| 362 | Ga0466964_0021996 | 3300044706 | Bacteria | 2470 |
| 363 | Ga0466964_0049083 | 3300044706 | Bacteria | 1727 |
| 364 | Ga0466964_0054016 | 3300044706 | Bacteria | 1655 |
| 365 | Ga0466964_0057899 | 3300044706 | Bacteria | 1605 |
| 366 | Ga0466964_0121606 | 3300044706 | Bacteria | 1178 |
| 367 | Ga0466964_0152791 | 3300044706 | Bacteria | 1072 |
| 368 | Ga0466964_0614159 | 3300044706 | Bacteria | 598 |
| 369 | Ga0466964_0870461 | 3300044706 | Bacteria | 513 |
| 370 | Ga0466971_0004244 | 3300044719 | Bacteria | 6178 |
| 371 | Ga0466971_0007535 | 3300044719 | Bacteria | 4743 |
| 372 | Ga0466971_0015897 | 3300044719 | Bacteria | 3316 |
| 373 | Ga0466971_0039481 | 3300044719 | Bacteria | 2118 |
| 374 | Ga0466971_0088107 | 3300044719 | Bacteria | 1419 |
| 375 | Ga0466971_0094646 | 3300044719 | Bacteria | 1369 |
| 376 | Ga0466971_0167875 | 3300044719 | Bacteria | 1029 |
| 377 | Ga0466971_0259356 | 3300044719 | Bacteria | 829 |
| 378 | Ga0466968_0003489 | 3300044735 | Bacteria | 5814 |
| 379 | Ga0466968_0004050 | 3300044735 | Bacteria | 5450 |
| 380 | Ga0466968_0015982 | 3300044735 | Bacteria | 2982 |
| 381 | Ga0466968_0061187 | 3300044735 | Bacteria | 1624 |
| 382 | Ga0466968_0173043 | 3300044735 | Bacteria | 1001 |
| 383 | Ga0466968_0339798 | 3300044735 | Bacteria | 728 |
| 384 | Ga0466970_0006773 | 3300044765 | Bacteria | 5734 |
| 385 | Ga0466970_0011420 | 3300044765 | Bacteria | 4527 |
| 386 | Ga0466970_0161314 | 3300044765 | Unclassified | 1240 |
| 387 | Ga0466970_0742370 | 3300044765 | Bacteria | 573 |
| 388 | Ga0466957_0002871 | 3300044842 | Bacteria | 9333 |
| 389 | Ga0466957_0022414 | 3300044842 | Bacteria | 3727 |
| 390 | Ga0466957_0027711 | 3300044842 | Bacteria | 3368 |
| 391 | Ga0466957_0063359 | 3300044842 | Bacteria | 2272 |
| 392 | Ga0466957_0082741 | 3300044842 | Bacteria | 2001 |
| 393 | Ga0466957_0089088 | 3300044842 | Bacteria | 1931 |
| 394 | Ga0466957_0177289 | 3300044842 | Bacteria | 1390 |
| 395 | Ga0466957_0221439 | 3300044842 | Bacteria | 1249 |
| 396 | Ga0466957_0243526 | 3300044842 | Bacteria | 1194 |
| 397 | Ga0466957_0255640 | 3300044842 | Bacteria | 1166 |
| 398 | Ga0466960_0003431 | 3300044901 | Bacteria | 6095 |
| 399 | Ga0466960_0007474 | 3300044901 | Bacteria | 4441 |
| 400 | Ga0466960_0264269 | 3300044901 | Bacteria | 960 |
| 401 | Ga0466960_0476464 | 3300044901 | Bacteria | 728 |
| 402 | Ga0466959_0015151 | 3300045049 | Bacteria | 5614 |
| 403 | Ga0466959_0028595 | 3300045049 | Bacteria | 4133 |
| 404 | Ga0466959_0045372 | 3300045049 | Bacteria | 3236 |
| 405 | Ga0466959_0047599 | 3300045049 | Bacteria | 3153 |
| 406 | Ga0466959_0098424 | 3300045049 | Bacteria | 2096 |
| 407 | Ga0466959_0108746 | 3300045049 | Bacteria | 1980 |
| 408 | Ga0466959_0200013 | 3300045049 | Bacteria | 1391 |
| 409 | Ga0466959_0247458 | 3300045049 | Bacteria | 1230 |
| 410 | Ga0466959_0291873 | 3300045049 | Bacteria | 1118 |
| 411 | Ga0466959_0654105 | 3300045049 | Bacteria | 705 |
| 412 | Ga0466958_0005502 | 3300045836 | Bacteria | 6830 |
| 413 | Ga0466958_0010539 | 3300045836 | Bacteria | 5180 |
| 414 | Ga0466958_0019328 | 3300045836 | Bacteria | 3965 |
| 415 | Ga0466958_0023800 | 3300045836 | Bacteria | 3599 |
| 416 | Ga0466958_0037277 | 3300045836 | Bacteria | 2913 |
| 417 | Ga0466958_0065093 | 3300045836 | Bacteria | 2224 |
| 418 | Ga0466958_0159614 | 3300045836 | Bacteria | 1424 |
| 419 | Ga0466958_0211253 | 3300045836 | Bacteria | 1236 |
| 420 | Ga0466958_0224876 | 3300045836 | Bacteria | 1198 |
| 421 | Ga0466958_0683554 | 3300045836 | Bacteria | 668 |
| 422 | Ga0466967_0000588 | 3300045976 | Bacteria | 17992 |
| 423 | Ga0466967_0002741 | 3300045976 | Bacteria | 11144 |
| 424 | Ga0466967_0009087 | 3300045976 | Bacteria | 7349 |
| 425 | Ga0466967_0011112 | 3300045976 | Bacteria | 6801 |
| 426 | Ga0466967_0015563 | 3300045976 | Bacteria | 5966 |
| 427 | Ga0466967_0015869 | 3300045976 | Bacteria | 5920 |
| 428 | Ga0466967_0024931 | 3300045976 | Bacteria | 4924 |
| 429 | Ga0466967_0025315 | 3300045976 | Bacteria | 4891 |
| 430 | Ga0466967_0041434 | 3300045976 | Bacteria | 3970 |
| 431 | Ga0466967_0066511 | 3300045976 | Bacteria | 3212 |
| 432 | Ga0466967_0069791 | 3300045976 | Bacteria | 3141 |
| 433 | Ga0466967_0086823 | 3300045976 | Bacteria | 2835 |
| 434 | Ga0466967_0089734 | 3300045976 | Bacteria | 2791 |
| 435 | Ga0466967_0118182 | 3300045976 | Bacteria | 2445 |
| 436 | Ga0466967_0144935 | 3300045976 | Bacteria | 2215 |
| 437 | Ga0466967_0153955 | 3300045976 | Bacteria | 2151 |
| 438 | Ga0466967_0171971 | 3300045976 | Bacteria | 2039 |
| 439 | Ga0466967_0277610 | 3300045976 | Bacteria | 1607 |
| 440 | Ga0466967_0367674 | 3300045976 | Bacteria | 1394 |
| 441 | Ga0466967_0384811 | 3300045976 | Bacteria | 1362 |
| 442 | Ga0466967_0527439 | 3300045976 | Bacteria | 1161 |
| 443 | Ga0466967_0533931 | 3300045976 | Bacteria | 1153 |
| 444 | Ga0466967_0636014 | 3300045976 | Bacteria | 1054 |
| 445 | Ga0466967_0866785 | 3300045976 | Bacteria | 897 |
| 446 | Ga0495592_0073320 | 3300046454 | Bacteria | 2490 |
| 447 | Ga0495592_0108898 | 3300046454 | Bacteria | 1963 |
| 448 | Ga0495603_0361147 | 3300046455 | Bacteria | 833 |
| 449 | Ga0495629_0052079 | 3300046459 | Bacteria | 2864 |
| 450 | Ga0495629_0122416 | 3300046459 | Bacteria | 1812 |
| 451 | Ga0495629_0191158 | 3300046459 | Bacteria | 1417 |
| 452 | Ga0495629_0227609 | 3300046459 | Bacteria | 1285 |
| 453 | Ga0495629_0434542 | 3300046459 | Unclassified | 890 |
| 454 | Ga0495629_0686604 | 3300046459 | Bacteria | 680 |
| 455 | Ga0495629_1141041 | 3300046459 | Unclassified | 502 |
| 456 | Ga0495641_0006277 | 3300046461 | Bacteria | 7736 |
| 457 | Ga0495641_0050149 | 3300046461 | Bacteria | 1908 |
| 458 | Ga0495641_0539589 | 3300046461 | Bacteria | 532 |
| 459 | Ga0495651_0371533 | 3300046462 | Bacteria | 940 |
| 460 | Ga0495651_0475908 | 3300046462 | Bacteria | 803 |
| 461 | Ga0495653_0025246 | 3300046463 | Bacteria | 4780 |
| 462 | Ga0495653_0202250 | 3300046463 | Bacteria | 1347 |
| 463 | Ga0495653_0447987 | 3300046463 | Bacteria | 812 |
| 464 | Ga0495580_0056079 | 3300046472 | Bacteria | 2775 |
| 465 | Ga0495580_0188810 | 3300046472 | Bacteria | 1422 |
| 466 | Ga0495580_0331796 | 3300046472 | Bacteria | 1033 |
| 467 | Ga0495582_0042259 | 3300046473 | Bacteria | 2511 |
| 468 | Ga0495582_0061754 | 3300046473 | Bacteria | 2069 |
| 469 | Ga0495582_0304955 | 3300046473 | Bacteria | 915 |
| 470 | Ga0495639_0020866 | 3300046475 | Bacteria | 2864 |
| 471 | Ga0495639_0056907 | 3300046475 | Bacteria | 1786 |
| 472 | Ga0495662_0007094 | 3300046476 | Bacteria | 5560 |
| 473 | Ga0495662_0061466 | 3300046476 | Bacteria | 1815 |
| 474 | Ga0495662_0080368 | 3300046476 | Bacteria | 1585 |
| 475 | Ga0495664_0021631 | 3300046477 | Bacteria | 3715 |
| 476 | Ga0495664_0122215 | 3300046477 | Bacteria | 1574 |
| 477 | Ga0495664_0278092 | 3300046477 | Bacteria | 1011 |
| 478 | Ga0495664_0480821 | 3300046477 | Bacteria | 742 |
| 479 | Ga0495594_0103095 | 3300046499 | Bacteria | 1606 |
| 480 | Ga0495608_0016503 | 3300046511 | Bacteria | 5110 |
| 481 | Ga0495608_0099298 | 3300046511 | Bacteria | 1878 |
| 482 | Ga0495608_0372475 | 3300046511 | Bacteria | 876 |
| 483 | Ga0495618_0034424 | 3300046514 | Bacteria | 3176 |
| 484 | Ga0495618_0038952 | 3300046514 | Bacteria | 2988 |
| 485 | Ga0495618_0293207 | 3300046514 | Bacteria | 1012 |
| 486 | Ga0495618_0854013 | 3300046514 | Bacteria | 527 |
| 487 | Ga0495628_1128810 | 3300046516 | Bacteria | 534 |
| 488 | Ga0495630_0009985 | 3300046517 | Bacteria | 6834 |
| 489 | Ga0495630_0109104 | 3300046517 | Bacteria | 2096 |
| 490 | Ga0495630_0146692 | 3300046517 | Bacteria | 1794 |
| 491 | Ga0495630_0294754 | 3300046517 | Bacteria | 1239 |
| 492 | Ga0495630_0513796 | 3300046517 | Bacteria | 918 |
| 493 | Ga0495630_1081934 | 3300046517 | Bacteria | 608 |
| 494 | Ga0495666_0002192 | 3300046526 | Bacteria | 9732 |
| 495 | Ga0495666_0307118 | 3300046526 | Bacteria | 717 |
| 496 | Ga0495652_0093805 | 3300046529 | Bacteria | 2450 |
| 497 | Ga0495652_0196150 | 3300046529 | Bacteria | 1536 |
| 498 | Ga0495652_0575785 | 3300046529 | Bacteria | 771 |
| 499 | Ga0495665_0034830 | 3300046531 | Bacteria | 2692 |
| 500 | Ga0495665_0438578 | 3300046531 | Bacteria | 661 |
| 501 | Ga0495640_0011544 | 3300046533 | Bacteria | 6792 |
| 502 | Ga0495640_0050437 | 3300046533 | Bacteria | 2866 |
| 503 | Ga0495640_0239619 | 3300046533 | Bacteria | 1139 |
| 504 | Ga0495640_0703054 | 3300046533 | Bacteria | 606 |
| 505 | Ga0495586_0008595 | 3300046535 | Bacteria | 5436 |
| 506 | Ga0495586_0091657 | 3300046535 | Bacteria | 1679 |
| 507 | Ga0495587_0321404 | 3300046536 | Bacteria | 864 |
| 508 | Ga0495645_0012102 | 3300046543 | Bacteria | 6078 |
| 509 | Ga0495645_0182910 | 3300046543 | Bacteria | 1434 |
| 510 | Ga0495645_0477492 | 3300046543 | Bacteria | 782 |
| 511 | Ga0495622_0338950 | 3300046557 | Bacteria | 652 |
| 512 | Ga0495667_0013950 | 3300046559 | Bacteria | 5426 |
| 513 | Ga0495667_0154158 | 3300046559 | Bacteria | 1479 |
| 514 | Ga0495667_0386974 | 3300046559 | Bacteria | 882 |
| 515 | Ga0495667_0511884 | 3300046559 | Bacteria | 751 |
| 516 | Ga0495667_0745733 | 3300046559 | Bacteria | 605 |
| 517 | Ga0495634_0049928 | 3300046642 | Bacteria | 2811 |
| 518 | Ga0495634_0150508 | 3300046642 | Bacteria | 1472 |
| 519 | Ga0495634_0184963 | 3300046642 | Bacteria | 1302 |
| 520 | Ga0495634_0418794 | 3300046642 | Bacteria | 794 |
| 521 | Ga0495635_0029691 | 3300046663 | Bacteria | 3803 |
| 522 | Ga0495635_0075934 | 3300046663 | Bacteria | 2302 |
| 523 | Ga0495635_0207804 | 3300046663 | Bacteria | 1326 |
| 524 | Ga0495635_0309489 | 3300046663 | Bacteria | 1058 |
| 525 | Ga0495657_0072837 | 3300046675 | Bacteria | 2240 |
| 526 | Ga0495657_0204335 | 3300046675 | Bacteria | 1203 |
| 527 | Ga0495657_0258318 | 3300046675 | Bacteria | 1047 |
| 528 | Ga0495599_0350691 | 3300046678 | Bacteria | 885 |
| 529 | Ga0495623_0121914 | 3300046679 | Bacteria | 1569 |
| 530 | Ga0495646_0097623 | 3300046680 | Bacteria | 1688 |
| 531 | Ga0495646_0170128 | 3300046680 | Bacteria | 1201 |
| 532 | Ga0495647_0003731 | 3300046681 | Bacteria | 4892 |
| 533 | Ga0495647_0018568 | 3300046681 | Bacteria | 2478 |
| 534 | Ga0495647_0091281 | 3300046681 | Bacteria | 1249 |
| 535 | Ga0495647_0419902 | 3300046681 | Bacteria | 616 |
| 536 | Ga0495658_0004658 | 3300046683 | Bacteria | 6747 |
| 537 | Ga0495658_0030384 | 3300046683 | Bacteria | 2933 |
| 538 | Ga0495658_0161638 | 3300046683 | Bacteria | 1382 |
| 539 | Ga0495658_0305137 | 3300046683 | Bacteria | 1007 |
| 540 | Ga0495613_0008663 | 3300046689 | Bacteria | 7544 |
| 541 | Ga0495613_0014645 | 3300046689 | Bacteria | 5819 |
| 542 | Ga0495613_0180533 | 3300046689 | Bacteria | 1495 |
| 543 | Ga0495613_0250234 | 3300046689 | Bacteria | 1237 |
| 544 | Ga0495613_0661285 | 3300046689 | Bacteria | 690 |
| 545 | Ga0495624_0009082 | 3300046690 | Bacteria | 6897 |
| 546 | Ga0495624_0011507 | 3300046690 | Bacteria | 6082 |
| 547 | Ga0495624_0269582 | 3300046690 | Bacteria | 1028 |
| 548 | Ga0495600_0272767 | 3300046809 | Bacteria | 1073 |
| 549 | Ga0495600_0438966 | 3300046809 | Bacteria | 808 |
| 550 | Ga0495581_0035967 | 3300047315 | Bacteria | 2864 |
| 551 | Ga0495581_0038666 | 3300047315 | Bacteria | 2761 |
| 552 | Ga0495604_0047389 | 3300047317 | Bacteria | 3347 |
| 553 | Ga0495674_0045748 | 3300047319 | Bacteria | 3886 |
| 554 | Ga0495674_0189757 | 3300047319 | Bacteria | 1708 |
| 555 | Ga0495674_0228725 | 3300047319 | Bacteria | 1535 |
| 556 | Ga0495674_0337305 | 3300047319 | Bacteria | 1225 |
| 557 | Ga0495674_1054738 | 3300047319 | Bacteria | 620 |
| 558 | Ga0495676_0064384 | 3300047321 | Bacteria | 2852 |
| 559 | Ga0495676_0160742 | 3300047321 | Bacteria | 1589 |
| 560 | Ga0495676_0228331 | 3300047321 | Bacteria | 1279 |
| 561 | Ga0495676_0387244 | 3300047321 | Bacteria | 929 |
| 562 | Ga0495676_0437261 | 3300047321 | Bacteria | 864 |
| 563 | Ga0495680_0040915 | 3300047322 | Bacteria | 3689 |
| 564 | Ga0495680_0747687 | 3300047322 | Bacteria | 642 |
| 565 | Ga0495680_0804760 | 3300047322 | Bacteria | 613 |
| 566 | Ga0495675_0364802 | 3300047444 | Bacteria | 847 |
| 567 | Ga0495684_0009525 | 3300047471 | Bacteria | 7489 |
| 568 | Ga0495684_0329508 | 3300047471 | Bacteria | 1089 |
| 569 | Ga0495684_0518665 | 3300047471 | Bacteria | 816 |
| 570 | Ga0495593_0004077 | 3300047673 | Bacteria | 8694 |
| 571 | Ga0495602_0659198 | 3300048088 | Unclassified | 714 |
| 572 | Ga0495602_0831243 | 3300048088 | Bacteria | 618 |
| 573 | Ga0495614_0000498 | 3300048089 | Bacteria | 16038 |
| 574 | Ga0496100_0045112 | 3300048903 | Bacteria | 2827 |
| 575 | Ga0496100_0190339 | 3300048903 | Bacteria | 1489 |
| 576 | Ga0496100_0296896 | 3300048903 | Bacteria | 1208 |
| 577 | Ga0496100_0525238 | 3300048903 | Bacteria | 914 |
| 578 | Ga0496101_0012681 | 3300048904 | Bacteria | 5632 |
| 579 | Ga0496101_0100887 | 3300048904 | Bacteria | 2160 |
| 580 | Ga0496101_0102518 | 3300048904 | Bacteria | 2143 |
| 581 | Ga0496101_0133926 | 3300048904 | Bacteria | 1884 |
| 582 | Ga0496101_0576261 | 3300048904 | Bacteria | 890 |
| 583 | Ga0496102_0002973 | 3300048905 | Bacteria | 14352 |
| 584 | Ga0496102_0021317 | 3300048905 | Bacteria | 5731 |
| 585 | Ga0496102_0501193 | 3300048905 | Bacteria | 1136 |
| 586 | Ga0496102_0653637 | 3300048905 | Unclassified | 974 |
| 587 | Ga0496102_1224726 | 3300048905 | Bacteria | 670 |
| 588 | Ga0496103_0004486 | 3300048906 | Bacteria | 8462 |
| 589 | Ga0496103_0072165 | 3300048906 | Bacteria | 2162 |
| 590 | Ga0496103_0218232 | 3300048906 | Bacteria | 1227 |
| 591 | Ga0496104_0076644 | 3300048907 | Bacteria | 3185 |
| 592 | Ga0496104_0109420 | 3300048907 | Bacteria | 2648 |
| 593 | Ga0496104_0136307 | 3300048907 | Bacteria | 2358 |
| 594 | Ga0496104_0258407 | 3300048907 | Bacteria | 1655 |
| 595 | Ga0496104_0399366 | 3300048907 | Bacteria | 1287 |
| 596 | Ga0496104_0550489 | 3300048907 | Bacteria | 1064 |
| 597 | Ga0496104_0741538 | 3300048907 | Unclassified | 889 |
| 598 | Ga0496105_0009379 | 3300048908 | Bacteria | 7653 |
| 599 | Ga0496105_0043138 | 3300048908 | Bacteria | 3720 |
| 600 | Ga0496105_0060934 | 3300048908 | Bacteria | 3113 |
| 601 | Ga0496105_0126362 | 3300048908 | Bacteria | 2108 |
| 602 | Ga0496105_0206200 | 3300048908 | Bacteria | 1603 |
| 603 | Ga0496105_0239651 | 3300048908 | Bacteria | 1472 |
| 604 | Ga0496106_0012999 | 3300048909 | Bacteria | 6141 |
| 605 | Ga0496106_0013479 | 3300048909 | Bacteria | 6035 |
| 606 | Ga0496107_0003330 | 3300048910 | Bacteria | 10741 |
| 607 | Ga0496107_0010143 | 3300048910 | Bacteria | 6534 |
| 608 | Ga0496107_0047369 | 3300048910 | Bacteria | 3096 |
| 609 | Ga0496107_0058346 | 3300048910 | Bacteria | 2791 |
| 610 | Ga0496107_0099906 | 3300048910 | Bacteria | 2127 |
| 611 | Ga0496108_0009721 | 3300048911 | Bacteria | 7796 |
| 612 | Ga0496108_0021737 | 3300048911 | Bacteria | 5275 |
| 613 | Ga0496108_0092303 | 3300048911 | Bacteria | 2574 |
| 614 | Ga0496108_0196326 | 3300048911 | Bacteria | 1750 |
| 615 | Ga0496108_0234569 | 3300048911 | Bacteria | 1596 |
| 616 | Ga0496108_0729214 | 3300048911 | Bacteria | 858 |
| 617 | Ga0496108_1160509 | 3300048911 | Unclassified | 654 |
| 618 | Ga0496109_0010257 | 3300048912 | Bacteria | 7999 |
| 619 | Ga0496109_0030220 | 3300048912 | Bacteria | 4856 |
| 620 | Ga0496109_0033814 | 3300048912 | Bacteria | 4601 |
| 621 | Ga0496109_0089545 | 3300048912 | Bacteria | 2845 |
| 622 | Ga0496109_0497685 | 3300048912 | Bacteria | 1150 |
| 623 | Ga0496109_0917993 | 3300048912 | Bacteria | 814 |
| 624 | Ga0496109_1241211 | 3300048912 | Bacteria | 682 |
| 625 | Ga0496109_1970183 | 3300048912 | Unclassified | 516 |
| 626 | Ga0496109_2053631 | 3300048912 | Unclassified | 503 |
| 627 | Ga0496110_0008688 | 3300048913 | Bacteria | 8180 |
| 628 | Ga0496110_0048826 | 3300048913 | Bacteria | 3711 |
| 629 | Ga0496110_0124504 | 3300048913 | Bacteria | 2325 |
| 630 | Ga0496110_0238380 | 3300048913 | Bacteria | 1655 |
| 631 | Ga0496111_0002119 | 3300048914 | Bacteria | 11851 |
| 632 | Ga0496111_0215291 | 3300048914 | Bacteria | 1427 |
| 633 | Ga0496111_0407579 | 3300048914 | Bacteria | 1004 |
| 634 | Ga0496111_0644509 | 3300048914 | Bacteria | 773 |
| 635 | Ga0496111_0730300 | 3300048914 | Bacteria | 719 |
| 636 | Ga0496112_0009795 | 3300048915 | Bacteria | 8654 |
| 637 | Ga0496112_0067812 | 3300048915 | Bacteria | 3522 |
| 638 | Ga0496112_0134055 | 3300048915 | Bacteria | 2447 |
| 639 | Ga0496112_0134105 | 3300048915 | Bacteria | 2447 |
| 640 | Ga0496112_0162668 | 3300048915 | Bacteria | 2198 |
| 641 | Ga0496112_0255638 | 3300048915 | Bacteria | 1702 |
| 642 | Ga0496112_0293270 | 3300048915 | Bacteria | 1572 |
| 643 | Ga0496112_0389840 | 3300048915 | Bacteria | 1333 |
| 644 | Ga0496112_0651205 | 3300048915 | Bacteria | 983 |
| 645 | Ga0496112_0889194 | 3300048915 | Bacteria | 813 |
| 646 | Ga0496113_0020361 | 3300048916 | Bacteria | 4662 |
| 647 | Ga0496113_0145329 | 3300048916 | Bacteria | 1868 |
| 648 | Ga0496113_0540277 | 3300048916 | Bacteria | 935 |
| 649 | Ga0496113_0849194 | 3300048916 | Bacteria | 724 |
| 650 | Ga0496113_1247083 | 3300048916 | Bacteria | 579 |
| 651 | Ga0496114_0003302 | 3300048917 | Bacteria | 12388 |
| 652 | Ga0496114_0006836 | 3300048917 | Bacteria | 8986 |
| 653 | Ga0496114_0017925 | 3300048917 | Bacteria | 5723 |
| 654 | Ga0496114_0022775 | 3300048917 | Bacteria | 5106 |
| 655 | Ga0496114_0054280 | 3300048917 | Bacteria | 3342 |
| 656 | Ga0496115_0003682 | 3300048918 | Bacteria | 11029 |
| 657 | Ga0496115_0012058 | 3300048918 | Bacteria | 6499 |
| 658 | Ga0496115_0072543 | 3300048918 | Bacteria | 2793 |
| 659 | Ga0496115_0133505 | 3300048918 | Bacteria | 2046 |
| 660 | Ga0496115_0276012 | 3300048918 | Bacteria | 1380 |
| 661 | Ga0496115_0276606 | 3300048918 | Bacteria | 1379 |
| 662 | Ga0496115_0368063 | 3300048918 | Bacteria | 1170 |
| 663 | Ga0501034_0045751 | 3300049571 | Bacteria | 4421 |
| 664 | Ga0501047_0987695 | 3300049581 | Bacteria | 655 |
| 665 | Ga0501067_0030525 | 3300049583 | Bacteria | 2989 |
| 666 | Ga0501068_0155866 | 3300049584 | Bacteria | 1438 |
| 667 | Ga0501069_0067488 | 3300049585 | Bacteria | 2001 |
| 668 | Ga0501070_0074769 | 3300049586 | Bacteria | 2805 |
| 669 | Ga0501070_0908572 | 3300049586 | Bacteria | 686 |
| 670 | Ga0501072_0246925 | 3300049588 | Bacteria | 1421 |
| 671 | Ga0501073_0046759 | 3300049589 | Bacteria | 3042 |
| 672 | Ga0501073_0262289 | 3300049589 | Bacteria | 1192 |
| 673 | Ga0501074_0019738 | 3300049590 | Bacteria | 4895 |
| 674 | Ga0501074_0459485 | 3300049590 | Bacteria | 902 |
| 675 | Ga0501079_0551297 | 3300049741 | Bacteria | 906 |
| 676 | Ga0501079_1257023 | 3300049741 | Bacteria | 583 |
| 677 | Ga0501079_1656494 | 3300049741 | Bacteria | 503 |
| 678 | Ga0501080_0026197 | 3300049742 | Bacteria | 5417 |
| 679 | Ga0501080_0245688 | 3300049742 | Bacteria | 1632 |
| 680 | Ga0501083_0001476 | 3300049744 | Bacteria | 16080 |
| 681 | nmdc:mga08y16_655212_c1 | 3300050511 | Bacteria | 1054 |
| 682 | nmdc:mga0n895_120375_c1 | 3300050512 | Bacteria | 2646 |
| 683 | nmdc:mga0n895_86746_c1 | 3300050512 | Bacteria | 3127 |
| 684 | nmdc:mga08x19_116723_c1 | 3300050514 | Bacteria | 1785 |
| 685 | nmdc:mga08x19_790492_c1 | 3300050514 | Unclassified | 674 |
| 686 | nmdc:mga0a205_52614_c1 | 3300050515 | Bacteria | 3929 |
| 687 | Ga0495601_0061078 | 3300053077 | Bacteria | 2392 |
| 688 | Ga0495601_0070362 | 3300053077 | Bacteria | 2233 |
| 689 | Ga0495601_0164187 | 3300053077 | Bacteria | 1451 |
| 690 | Ga0495601_0232736 | 3300053077 | Bacteria | 1203 |
| 691 | Ga0495612_0182733 | 3300053078 | Bacteria | 921 |
| 692 | Ga0495612_0202714 | 3300053078 | Bacteria | 875 |
| 693 | Ga0495612_0206972 | 3300053078 | Bacteria | 866 |
| 694 | Ga0495595_0054203 | 3300053084 | Bacteria | 1864 |
| 695 | Ga0495595_0199741 | 3300053084 | Bacteria | 995 |
| 696 | Ga0495595_0287640 | 3300053084 | Bacteria | 826 |
| 697 | Ga0495619_0042062 | 3300053085 | Bacteria | 2991 |
| 698 | Ga0495619_0053871 | 3300053085 | Bacteria | 2662 |
| 699 | Ga0495619_0290563 | 3300053085 | Bacteria | 1132 |
| 700 | Ga0500566_0295692 | 3300053094 | Bacteria | 764 |
| 701 | Ga0501084_0389253 | 3300054114 | Bacteria | 1178 |
| 702 | Ga0587066_005506 | 3300059490 | Bacteria | 1624 |
| 703 | Ga0587066_021765 | 3300059490 | Bacteria | 1066 |
| 704 | Ga0587066_177396 | 3300059490 | Unclassified | 546 |
| 705 | Ga0587070_047127 | 3300059491 | Unclassified | 847 |
| 706 | Ga0587073_0080995 | 3300059492 | Bacteria | 806 |
| 707 | Ga0587080_160732 | 3300059503 | Bacteria | 527 |
| 708 | Ga0587082_038246 | 3300059504 | Bacteria | 868 |
| 709 | Ga0587083_0013353 | 3300059505 | Bacteria | 1398 |
| 710 | Ga0587091_016320 | 3300059511 | Bacteria | 1237 |
| 711 | Ga0587091_081996 | 3300059511 | Bacteria | 726 |
| 712 | Ga0587092_074056 | 3300059512 | Bacteria | 661 |
| 713 | Ga0587094_019247 | 3300059513 | Bacteria | 978 |
| 714 | Ga0587106_006251 | 3300059605 | Bacteria | 1396 |
| 715 | Ga0587106_047799 | 3300059605 | Bacteria | 749 |
| 716 | Ga0587067_012061 | 3300059640 | Bacteria | 1343 |
| 717 | Ga0587067_038041 | 3300059640 | Bacteria | 922 |
| 718 | Ga0587068_059680 | 3300059641 | Bacteria | 731 |
| 719 | Ga0587079_001379 | 3300059647 | Bacteria | 2697 |
| 720 | Ga0587079_031750 | 3300059647 | Bacteria | 1019 |
| 721 | Ga0587079_118514 | 3300059647 | Bacteria | 652 |
| 722 | Ga0587105_003541 | 3300059651 | Bacteria | 955 |
| 723 | Ga0587119_010442 | 3300059658 | Unclassified | 1054 |
| 724 | Ga0501082_0610619 | 3300060353 | Bacteria | 954 |
| 725 | Ga0466962_0000842 | 3300061719 | Bacteria | 13849 |
| 726 | Ga0466962_0002125 | 3300061719 | Bacteria | 9360 |
| 727 | Ga0466962_0021193 | 3300061719 | Bacteria | 3121 |
| 728 | Ga0466962_0034161 | 3300061719 | Bacteria | 2433 |
| 729 | Ga0466962_0061024 | 3300061719 | Bacteria | 1800 |
| 730 | Ga0466962_0206583 | 3300061719 | Bacteria | 960 |
| 731 | Ga0466962_0220803 | 3300061719 | Unclassified | 928 |
| 732 | Ga0466962_0324876 | 3300061719 | Bacteria | 763 |
| 733 | Ga0207661_10451920 | |||
| 734 | rootH2_10242497 | |||
| 735 | Ga0070658_10165264 | |||
| 736 | Ga0070658_10285233 | |||
| 737 | Ga0070658_10533998 | |||
| 738 | Ga0070658_10827512 | |||
| 739 | Ga0070683_100057022 | |||
| 740 | Ga0070683_100502911 | |||
| 741 | Ga0070683_100644605 | |||
| 742 | Ga0070680_100797262 | |||
| 743 | Ga0070680_101824412 | |||
| 744 | Ga0070680_102004643 | |||
| 745 | Ga0070682_100236095 | |||
| 746 | Ga0070682_101030193 | |||
| 747 | Ga0068868_101402631 | |||
| 748 | Ga0070660_100014749 | |||
| 749 | Ga0070660_100493382 | |||
| 750 | Ga0070660_100581076 | |||
| 751 | Ga0070660_101291891 | |||
| 752 | Ga0070691_10470561 | |||
| 753 | Ga0070661_100102660 | |||
| 754 | Ga0070661_100850671 | |||
| 755 | Ga0070671_100262684 | |||
| 756 | Ga0070673_100433353 | |||
| 757 | Ga0070659_100507150 | |||
| 758 | Ga0070667_102340795 | |||
| 759 | Ga0070709_10009852 | |||
| 760 | Ga0070709_10119175 | |||
| 761 | Ga0070709_10610163 | |||
| 762 | Ga0070709_11026629 | |||
| 763 | Ga0070714_100009556 | |||
| 764 | Ga0070714_100013451 | |||
| 765 | Ga0070714_100016784 | |||
| 766 | Ga0070714_100091422 | |||
| 767 | Ga0070714_100464538 | |||
| 768 | Ga0070714_100680885 | |||
| 769 | Ga0070714_100742323 | |||
| 770 | Ga0070714_101623656 | |||
| 771 | Ga0070713_100018202 | |||
| 772 | Ga0070713_100066952 | |||
| 773 | Ga0070713_100144307 | |||
| 774 | Ga0070713_100864383 | |||
| 775 | Ga0070710_10004489 | |||
| 776 | Ga0070710_10015865 | |||
| 777 | Ga0070711_100009830 | |||
| 778 | Ga0070711_100103479 | |||
| 779 | Ga0070711_101961789 | |||
| 780 | Ga0070711_101982945 | |||
| 781 | Ga0070708_102163272 | |||
| 782 | Ga0070663_100753443 | |||
| 783 | Ga0070678_100387042 | |||
| 784 | Ga0070681_10122844 | |||
| 785 | Ga0070681_10263204 | |||
| 786 | Ga0070681_10325630 | |||
| 787 | Ga0070681_10455229 | |||
| 788 | Ga0070681_10691158 | |||
| 789 | Ga0070681_11205607 | |||
| 790 | Ga0070706_100444898 | |||
| 791 | Ga0070707_100027516 | |||
| 792 | Ga0070707_100437140 | |||
| 793 | Ga0070707_101899631 | |||
| 794 | Ga0070698_100037982 | |||
| 795 | Ga0070698_100294250 | |||
| 796 | Ga0070698_100669878 | |||
| 797 | Ga0070699_100059619 | |||
| 798 | Ga0070679_100273046 | |||
| 799 | Ga0070679_100366936 | |||
| 800 | Ga0070679_101106015 | |||
| 801 | Ga0070679_101145457 | |||
| 802 | Ga0070684_100023525 | |||
| 803 | Ga0070684_100077503 | |||
| 804 | Ga0070684_100475811 | |||
| 805 | Ga0070697_100417963 | |||
| 806 | Ga0070697_101070117 | |||
| 807 | Ga0068853_100086737 | |||
| 808 | Ga0070695_100396879 | |||
| 809 | Ga0070695_100901717 | |||
| 810 | Ga0070695_101009387 | |||
| 811 | Ga0070696_100267827 | |||
| 812 | Ga0070665_100740264 | |||
| 813 | Ga0070704_100027480 | |||
| 814 | Ga0068855_100949609 | |||
| 815 | Ga0068855_101180815 | |||
| 816 | Ga0068855_102335757 | |||
| 817 | Ga0068856_100084012 | |||
| 818 | Ga0068856_102126569 | |||
| 819 | Ga0068852_100235342 | |||
| 820 | Ga0068864_102691603 | |||
| 821 | Ga0068866_10466455 | |||
| 822 | Ga0068863_100334169 | |||
| 823 | Ga0068863_100683010 | |||
| 824 | Ga0068858_101934521 | |||
| 825 | Ga0070717_10001309 | |||
| 826 | Ga0070717_10002987 | |||
| 827 | Ga0070717_10006721 | |||
| 828 | Ga0070717_10012873 | |||
| 829 | Ga0070717_10058761 | |||
| 830 | Ga0070715_10000128 | |||
| 831 | Ga0070716_100018752 | |||
| 832 | Ga0070716_100237638 | |||
| 833 | Ga0070716_100270202 | |||
| 834 | Ga0070716_101466096 | |||
| 835 | Ga0070712_100046418 | |||
| 836 | Ga0070712_100139545 | |||
| 837 | Ga0070712_100369112 | |||
| 838 | Ga0070712_100625706 | |||
| 839 | Ga0070712_100675348 | |||
| 840 | Ga0070712_101444311 | |||
| 841 | Ga0068871_100300373 | |||
| 842 | Ga0075433_10062389 | |||
| 843 | Ga0075434_100052927 | |||
| 844 | Ga0068865_100332247 | |||
| 845 | Ga0075436_100122419 | |||
| 846 | Ga0075436_100383296 | |||
| 847 | Ga0105240_10040447 | |||
| 848 | Ga0105240_11485853 | |||
| 849 | Ga0111539_10435828 | |||
| 850 | Ga0105245_10056263 | |||
| 851 | Ga0105245_10360289 | |||
| 852 | Ga0105247_10444176 | |||
| 853 | Ga0105243_12936970 | |||
| 854 | Ga0105242_10945001 | |||
| 855 | Ga0105248_10128263 | |||
| 856 | Ga0105248_10643864 | |||
| 857 | Ga0105237_10013009 | |||
| 858 | Ga0105238_10070118 | |||
| 859 | Ga0105238_10932210 | |||
| 860 | Ga0105238_11429616 | |||
| 861 | Ga0105239_12484029 | |||
| 862 | Ga0157373_10747666 | |||
| 863 | Ga0157373_10969027 | |||
| 864 | Ga0157373_11321126 | |||
| 865 | Ga0157370_10044813 | |||
| 866 | Ga0157370_10211925 | |||
| 867 | Ga0157370_10223079 | |||
| 868 | Ga0157369_10007929 | |||
| 869 | Ga0157369_10201450 | |||
| 870 | Ga0157369_10438060 | |||
| 871 | Ga0157369_12046922 | |||
| 872 | Ga0157374_10015556 | |||
| 873 | Ga0163162_10378448 | |||
| 874 | Ga0157372_10090949 | |||
| 875 | Ga0157372_12158510 | |||
| 876 | Ga0157372_12375241 | |||
| 877 | Ga0157375_11465055 | |||
| 878 | Ga0163163_10236022 | |||
| 879 | Ga0157380_10697635 | |||
| 880 | Ga0182008_10125148 | |||
| 881 | Ga0182008_10235020 | |||
| 882 | Ga0182008_10278497 | |||
| 883 | Ga0157377_10115554 | |||
| 884 | Ga0157377_10560323 | |||
| 885 | Ga0157379_11642913 | |||
| 886 | Ga0157379_12147933 | |||
| 887 | Ga0157376_10135273 | |||
| 888 | Ga0157376_11127080 | |||
| 889 | Ga0197907_10658307 | |||
| 890 | Ga0197907_10930357 | |||
| 891 | Ga0197907_11490104 | |||
| 892 | Ga0206356_10315597 | |||
| 893 | Ga0206356_10592217 | |||
| 894 | Ga0206356_11558539 | |||
| 895 | Ga0206354_11269589 | |||
| 896 | Ga0206354_11673090 | |||
| 897 | Ga0206353_10800247 | |||
| 898 | Ga0206353_11130274 | |||
| 899 | Ga0206353_11636931 | |||
| 900 | Ga0154015_1293283 | |||
| 901 | Ga0224712_10029772 | |||
| 902 | Ga0224712_10241706 | |||
| 903 | Ga0207692_10028233 | |||
| 904 | Ga0207692_10068704 | |||
| 905 | Ga0207692_10382714 | |||
| 906 | Ga0207642_10393663 | |||
| 907 | Ga0207710_10563866 | |||
| 908 | Ga0207685_10001914 | |||
| 909 | Ga0207699_10033221 | |||
| 910 | Ga0207699_10102253 | |||
| 911 | Ga0207699_11080158 | |||
| 912 | Ga0207705_10050078 | |||
| 913 | Ga0207705_10659118 | |||
| 914 | Ga0207684_10211748 | |||
| 915 | Ga0207707_10039266 | |||
| 916 | Ga0207707_10156923 | |||
| 917 | Ga0207707_10181760 | |||
| 918 | Ga0207707_10372190 | |||
| 919 | Ga0207707_10443114 | |||
| 920 | Ga0207695_10221153 | |||
| 921 | Ga0207693_10001852 | |||
| 922 | Ga0207693_10002202 | |||
| 923 | Ga0207693_10261452 | |||
| 924 | Ga0207693_10387199 | |||
| 925 | Ga0207693_10392841 | |||
| 926 | Ga0207693_10609387 | |||
| 927 | Ga0207693_11304383 | |||
| 928 | Ga0207663_10003571 | |||
| 929 | Ga0207663_10006777 | |||
| 930 | Ga0207663_10364123 | |||
| 931 | Ga0207660_10065540 | |||
| 932 | Ga0207660_10543471 | |||
| 933 | Ga0207660_10716263 | |||
| 934 | Ga0207660_11482922 | |||
| 935 | Ga0207657_10024027 | |||
| 936 | Ga0207657_10218386 | |||
| 937 | Ga0207657_10277518 | |||
| 938 | Ga0207657_10546189 | |||
| 939 | Ga0207657_10589688 | |||
| 940 | Ga0207649_10081336 | |||
| 941 | Ga0207652_10020914 | |||
| 942 | Ga0207652_10051514 | |||
| 943 | Ga0207652_10564496 | |||
| 944 | Ga0207652_10919581 | |||
| 945 | Ga0207652_11875598 | |||
| 946 | Ga0207646_10002470 | |||
| 947 | Ga0207646_10144468 | |||
| 948 | Ga0207646_10208876 | |||
| 949 | Ga0207687_10080371 | |||
| 950 | Ga0207687_10254123 | |||
| 951 | Ga0207700_10024718 | |||
| 952 | Ga0207700_10219661 | |||
| 953 | Ga0207700_10890208 | |||
| 954 | Ga0207700_11171900 | |||
| 955 | Ga0207700_11552531 | |||
| 956 | Ga0207664_10004974 | |||
| 957 | Ga0207664_10025030 | |||
| 958 | Ga0207664_10036123 | |||
| 959 | Ga0207664_10090502 | |||
| 960 | Ga0207664_10148476 | |||
| 961 | Ga0207664_10155850 | |||
| 962 | Ga0207664_10183927 | |||
| 963 | Ga0207664_10291142 | |||
| 964 | Ga0207664_10317772 | |||
| 965 | Ga0207664_10455319 | |||
| 966 | Ga0207664_10475102 | |||
| 967 | Ga0207664_11058804 | |||
| 968 | Ga0207644_10189502 | |||
| 969 | Ga0207690_10093928 | |||
| 970 | Ga0207686_10580547 | |||
| 971 | Ga0207704_10267739 | |||
| 972 | Ga0207665_10001140 | |||
| 973 | Ga0207665_10184865 | |||
| 974 | Ga0207665_10781820 | |||
| 975 | Ga0207711_10433726 | |||
| 976 | Ga0207661_10076588 | |||
| 977 | Ga0207661_10120352 | |||
| 978 | Ga0207661_11874339 | |||
| 979 | Ga0207667_10382017 | |||
| 980 | Ga0207667_10582644 | |||
| 981 | Ga0207667_11464360 | |||
| 982 | Ga0207640_11353799 | |||
| 983 | Ga0207658_11960730 | |||
| 984 | Ga0207639_11131418 | |||
| 985 | Ga0207702_12515138 | |||
| 986 | Ga0207683_11164028 | |||
| 987 | Ga0207698_10094247 | |||
| 988 | Ga0207698_10921616 | |||
| 989 | Ga0207698_12237236 | |||
| 990 | Ga0207428_10321631 | |||
| 991 | Ga0268266_10643785 | |||
| 992 | Ga0265337_1037492 | |||
| 993 | Ga0265334_10150591 | |||
| 994 | Ga0265318_10085108 | |||
| 995 | Ga0265336_10031965 | |||
| 996 | Ga0265336_10084073 | |||
| 997 | Ga0265338_10003515 | |||
| 998 | Ga0265338_10005836 | |||
| 999 | Ga0265338_10270543 | |||
| 1000 | Ga0265330_10020448 | |||
| 1001 | Ga0265325_10130880 | |||
| 1002 | Ga0265325_10235078 | |||
| 1003 | Ga0265329_10126386 | |||
| 1004 | Ga0265340_10207618 | |||
| 1005 | Ga0265339_10014897 | |||
| 1006 | Ga0265339_10283430 | |||
| 1007 | Ga0265331_10044132 | |||
| 1008 | Ga0265316_10110084 | |||
| 1009 | Ga0265313_10121675 | |||
| 1010 | Ga0265342_10139239 | |||
| 1011 | Ga0373936_0092530 | |||
| 1012 | Ga0373936_0242939 | |||
| 1013 | Ga0373939_0094469 | |||
| 1014 | Ga0373945_0060945 | |||
| 1015 | Ga0373954_0139041 | |||
| 1016 | Ga0373954_0327090 | |||
| 1017 | Ga0373956_0276603 | |||
| 1018 | Ga0373960_0135159 | |||
| 1019 | Ga0373943_0007035 | |||
| 1020 | Ga0373943_0912893 | |||
| 1021 | Ga0373946_0651163 | |||
| 1022 | Ga0373955_0894893 | |||
| 1023 | Ga0373924_0215326 | |||
| 1024 | Ga0373931_0016344 | |||
| 1025 | Ga0373931_0777757 | |||
| 1026 | Ga0373935_0227728 | |||
| 1027 | Ga0373935_1514840 | |||
| 1028 | Ga0373927_0309532 | |||
| 1029 | Ga0373933_1102737 | |||
| 1030 | Ga0373933_1138113 | |||
| 1031 | Ga0373947_0012958 | |||
| 1032 | Ga0373937_0918629 | |||
| 1033 | Ga0373937_1044691 | |||
| 1034 | Ga0373925_0001504 | |||
| 1035 | Ga0373925_0931338 | |||
| 1036 | Ga0395899_0221288 | |||
| 1037 | Ga0395899_0738319 | |||
| 1038 | Ga0395900_1014480 | |||
| 1039 | Ga0395900_1119187 | |||
| 1040 | Ga0395898_0026348 | |||
| 1041 | Ga0395898_0303511 | |||
| 1042 | Ga0395905_0263269 | |||
| 1043 | Ga0395905_0805580 | |||
| 1044 | Ga0395901_0244976 | |||
| 1045 | Ga0395901_0261248 | |||
| 1046 | Ga0395901_1088225 | |||
| 1047 | Ga0451807_0172388 | |||
| 1048 | Ga0451853_2907895 | |||
| 1049 | Ga0451853_3352851 | |||
| 1050 | Ga0439459_0071253 | |||
| 1051 | Ga0466969_0001728 | |||
| 1052 | Ga0466969_0014328 | |||
| 1053 | Ga0466969_0289061 | |||
| 1054 | Ga0466969_0570390 | |||
| 1055 | Ga0466972_0003611 | |||
| 1056 | Ga0466965_0022263 | |||
| 1057 | Ga0466965_0024918 | |||
| 1058 | Ga0466965_0057541 | |||
| 1059 | Ga0466965_0074413 | |||
| 1060 | Ga0466965_0371919 | |||
| 1061 | Ga0466966_0021143 | |||
| 1062 | Ga0466966_0054866 | |||
| 1063 | Ga0466966_0067455 | |||
| 1064 | Ga0466966_0077354 | |||
| 1065 | Ga0466966_0361168 | |||
| 1066 | Ga0466966_0376078 | |||
| 1067 | Ga0466966_1013604 | |||
| 1068 | Ga0466961_0012267 | |||
| 1069 | Ga0466961_0012971 | |||
| 1070 | Ga0466961_0020428 | |||
| 1071 | Ga0466961_0052103 | |||
| 1072 | Ga0466961_0248860 | |||
| 1073 | Ga0466961_0273387 | |||
| 1074 | Ga0466961_0790877 | |||
| 1075 | Ga0466963_0002677 | |||
| 1076 | Ga0466963_0003734 | |||
| 1077 | Ga0466963_0003889 | |||
| 1078 | Ga0466963_0004523 | |||
| 1079 | Ga0466963_0017986 | |||
| 1080 | Ga0466963_0024454 | |||
| 1081 | Ga0466963_0029057 | |||
| 1082 | Ga0466963_0049994 | |||
| 1083 | Ga0466963_0060809 | |||
| 1084 | Ga0466963_0062243 | |||
| 1085 | Ga0466963_0066702 | |||
| 1086 | Ga0466963_0088349 | |||
| 1087 | Ga0466963_0154117 | |||
| 1088 | Ga0466963_0971554 | |||
| 1089 | Ga0466963_1141781 | |||
| 1090 | Ga0466964_0000362 | |||
| 1091 | Ga0466964_0003274 | |||
| 1092 | Ga0466964_0005636 | |||
| 1093 | Ga0466964_0013029 | |||
| 1094 | Ga0466964_0021996 | |||
| 1095 | Ga0466964_0049083 | |||
| 1096 | Ga0466964_0054016 | |||
| 1097 | Ga0466964_0057899 | |||
| 1098 | Ga0466964_0121606 | |||
| 1099 | Ga0466964_0152791 | |||
| 1100 | Ga0466964_0614159 | |||
| 1101 | Ga0466964_0870461 | |||
| 1102 | Ga0466971_0004244 | |||
| 1103 | Ga0466971_0007535 | |||
| 1104 | Ga0466971_0015897 | |||
| 1105 | Ga0466971_0039481 | |||
| 1106 | Ga0466971_0088107 | |||
| 1107 | Ga0466971_0094646 | |||
| 1108 | Ga0466971_0167875 | |||
| 1109 | Ga0466971_0259356 | |||
| 1110 | Ga0466968_0003489 | |||
| 1111 | Ga0466968_0004050 | |||
| 1112 | Ga0466968_0015982 | |||
| 1113 | Ga0466968_0061187 | |||
| 1114 | Ga0466968_0173043 | |||
| 1115 | Ga0466968_0339798 | |||
| 1116 | Ga0466970_0006773 | |||
| 1117 | Ga0466970_0011420 | |||
| 1118 | Ga0466970_0161314 | |||
| 1119 | Ga0466970_0742370 | |||
| 1120 | Ga0466957_0002871 | |||
| 1121 | Ga0466957_0022414 | |||
| 1122 | Ga0466957_0027711 | |||
| 1123 | Ga0466957_0063359 | |||
| 1124 | Ga0466957_0082741 | |||
| 1125 | Ga0466957_0089088 | |||
| 1126 | Ga0466957_0177289 | |||
| 1127 | Ga0466957_0221439 | |||
| 1128 | Ga0466957_0243526 | |||
| 1129 | Ga0466957_0255640 | |||
| 1130 | Ga0466960_0003431 | |||
| 1131 | Ga0466960_0007474 | |||
| 1132 | Ga0466960_0264269 | |||
| 1133 | Ga0466960_0476464 | |||
| 1134 | Ga0466959_0015151 | |||
| 1135 | Ga0466959_0028595 | |||
| 1136 | Ga0466959_0045372 | |||
| 1137 | Ga0466959_0047599 | |||
| 1138 | Ga0466959_0098424 | |||
| 1139 | Ga0466959_0108746 | |||
| 1140 | Ga0466959_0200013 | |||
| 1141 | Ga0466959_0247458 | |||
| 1142 | Ga0466959_0291873 | |||
| 1143 | Ga0466959_0654105 | |||
| 1144 | Ga0466958_0005502 | |||
| 1145 | Ga0466958_0010539 | |||
| 1146 | Ga0466958_0019328 | |||
| 1147 | Ga0466958_0023800 | |||
| 1148 | Ga0466958_0037277 | |||
| 1149 | Ga0466958_0065093 | |||
| 1150 | Ga0466958_0159614 | |||
| 1151 | Ga0466958_0211253 | |||
| 1152 | Ga0466958_0224876 | |||
| 1153 | Ga0466958_0683554 | |||
| 1154 | Ga0466967_0000588 | |||
| 1155 | Ga0466967_0002741 | |||
| 1156 | Ga0466967_0009087 | |||
| 1157 | Ga0466967_0011112 | |||
| 1158 | Ga0466967_0015563 | |||
| 1159 | Ga0466967_0015869 | |||
| 1160 | Ga0466967_0024931 | |||
| 1161 | Ga0466967_0025315 | |||
| 1162 | Ga0466967_0041434 | |||
| 1163 | Ga0466967_0066511 | |||
| 1164 | Ga0466967_0069791 | |||
| 1165 | Ga0466967_0086823 | |||
| 1166 | Ga0466967_0089734 | |||
| 1167 | Ga0466967_0118182 | |||
| 1168 | Ga0466967_0144935 | |||
| 1169 | Ga0466967_0153955 | |||
| 1170 | Ga0466967_0171971 | |||
| 1171 | Ga0466967_0277610 | |||
| 1172 | Ga0466967_0367674 | |||
| 1173 | Ga0466967_0384811 | |||
| 1174 | Ga0466967_0527439 | |||
| 1175 | Ga0466967_0533931 | |||
| 1176 | Ga0466967_0636014 | |||
| 1177 | Ga0466967_0866785 | |||
| 1178 | Ga0495592_0073320 | |||
| 1179 | Ga0495592_0108898 | |||
| 1180 | Ga0495603_0361147 | |||
| 1181 | Ga0495629_0052079 | |||
| 1182 | Ga0495629_0122416 | |||
| 1183 | Ga0495629_0191158 | |||
| 1184 | Ga0495629_0227609 | |||
| 1185 | Ga0495629_0434542 | |||
| 1186 | Ga0495629_0686604 | |||
| 1187 | Ga0495629_1141041 | |||
| 1188 | Ga0495641_0006277 | |||
| 1189 | Ga0495641_0050149 | |||
| 1190 | Ga0495641_0539589 | |||
| 1191 | Ga0495651_0371533 | |||
| 1192 | Ga0495651_0475908 | |||
| 1193 | Ga0495653_0025246 | |||
| 1194 | Ga0495653_0202250 | |||
| 1195 | Ga0495653_0447987 | |||
| 1196 | Ga0495580_0056079 | |||
| 1197 | Ga0495580_0188810 | |||
| 1198 | Ga0495580_0331796 | |||
| 1199 | Ga0495582_0042259 | |||
| 1200 | Ga0495582_0061754 | |||
| 1201 | Ga0495582_0304955 | |||
| 1202 | Ga0495639_0020866 | |||
| 1203 | Ga0495639_0056907 | |||
| 1204 | Ga0495662_0007094 | |||
| 1205 | Ga0495662_0061466 | |||
| 1206 | Ga0495662_0080368 | |||
| 1207 | Ga0495664_0021631 | |||
| 1208 | Ga0495664_0122215 | |||
| 1209 | Ga0495664_0278092 | |||
| 1210 | Ga0495664_0480821 | |||
| 1211 | Ga0495594_0103095 | |||
| 1212 | Ga0495608_0016503 | |||
| 1213 | Ga0495608_0099298 | |||
| 1214 | Ga0495608_0372475 | |||
| 1215 | Ga0495618_0034424 | |||
| 1216 | Ga0495618_0038952 | |||
| 1217 | Ga0495618_0293207 | |||
| 1218 | Ga0495618_0854013 | |||
| 1219 | Ga0495628_1128810 | |||
| 1220 | Ga0495630_0009985 | |||
| 1221 | Ga0495630_0109104 | |||
| 1222 | Ga0495630_0146692 | |||
| 1223 | Ga0495630_0294754 | |||
| 1224 | Ga0495630_0513796 | |||
| 1225 | Ga0495630_1081934 | |||
| 1226 | Ga0495666_0002192 | |||
| 1227 | Ga0495666_0307118 | |||
| 1228 | Ga0495652_0093805 | |||
| 1229 | Ga0495652_0196150 | |||
| 1230 | Ga0495652_0575785 | |||
| 1231 | Ga0495665_0034830 | |||
| 1232 | Ga0495665_0438578 | |||
| 1233 | Ga0495640_0011544 | |||
| 1234 | Ga0495640_0050437 | |||
| 1235 | Ga0495640_0239619 | |||
| 1236 | Ga0495640_0703054 | |||
| 1237 | Ga0495586_0008595 | |||
| 1238 | Ga0495586_0091657 | |||
| 1239 | Ga0495587_0321404 | |||
| 1240 | Ga0495645_0012102 | |||
| 1241 | Ga0495645_0182910 | |||
| 1242 | Ga0495645_0477492 | |||
| 1243 | Ga0495622_0338950 | |||
| 1244 | Ga0495667_0013950 | |||
| 1245 | Ga0495667_0154158 | |||
| 1246 | Ga0495667_0386974 | |||
| 1247 | Ga0495667_0511884 | |||
| 1248 | Ga0495667_0745733 | |||
| 1249 | Ga0495634_0049928 | |||
| 1250 | Ga0495634_0150508 | |||
| 1251 | Ga0495634_0184963 | |||
| 1252 | Ga0495634_0418794 | |||
| 1253 | Ga0495635_0029691 | |||
| 1254 | Ga0495635_0075934 | |||
| 1255 | Ga0495635_0207804 | |||
| 1256 | Ga0495635_0309489 | |||
| 1257 | Ga0495657_0072837 | |||
| 1258 | Ga0495657_0204335 | |||
| 1259 | Ga0495657_0258318 | |||
| 1260 | Ga0495599_0350691 | |||
| 1261 | Ga0495623_0121914 | |||
| 1262 | Ga0495646_0097623 | |||
| 1263 | Ga0495646_0170128 | |||
| 1264 | Ga0495647_0003731 | |||
| 1265 | Ga0495647_0018568 | |||
| 1266 | Ga0495647_0091281 | |||
| 1267 | Ga0495647_0419902 | |||
| 1268 | Ga0495658_0004658 | |||
| 1269 | Ga0495658_0030384 | |||
| 1270 | Ga0495658_0161638 | |||
| 1271 | Ga0495658_0305137 | |||
| 1272 | Ga0495613_0008663 | |||
| 1273 | Ga0495613_0014645 | |||
| 1274 | Ga0495613_0180533 | |||
| 1275 | Ga0495613_0250234 | |||
| 1276 | Ga0495613_0661285 | |||
| 1277 | Ga0495624_0009082 | |||
| 1278 | Ga0495624_0011507 | |||
| 1279 | Ga0495624_0269582 | |||
| 1280 | Ga0495600_0272767 | |||
| 1281 | Ga0495600_0438966 | |||
| 1282 | Ga0495581_0035967 | |||
| 1283 | Ga0495581_0038666 | |||
| 1284 | Ga0495604_0047389 | |||
| 1285 | Ga0495674_0045748 | |||
| 1286 | Ga0495674_0189757 | |||
| 1287 | Ga0495674_0228725 | |||
| 1288 | Ga0495674_0337305 | |||
| 1289 | Ga0495674_1054738 | |||
| 1290 | Ga0495676_0064384 | |||
| 1291 | Ga0495676_0160742 | |||
| 1292 | Ga0495676_0228331 | |||
| 1293 | Ga0495676_0387244 | |||
| 1294 | Ga0495676_0437261 | |||
| 1295 | Ga0495680_0040915 | |||
| 1296 | Ga0495680_0747687 | |||
| 1297 | Ga0495680_0804760 | |||
| 1298 | Ga0495675_0364802 | |||
| 1299 | Ga0495684_0009525 | |||
| 1300 | Ga0495684_0329508 | |||
| 1301 | Ga0495684_0518665 | |||
| 1302 | Ga0495593_0004077 | |||
| 1303 | Ga0495602_0659198 | |||
| 1304 | Ga0495602_0831243 | |||
| 1305 | Ga0495614_0000498 | |||
| 1306 | Ga0496100_0045112 | |||
| 1307 | Ga0496100_0190339 | |||
| 1308 | Ga0496100_0296896 | |||
| 1309 | Ga0496100_0525238 | |||
| 1310 | Ga0496101_0012681 | |||
| 1311 | Ga0496101_0100887 | |||
| 1312 | Ga0496101_0102518 | |||
| 1313 | Ga0496101_0133926 | |||
| 1314 | Ga0496101_0576261 | |||
| 1315 | Ga0496102_0002973 | |||
| 1316 | Ga0496102_0021317 | |||
| 1317 | Ga0496102_0501193 | |||
| 1318 | Ga0496102_0653637 | |||
| 1319 | Ga0496102_1224726 | |||
| 1320 | Ga0496103_0004486 | |||
| 1321 | Ga0496103_0072165 | |||
| 1322 | Ga0496103_0218232 | |||
| 1323 | Ga0496104_0076644 | |||
| 1324 | Ga0496104_0109420 | |||
| 1325 | Ga0496104_0136307 | |||
| 1326 | Ga0496104_0258407 | |||
| 1327 | Ga0496104_0399366 | |||
| 1328 | Ga0496104_0550489 | |||
| 1329 | Ga0496104_0741538 | |||
| 1330 | Ga0496105_0009379 | |||
| 1331 | Ga0496105_0043138 | |||
| 1332 | Ga0496105_0060934 | |||
| 1333 | Ga0496105_0126362 | |||
| 1334 | Ga0496105_0206200 | |||
| 1335 | Ga0496105_0239651 | |||
| 1336 | Ga0496106_0012999 | |||
| 1337 | Ga0496106_0013479 | |||
| 1338 | Ga0496107_0003330 | |||
| 1339 | Ga0496107_0010143 | |||
| 1340 | Ga0496107_0047369 | |||
| 1341 | Ga0496107_0058346 | |||
| 1342 | Ga0496107_0099906 | |||
| 1343 | Ga0496108_0009721 | |||
| 1344 | Ga0496108_0021737 | |||
| 1345 | Ga0496108_0092303 | |||
| 1346 | Ga0496108_0196326 | |||
| 1347 | Ga0496108_0234569 | |||
| 1348 | Ga0496108_0729214 | |||
| 1349 | Ga0496108_1160509 | |||
| 1350 | Ga0496109_0010257 | |||
| 1351 | Ga0496109_0030220 | |||
| 1352 | Ga0496109_0033814 | |||
| 1353 | Ga0496109_0089545 | |||
| 1354 | Ga0496109_0497685 | |||
| 1355 | Ga0496109_0917993 | |||
| 1356 | Ga0496109_1241211 | |||
| 1357 | Ga0496109_1970183 | |||
| 1358 | Ga0496109_2053631 | |||
| 1359 | Ga0496110_0008688 | |||
| 1360 | Ga0496110_0048826 | |||
| 1361 | Ga0496110_0124504 | |||
| 1362 | Ga0496110_0238380 | |||
| 1363 | Ga0496111_0002119 | |||
| 1364 | Ga0496111_0215291 | |||
| 1365 | Ga0496111_0407579 | |||
| 1366 | Ga0496111_0644509 | |||
| 1367 | Ga0496111_0730300 | |||
| 1368 | Ga0496112_0009795 | |||
| 1369 | Ga0496112_0067812 | |||
| 1370 | Ga0496112_0134055 | |||
| 1371 | Ga0496112_0134105 | |||
| 1372 | Ga0496112_0162668 | |||
| 1373 | Ga0496112_0255638 | |||
| 1374 | Ga0496112_0293270 | |||
| 1375 | Ga0496112_0389840 | |||
| 1376 | Ga0496112_0651205 | |||
| 1377 | Ga0496112_0889194 | |||
| 1378 | Ga0496113_0020361 | |||
| 1379 | Ga0496113_0145329 | |||
| 1380 | Ga0496113_0540277 | |||
| 1381 | Ga0496113_0849194 | |||
| 1382 | Ga0496113_1247083 | |||
| 1383 | Ga0496114_0003302 | |||
| 1384 | Ga0496114_0006836 | |||
| 1385 | Ga0496114_0017925 | |||
| 1386 | Ga0496114_0022775 | |||
| 1387 | Ga0496114_0054280 | |||
| 1388 | Ga0496115_0003682 | |||
| 1389 | Ga0496115_0012058 | |||
| 1390 | Ga0496115_0072543 | |||
| 1391 | Ga0496115_0133505 | |||
| 1392 | Ga0496115_0276012 | |||
| 1393 | Ga0496115_0276606 | |||
| 1394 | Ga0496115_0368063 | |||
| 1395 | Ga0501034_0045751 | |||
| 1396 | Ga0501047_0987695 | |||
| 1397 | Ga0501067_0030525 | |||
| 1398 | Ga0501068_0155866 | |||
| 1399 | Ga0501069_0067488 | |||
| 1400 | Ga0501070_0074769 | |||
| 1401 | Ga0501070_0908572 | |||
| 1402 | Ga0501072_0246925 | |||
| 1403 | Ga0501073_0046759 | |||
| 1404 | Ga0501073_0262289 | |||
| 1405 | Ga0501074_0019738 | |||
| 1406 | Ga0501074_0459485 | |||
| 1407 | Ga0501079_0551297 | |||
| 1408 | Ga0501079_1257023 | |||
| 1409 | Ga0501079_1656494 | |||
| 1410 | Ga0501080_0026197 | |||
| 1411 | Ga0501080_0245688 | |||
| 1412 | Ga0501083_0001476 | |||
| 1413 | nmdc:mga08y16_655212_c1 | |||
| 1414 | nmdc:mga0n895_120375_c1 | |||
| 1415 | nmdc:mga0n895_86746_c1 | |||
| 1416 | nmdc:mga08x19_116723_c1 | |||
| 1417 | nmdc:mga08x19_790492_c1 | |||
| 1418 | nmdc:mga0a205_52614_c1 | |||
| 1419 | Ga0495601_0061078 | |||
| 1420 | Ga0495601_0070362 | |||
| 1421 | Ga0495601_0164187 | |||
| 1422 | Ga0495601_0232736 | |||
| 1423 | Ga0495612_0182733 | |||
| 1424 | Ga0495612_0202714 | |||
| 1425 | Ga0495612_0206972 | |||
| 1426 | Ga0495595_0054203 | |||
| 1427 | Ga0495595_0199741 | |||
| 1428 | Ga0495595_0287640 | |||
| 1429 | Ga0495619_0042062 | |||
| 1430 | Ga0495619_0053871 | |||
| 1431 | Ga0495619_0290563 | |||
| 1432 | Ga0500566_0295692 | |||
| 1433 | Ga0501084_0389253 | |||
| 1434 | Ga0587066_005506 | |||
| 1435 | Ga0587066_021765 | |||
| 1436 | Ga0587066_177396 | |||
| 1437 | Ga0587070_047127 | |||
| 1438 | Ga0587073_0080995 | |||
| 1439 | Ga0587080_160732 | |||
| 1440 | Ga0587082_038246 | |||
| 1441 | Ga0587083_0013353 | |||
| 1442 | Ga0587091_016320 | |||
| 1443 | Ga0587091_081996 | |||
| 1444 | Ga0587092_074056 | |||
| 1445 | Ga0587094_019247 | |||
| 1446 | Ga0587106_006251 | |||
| 1447 | Ga0587106_047799 | |||
| 1448 | Ga0587067_012061 | |||
| 1449 | Ga0587067_038041 | |||
| 1450 | Ga0587068_059680 | |||
| 1451 | Ga0587079_001379 | |||
| 1452 | Ga0587079_031750 | |||
| 1453 | Ga0587079_118514 | |||
| 1454 | Ga0587105_003541 | |||
| 1455 | Ga0587119_010442 | |||
| 1456 | Ga0501082_0610619 | |||
| 1457 | Ga0466962_0000842 | |||
| 1458 | Ga0466962_0002125 | |||
| 1459 | Ga0466962_0021193 | |||
| 1460 | Ga0466962_0034161 | |||
| 1461 | Ga0466962_0061024 | |||
| 1462 | Ga0466962_0206583 | |||
| 1463 | Ga0466962_0220803 | |||
| 1464 | Ga0466962_0324876 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ftr-assembly1.cif.gz_B | crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution | 0.7765 | 1 | 93 |
| 2ftr-assembly1.cif.gz_B | crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution | 0.7696 | 1 | 93 |
| 2q3p-assembly1.cif.gz_A | ensemble refinement of the protein crystal structure of at3g17210 from arabidopsis thaliana | 0.7309 | 2 | 93 |
| 2q3p-assembly1.cif.gz_A | ensemble refinement of the protein crystal structure of at3g17210 from arabidopsis thaliana | 0.7185 | 2 | 93 |
| 1si9-assembly1.cif.gz_A | boiling stable protein isolated from populus tremula | 0.7177 | 2 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1si9C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7375 | 2 | 93 | 3.30.70.100 |
| 1si9C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7249 | 2 | 93 | 3.30.70.100 |
| 3hdsA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7217 | 1 | 91 | 3.30.70.100 |
| 3lo3U00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7053 | 2 | 91 | 3.30.70.100 |
| 3hdsA01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7027 | 1 | 91 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1N3B7-F1-model_v4 | ABM domain-containing protein | 0.9771 | 5 | 93 |
|
| AF-A0A538F0E6-F1-model_v4 | EthD family reductase | 0.9474 | 1 | 93 |
|
| AF-A0A538F0E6-F1-model_v4 | EthD family reductase | 0.9376 | 1 | 93 |
|
| AF-A0A7W1N3B7-F1-model_v4 | ABM domain-containing protein | 0.9359 | 5 | 93 |
|
| AF-A0A7V9FN34-F1-model_v4 | ABM domain-containing protein | 0.9346 | 1 | 93 |
|