F478035

General Info

Members Datasets Scaffolds Average Seq Length
732 269 1464 93

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10451920|Ga0207661_104519203
Length 114
Sequence MNQRAQELHLAPAREGDSLRPMHRVIVLYEQEPDADSYAEHVEICKQVPGGIFRHGKVTGAPMGEPAHAYYAEWEFADQQAFDSAVRSEEFMASGKDAYKRGFPTPSVEFAEFA

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
116 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
136 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.08
Metatranscriptomes 4.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 12.3
Rhizosphere 87.16
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10451920 3300025944 Bacteria 1170
2 rootH2_10242497 3300003320 Bacteria 1356
3 Ga0070658_10165264 3300005327 Bacteria 1858
4 Ga0070658_10285233 3300005327 Bacteria 1406
5 Ga0070658_10533998 3300005327 Bacteria 1014
6 Ga0070658_10827512 3300005327 Bacteria 804
7 Ga0070683_100057022 3300005329 Bacteria 3628
8 Ga0070683_100502911 3300005329 Bacteria 1158
9 Ga0070683_100644605 3300005329 Unclassified 1014
10 Ga0070680_100797262 3300005336 Bacteria 814
11 Ga0070680_101824412 3300005336 Bacteria 527
12 Ga0070680_102004643 3300005336 Unclassified 502
13 Ga0070682_100236095 3300005337 Bacteria 1310
14 Ga0070682_101030193 3300005337 Bacteria 685
15 Ga0068868_101402631 3300005338 Bacteria 652
16 Ga0070660_100014749 3300005339 Bacteria 5637
17 Ga0070660_100493382 3300005339 Bacteria 1018
18 Ga0070660_100581076 3300005339 Bacteria 936
19 Ga0070660_101291891 3300005339 Bacteria 619
20 Ga0070691_10470561 3300005341 Bacteria 721
21 Ga0070661_100102660 3300005344 Bacteria 2129
22 Ga0070661_100850671 3300005344 Bacteria 751
23 Ga0070671_100262684 3300005355 Bacteria 1467
24 Ga0070673_100433353 3300005364 Bacteria 1180
25 Ga0070659_100507150 3300005366 Bacteria 1029
26 Ga0070667_102340795 3300005367 Unclassified 503
27 Ga0070709_10009852 3300005434 Bacteria 5279
28 Ga0070709_10119175 3300005434 Bacteria 1786
29 Ga0070709_10610163 3300005434 Unclassified 841
30 Ga0070709_11026629 3300005434 Bacteria 657
31 Ga0070714_100009556 3300005435 Bacteria 7631
32 Ga0070714_100013451 3300005435 Bacteria 6558
33 Ga0070714_100016784 3300005435 Bacteria 5920
34 Ga0070714_100091422 3300005435 Bacteria 2667
35 Ga0070714_100464538 3300005435 Bacteria 1203
36 Ga0070714_100680885 3300005435 Bacteria 991
37 Ga0070714_100742323 3300005435 Bacteria 949
38 Ga0070714_101623656 3300005435 Bacteria 632
39 Ga0070713_100018202 3300005436 Bacteria 5337
40 Ga0070713_100066952 3300005436 Bacteria 3022
41 Ga0070713_100144307 3300005436 Bacteria 2111
42 Ga0070713_100864383 3300005436 Bacteria 869
43 Ga0070710_10004489 3300005437 Bacteria 6600
44 Ga0070710_10015865 3300005437 Bacteria 3821
45 Ga0070711_100009830 3300005439 Bacteria 5899
46 Ga0070711_100103479 3300005439 Bacteria 2075
47 Ga0070711_101961789 3300005439 Bacteria 515
48 Ga0070711_101982945 3300005439 Unclassified 512
49 Ga0070708_102163272 3300005445 Unclassified 514
50 Ga0070663_100753443 3300005455 Bacteria 832
51 Ga0070678_100387042 3300005456 Bacteria 1211
52 Ga0070681_10122844 3300005458 Bacteria 2529
53 Ga0070681_10263204 3300005458 Bacteria 1636
54 Ga0070681_10325630 3300005458 Bacteria 1446
55 Ga0070681_10455229 3300005458 Bacteria 1192
56 Ga0070681_10691158 3300005458 Bacteria 936
57 Ga0070681_11205607 3300005458 Unclassified 679
58 Ga0070706_100444898 3300005467 Bacteria 1206
59 Ga0070707_100027516 3300005468 Bacteria 5410
60 Ga0070707_100437140 3300005468 Bacteria 1269
61 Ga0070707_101899631 3300005468 Unclassified 563
62 Ga0070698_100037982 3300005471 Bacteria 4964
63 Ga0070698_100294250 3300005471 Bacteria 1555
64 Ga0070698_100669878 3300005471 Unclassified 979
65 Ga0070699_100059619 3300005518 Bacteria 3306
66 Ga0070679_100273046 3300005530 Bacteria 1644
67 Ga0070679_100366936 3300005530 Bacteria 1387
68 Ga0070679_101106015 3300005530 Bacteria 737
69 Ga0070679_101145457 3300005530 Unclassified 723
70 Ga0070684_100023525 3300005535 Bacteria 5156
71 Ga0070684_100077503 3300005535 Bacteria 2935
72 Ga0070684_100475811 3300005535 Bacteria 1156
73 Ga0070697_100417963 3300005536 Bacteria 1165
74 Ga0070697_101070117 3300005536 Unclassified 717
75 Ga0068853_100086737 3300005539 Bacteria 2745
76 Ga0070695_100396879 3300005545 Unclassified 1045
77 Ga0070695_100901717 3300005545 Bacteria 714
78 Ga0070695_101009387 3300005545 Unclassified 677
79 Ga0070696_100267827 3300005546 Bacteria 1298
80 Ga0070665_100740264 3300005548 Bacteria 996
81 Ga0070704_100027480 3300005549 Bacteria 3775
82 Ga0068855_100949609 3300005563 Bacteria 906
83 Ga0068855_101180815 3300005563 Bacteria 797
84 Ga0068855_102335757 3300005563 Unclassified 535
85 Ga0068856_100084012 3300005614 Bacteria 3162
86 Ga0068856_102126569 3300005614 Bacteria 571
87 Ga0068852_100235342 3300005616 Bacteria 1748
88 Ga0068864_102691603 3300005618 Bacteria 503
89 Ga0068866_10466455 3300005718 Unclassified 829
90 Ga0068863_100334169 3300005841 Bacteria 1473
91 Ga0068863_100683010 3300005841 Bacteria 1020
92 Ga0068858_101934521 3300005842 Bacteria 583
93 Ga0070717_10001309 3300006028 Bacteria 17038
94 Ga0070717_10002987 3300006028 Bacteria 12039
95 Ga0070717_10006721 3300006028 Bacteria 8483
96 Ga0070717_10012873 3300006028 Bacteria 6388
97 Ga0070717_10058761 3300006028 Bacteria 3180
98 Ga0070715_10000128 3300006163 Bacteria 18010
99 Ga0070716_100018752 3300006173 Bacteria 3608
100 Ga0070716_100237638 3300006173 Bacteria 1234
101 Ga0070716_100270202 3300006173 Bacteria 1168
102 Ga0070716_101466096 3300006173 Bacteria 557
103 Ga0070712_100046418 3300006175 Bacteria 3003
104 Ga0070712_100139545 3300006175 Bacteria 1848
105 Ga0070712_100369112 3300006175 Bacteria 1179
106 Ga0070712_100625706 3300006175 Bacteria 913
107 Ga0070712_100675348 3300006175 Unclassified 879
108 Ga0070712_101444311 3300006175 Bacteria 601
109 Ga0068871_100300373 3300006358 Bacteria 1409
110 Ga0075433_10062389 3300006852 Bacteria 3264
111 Ga0075434_100052927 3300006871 Bacteria 4034
112 Ga0068865_100332247 3300006881 Bacteria 1226
113 Ga0075436_100122419 3300006914 Bacteria 1821
114 Ga0075436_100383296 3300006914 Bacteria 1017
115 Ga0105240_10040447 3300009093 Bacteria 5962
116 Ga0105240_11485853 3300009093 Unclassified 711
117 Ga0111539_10435828 3300009094 Bacteria 1526
118 Ga0105245_10056263 3300009098 Bacteria 3535
119 Ga0105245_10360289 3300009098 Bacteria 1443
120 Ga0105247_10444176 3300009101 Bacteria 933
121 Ga0105243_12936970 3300009148 Bacteria 517
122 Ga0105242_10945001 3300009176 Bacteria 866
123 Ga0105248_10128263 3300009177 Bacteria 2862
124 Ga0105248_10643864 3300009177 Bacteria 1196
125 Ga0105237_10013009 3300009545 Bacteria 8739
126 Ga0105238_10070118 3300009551 Bacteria 3505
127 Ga0105238_10932210 3300009551 Bacteria 888
128 Ga0105238_11429616 3300009551 Bacteria 719
129 Ga0105239_12484029 3300010375 Bacteria 604
130 Ga0157373_10747666 3300013100 Bacteria 719
131 Ga0157373_10969027 3300013100 Unclassified 633
132 Ga0157373_11321126 3300013100 Unclassified 546
133 Ga0157370_10044813 3300013104 Bacteria 4248
134 Ga0157370_10211925 3300013104 Bacteria 1795
135 Ga0157370_10223079 3300013104 Bacteria 1746
136 Ga0157369_10007929 3300013105 Bacteria 12209
137 Ga0157369_10201450 3300013105 Bacteria 2089
138 Ga0157369_10438060 3300013105 Bacteria 1354
139 Ga0157369_12046922 3300013105 Unclassified 581
140 Ga0157374_10015556 3300013296 Bacteria 6675
141 Ga0163162_10378448 3300013306 Bacteria 1549
142 Ga0157372_10090949 3300013307 Bacteria 3470
143 Ga0157372_12158510 3300013307 Bacteria 640
144 Ga0157372_12375241 3300013307 Unclassified 609
145 Ga0157375_11465055 3300013308 Unclassified 805
146 Ga0163163_10236022 3300014325 Bacteria 1878
147 Ga0157380_10697635 3300014326 Bacteria 1019
148 Ga0182008_10125148 3300014497 Bacteria 1279
149 Ga0182008_10235020 3300014497 Bacteria 941
150 Ga0182008_10278497 3300014497 Bacteria 870
151 Ga0157377_10115554 3300014745 Bacteria 1619
152 Ga0157377_10560323 3300014745 Bacteria 809
153 Ga0157379_11642913 3300014968 Bacteria 628
154 Ga0157379_12147933 3300014968 Bacteria 554
155 Ga0157376_10135273 3300014969 Bacteria 2205
156 Ga0157376_11127080 3300014969 Bacteria 811
157 Ga0197907_10658307 3300020069 Unclassified 518
158 Ga0197907_10930357 3300020069 Unclassified 911
159 Ga0197907_11490104 3300020069 Bacteria 1278
160 Ga0206356_10315597 3300020070 Bacteria 1824
161 Ga0206356_10592217 3300020070 Bacteria 1043
162 Ga0206356_11558539 3300020070 Bacteria 1069
163 Ga0206354_11269589 3300020081 Bacteria 1403
164 Ga0206354_11673090 3300020081 Bacteria 1059
165 Ga0206353_10800247 3300020082 Bacteria 1024
166 Ga0206353_11130274 3300020082 Bacteria 4920
167 Ga0206353_11636931 3300020082 Bacteria 5725
168 Ga0154015_1293283 3300020610 Unclassified 719
169 Ga0224712_10029772 3300022467 Bacteria 1964
170 Ga0224712_10241706 3300022467 Unclassified 832
171 Ga0207692_10028233 3300025898 Bacteria 2651
172 Ga0207692_10068704 3300025898 Bacteria 1859
173 Ga0207692_10382714 3300025898 Bacteria 874
174 Ga0207642_10393663 3300025899 Unclassified 827
175 Ga0207710_10563866 3300025900 Bacteria 594
176 Ga0207685_10001914 3300025905 Bacteria 4595
177 Ga0207699_10033221 3300025906 Bacteria 2915
178 Ga0207699_10102253 3300025906 Bacteria 1821
179 Ga0207699_11080158 3300025906 Bacteria 594
180 Ga0207705_10050078 3300025909 Bacteria 3006
181 Ga0207705_10659118 3300025909 Bacteria 814
182 Ga0207684_10211748 3300025910 Bacteria 1672
183 Ga0207707_10039266 3300025912 Bacteria 4138
184 Ga0207707_10156923 3300025912 Bacteria 1990
185 Ga0207707_10181760 3300025912 Bacteria 1836
186 Ga0207707_10372190 3300025912 Bacteria 1229
187 Ga0207707_10443114 3300025912 Bacteria 1112
188 Ga0207695_10221153 3300025913 Bacteria 1801
189 Ga0207693_10001852 3300025915 Bacteria 18530
190 Ga0207693_10002202 3300025915 Bacteria 16996
191 Ga0207693_10261452 3300025915 Bacteria 1357
192 Ga0207693_10387199 3300025915 Bacteria 1093
193 Ga0207693_10392841 3300025915 Bacteria 1085
194 Ga0207693_10609387 3300025915 Bacteria 850
195 Ga0207693_11304383 3300025915 Unclassified 543
196 Ga0207663_10003571 3300025916 Bacteria 7630
197 Ga0207663_10006777 3300025916 Bacteria 5895
198 Ga0207663_10364123 3300025916 Bacteria 1098
199 Ga0207660_10065540 3300025917 Bacteria 2625
200 Ga0207660_10543471 3300025917 Bacteria 945
201 Ga0207660_10716263 3300025917 Unclassified 816
202 Ga0207660_11482922 3300025917 Unclassified 548
203 Ga0207657_10024027 3300025919 Bacteria 5659
204 Ga0207657_10218386 3300025919 Bacteria 1528
205 Ga0207657_10277518 3300025919 Bacteria 1331
206 Ga0207657_10546189 3300025919 Bacteria 906
207 Ga0207657_10589688 3300025919 Bacteria 868
208 Ga0207649_10081336 3300025920 Bacteria 2097
209 Ga0207652_10020914 3300025921 Bacteria 5395
210 Ga0207652_10051514 3300025921 Bacteria 3529
211 Ga0207652_10564496 3300025921 Bacteria 1022
212 Ga0207652_10919581 3300025921 Unclassified 772
213 Ga0207652_11875598 3300025921 Bacteria 505
214 Ga0207646_10002470 3300025922 Bacteria 21835
215 Ga0207646_10144468 3300025922 Unclassified 2144
216 Ga0207646_10208876 3300025922 Bacteria 1763
217 Ga0207687_10080371 3300025927 Bacteria 2353
218 Ga0207687_10254123 3300025927 Bacteria 1398
219 Ga0207700_10024718 3300025928 Bacteria 4161
220 Ga0207700_10219661 3300025928 Bacteria 1610
221 Ga0207700_10890208 3300025928 Unclassified 796
222 Ga0207700_11171900 3300025928 Bacteria 686
223 Ga0207700_11552531 3300025928 Bacteria 587
224 Ga0207664_10004974 3300025929 Bacteria 9035
225 Ga0207664_10025030 3300025929 Bacteria 4489
226 Ga0207664_10036123 3300025929 Bacteria 3817
227 Ga0207664_10090502 3300025929 Bacteria 2507
228 Ga0207664_10148476 3300025929 Bacteria 1990
229 Ga0207664_10155850 3300025929 Bacteria 1944
230 Ga0207664_10183927 3300025929 Bacteria 1795
231 Ga0207664_10291142 3300025929 Bacteria 1435
232 Ga0207664_10317772 3300025929 Bacteria 1373
233 Ga0207664_10455319 3300025929 Bacteria 1142
234 Ga0207664_10475102 3300025929 Bacteria 1118
235 Ga0207664_11058804 3300025929 Unclassified 726
236 Ga0207644_10189502 3300025931 Bacteria 1616
237 Ga0207690_10093928 3300025932 Bacteria 2127
238 Ga0207686_10580547 3300025934 Bacteria 880
239 Ga0207704_10267739 3300025938 Bacteria 1292
240 Ga0207665_10001140 3300025939 Bacteria 17874
241 Ga0207665_10184865 3300025939 Bacteria 1511
242 Ga0207665_10781820 3300025939 Bacteria 754
243 Ga0207711_10433726 3300025941 Bacteria 1223
244 Ga0207661_10076588 3300025944 Bacteria 2748
245 Ga0207661_10120352 3300025944 Bacteria 2234
246 Ga0207661_11874339 3300025944 Unclassified 545
247 Ga0207667_10382017 3300025949 Bacteria 1435
248 Ga0207667_10582644 3300025949 Bacteria 1129
249 Ga0207667_11464360 3300025949 Bacteria 655
250 Ga0207640_11353799 3300025981 Bacteria 637
251 Ga0207658_11960730 3300025986 Unclassified 533
252 Ga0207639_11131418 3300026041 Bacteria 734
253 Ga0207702_12515138 3300026078 Unclassified 501
254 Ga0207683_11164028 3300026121 Bacteria 715
255 Ga0207698_10094247 3300026142 Bacteria 2461
256 Ga0207698_10921616 3300026142 Bacteria 882
257 Ga0207698_12237236 3300026142 Bacteria 559
258 Ga0207428_10321631 3300027907 Bacteria 1142
259 Ga0268266_10643785 3300028379 Bacteria 1020
260 Ga0265337_1037492 3300028556 Bacteria 1410
261 Ga0265334_10150591 3300028573 Bacteria 821
262 Ga0265318_10085108 3300028577 Bacteria 1166
263 Ga0265336_10031965 3300028666 Bacteria 1634
264 Ga0265336_10084073 3300028666 Bacteria 949
265 Ga0265338_10003515 3300028800 Bacteria 21949
266 Ga0265338_10005836 3300028800 Bacteria 15891
267 Ga0265338_10270543 3300028800 Bacteria 1245
268 Ga0265330_10020448 3300031235 Bacteria 3024
269 Ga0265325_10130880 3300031241 Bacteria 1201
270 Ga0265325_10235078 3300031241 Unclassified 834
271 Ga0265329_10126386 3300031242 Unclassified 822
272 Ga0265340_10207618 3300031247 Unclassified 880
273 Ga0265339_10014897 3300031249 Bacteria 4675
274 Ga0265339_10283430 3300031249 Unclassified 794
275 Ga0265331_10044132 3300031250 Bacteria 2157
276 Ga0265316_10110084 3300031344 Bacteria 2086
277 Ga0265313_10121675 3300031595 Bacteria 1137
278 Ga0265342_10139239 3300031712 Bacteria 1355
279 Ga0373936_0092530 3300035113 Bacteria 1269
280 Ga0373936_0242939 3300035113 Bacteria 803
281 Ga0373939_0094469 3300035114 Bacteria 1016
282 Ga0373945_0060945 3300035116 Bacteria 1408
283 Ga0373954_0139041 3300035118 Bacteria 1184
284 Ga0373954_0327090 3300035118 Bacteria 757
285 Ga0373956_0276603 3300035119 Bacteria 799
286 Ga0373960_0135159 3300035121 Bacteria 830
287 Ga0373943_0007035 3300035170 Bacteria 5047
288 Ga0373943_0912893 3300035170 Bacteria 525
289 Ga0373946_0651163 3300035171 Bacteria 549
290 Ga0373955_0894893 3300035172 Bacteria 546
291 Ga0373924_0215326 3300035410 Bacteria 848
292 Ga0373931_0016344 3300035691 Bacteria 3652
293 Ga0373931_0777757 3300035691 Bacteria 637
294 Ga0373935_0227728 3300035692 Bacteria 1297
295 Ga0373935_1514840 3300035692 Bacteria 502
296 Ga0373927_0309532 3300035695 Bacteria 1040
297 Ga0373933_1102737 3300035724 Bacteria 523
298 Ga0373933_1138113 3300035724 Bacteria 514
299 Ga0373947_0012958 3300035725 Bacteria 4780
300 Ga0373937_0918629 3300036401 Bacteria 824
301 Ga0373937_1044691 3300036401 Unclassified 766
302 Ga0373925_0001504 3300037068 Bacteria 19959
303 Ga0373925_0931338 3300037068 Bacteria 716
304 Ga0395899_0221288 3300037312 Bacteria 1311
305 Ga0395899_0738319 3300037312 Bacteria 614
306 Ga0395900_1014480 3300037418 Bacteria 749
307 Ga0395900_1119187 3300037418 Unclassified 704
308 Ga0395898_0026348 3300037466 Bacteria 5852
309 Ga0395898_0303511 3300037466 Bacteria 1523
310 Ga0395905_0263269 3300037471 Bacteria 1610
311 Ga0395905_0805580 3300037471 Bacteria 842
312 Ga0395901_0244976 3300038443 Bacteria 1869
313 Ga0395901_0261248 3300038443 Bacteria 1802
314 Ga0395901_1088225 3300038443 Bacteria 770
315 Ga0451807_0172388 3300041486 Unclassified 671
316 Ga0451853_2907895 3300041512 Unclassified 517
317 Ga0451853_3352851 3300041512 Bacteria 508
318 Ga0439459_0071253 3300042438 Bacteria 804
319 Ga0466969_0001728 3300044656 Bacteria 11667
320 Ga0466969_0014328 3300044656 Bacteria 4168
321 Ga0466969_0289061 3300044656 Bacteria 742
322 Ga0466969_0570390 3300044656 Bacteria 518
323 Ga0466972_0003611 3300044658 Bacteria 7689
324 Ga0466965_0022263 3300044683 Bacteria 3056
325 Ga0466965_0024918 3300044683 Bacteria 2895
326 Ga0466965_0057541 3300044683 Bacteria 1938
327 Ga0466965_0074413 3300044683 Bacteria 1711
328 Ga0466965_0371919 3300044683 Unclassified 786
329 Ga0466966_0021143 3300044684 Bacteria 4273
330 Ga0466966_0054866 3300044684 Bacteria 2524
331 Ga0466966_0067455 3300044684 Bacteria 2247
332 Ga0466966_0077354 3300044684 Bacteria 2076
333 Ga0466966_0361168 3300044684 Bacteria 872
334 Ga0466966_0376078 3300044684 Bacteria 853
335 Ga0466966_1013604 3300044684 Bacteria 501
336 Ga0466961_0012267 3300044693 Bacteria 5480
337 Ga0466961_0012971 3300044693 Bacteria 5331
338 Ga0466961_0020428 3300044693 Bacteria 4260
339 Ga0466961_0052103 3300044693 Bacteria 2612
340 Ga0466961_0248860 3300044693 Bacteria 1091
341 Ga0466961_0273387 3300044693 Bacteria 1035
342 Ga0466961_0790877 3300044693 Bacteria 566
343 Ga0466963_0002677 3300044694 Bacteria 10032
344 Ga0466963_0003734 3300044694 Bacteria 8764
345 Ga0466963_0003889 3300044694 Bacteria 8623
346 Ga0466963_0004523 3300044694 Bacteria 8096
347 Ga0466963_0017986 3300044694 Bacteria 4410
348 Ga0466963_0024454 3300044694 Bacteria 3846
349 Ga0466963_0029057 3300044694 Bacteria 3555
350 Ga0466963_0049994 3300044694 Bacteria 2766
351 Ga0466963_0060809 3300044694 Bacteria 2524
352 Ga0466963_0062243 3300044694 Bacteria 2496
353 Ga0466963_0066702 3300044694 Bacteria 2414
354 Ga0466963_0088349 3300044694 Bacteria 2108
355 Ga0466963_0154117 3300044694 Bacteria 1596
356 Ga0466963_0971554 3300044694 Unclassified 598
357 Ga0466963_1141781 3300044694 Unclassified 548
358 Ga0466964_0000362 3300044706 Bacteria 13664
359 Ga0466964_0003274 3300044706 Bacteria 5892
360 Ga0466964_0005636 3300044706 Bacteria 4653
361 Ga0466964_0013029 3300044706 Bacteria 3150
362 Ga0466964_0021996 3300044706 Bacteria 2470
363 Ga0466964_0049083 3300044706 Bacteria 1727
364 Ga0466964_0054016 3300044706 Bacteria 1655
365 Ga0466964_0057899 3300044706 Bacteria 1605
366 Ga0466964_0121606 3300044706 Bacteria 1178
367 Ga0466964_0152791 3300044706 Bacteria 1072
368 Ga0466964_0614159 3300044706 Bacteria 598
369 Ga0466964_0870461 3300044706 Bacteria 513
370 Ga0466971_0004244 3300044719 Bacteria 6178
371 Ga0466971_0007535 3300044719 Bacteria 4743
372 Ga0466971_0015897 3300044719 Bacteria 3316
373 Ga0466971_0039481 3300044719 Bacteria 2118
374 Ga0466971_0088107 3300044719 Bacteria 1419
375 Ga0466971_0094646 3300044719 Bacteria 1369
376 Ga0466971_0167875 3300044719 Bacteria 1029
377 Ga0466971_0259356 3300044719 Bacteria 829
378 Ga0466968_0003489 3300044735 Bacteria 5814
379 Ga0466968_0004050 3300044735 Bacteria 5450
380 Ga0466968_0015982 3300044735 Bacteria 2982
381 Ga0466968_0061187 3300044735 Bacteria 1624
382 Ga0466968_0173043 3300044735 Bacteria 1001
383 Ga0466968_0339798 3300044735 Bacteria 728
384 Ga0466970_0006773 3300044765 Bacteria 5734
385 Ga0466970_0011420 3300044765 Bacteria 4527
386 Ga0466970_0161314 3300044765 Unclassified 1240
387 Ga0466970_0742370 3300044765 Bacteria 573
388 Ga0466957_0002871 3300044842 Bacteria 9333
389 Ga0466957_0022414 3300044842 Bacteria 3727
390 Ga0466957_0027711 3300044842 Bacteria 3368
391 Ga0466957_0063359 3300044842 Bacteria 2272
392 Ga0466957_0082741 3300044842 Bacteria 2001
393 Ga0466957_0089088 3300044842 Bacteria 1931
394 Ga0466957_0177289 3300044842 Bacteria 1390
395 Ga0466957_0221439 3300044842 Bacteria 1249
396 Ga0466957_0243526 3300044842 Bacteria 1194
397 Ga0466957_0255640 3300044842 Bacteria 1166
398 Ga0466960_0003431 3300044901 Bacteria 6095
399 Ga0466960_0007474 3300044901 Bacteria 4441
400 Ga0466960_0264269 3300044901 Bacteria 960
401 Ga0466960_0476464 3300044901 Bacteria 728
402 Ga0466959_0015151 3300045049 Bacteria 5614
403 Ga0466959_0028595 3300045049 Bacteria 4133
404 Ga0466959_0045372 3300045049 Bacteria 3236
405 Ga0466959_0047599 3300045049 Bacteria 3153
406 Ga0466959_0098424 3300045049 Bacteria 2096
407 Ga0466959_0108746 3300045049 Bacteria 1980
408 Ga0466959_0200013 3300045049 Bacteria 1391
409 Ga0466959_0247458 3300045049 Bacteria 1230
410 Ga0466959_0291873 3300045049 Bacteria 1118
411 Ga0466959_0654105 3300045049 Bacteria 705
412 Ga0466958_0005502 3300045836 Bacteria 6830
413 Ga0466958_0010539 3300045836 Bacteria 5180
414 Ga0466958_0019328 3300045836 Bacteria 3965
415 Ga0466958_0023800 3300045836 Bacteria 3599
416 Ga0466958_0037277 3300045836 Bacteria 2913
417 Ga0466958_0065093 3300045836 Bacteria 2224
418 Ga0466958_0159614 3300045836 Bacteria 1424
419 Ga0466958_0211253 3300045836 Bacteria 1236
420 Ga0466958_0224876 3300045836 Bacteria 1198
421 Ga0466958_0683554 3300045836 Bacteria 668
422 Ga0466967_0000588 3300045976 Bacteria 17992
423 Ga0466967_0002741 3300045976 Bacteria 11144
424 Ga0466967_0009087 3300045976 Bacteria 7349
425 Ga0466967_0011112 3300045976 Bacteria 6801
426 Ga0466967_0015563 3300045976 Bacteria 5966
427 Ga0466967_0015869 3300045976 Bacteria 5920
428 Ga0466967_0024931 3300045976 Bacteria 4924
429 Ga0466967_0025315 3300045976 Bacteria 4891
430 Ga0466967_0041434 3300045976 Bacteria 3970
431 Ga0466967_0066511 3300045976 Bacteria 3212
432 Ga0466967_0069791 3300045976 Bacteria 3141
433 Ga0466967_0086823 3300045976 Bacteria 2835
434 Ga0466967_0089734 3300045976 Bacteria 2791
435 Ga0466967_0118182 3300045976 Bacteria 2445
436 Ga0466967_0144935 3300045976 Bacteria 2215
437 Ga0466967_0153955 3300045976 Bacteria 2151
438 Ga0466967_0171971 3300045976 Bacteria 2039
439 Ga0466967_0277610 3300045976 Bacteria 1607
440 Ga0466967_0367674 3300045976 Bacteria 1394
441 Ga0466967_0384811 3300045976 Bacteria 1362
442 Ga0466967_0527439 3300045976 Bacteria 1161
443 Ga0466967_0533931 3300045976 Bacteria 1153
444 Ga0466967_0636014 3300045976 Bacteria 1054
445 Ga0466967_0866785 3300045976 Bacteria 897
446 Ga0495592_0073320 3300046454 Bacteria 2490
447 Ga0495592_0108898 3300046454 Bacteria 1963
448 Ga0495603_0361147 3300046455 Bacteria 833
449 Ga0495629_0052079 3300046459 Bacteria 2864
450 Ga0495629_0122416 3300046459 Bacteria 1812
451 Ga0495629_0191158 3300046459 Bacteria 1417
452 Ga0495629_0227609 3300046459 Bacteria 1285
453 Ga0495629_0434542 3300046459 Unclassified 890
454 Ga0495629_0686604 3300046459 Bacteria 680
455 Ga0495629_1141041 3300046459 Unclassified 502
456 Ga0495641_0006277 3300046461 Bacteria 7736
457 Ga0495641_0050149 3300046461 Bacteria 1908
458 Ga0495641_0539589 3300046461 Bacteria 532
459 Ga0495651_0371533 3300046462 Bacteria 940
460 Ga0495651_0475908 3300046462 Bacteria 803
461 Ga0495653_0025246 3300046463 Bacteria 4780
462 Ga0495653_0202250 3300046463 Bacteria 1347
463 Ga0495653_0447987 3300046463 Bacteria 812
464 Ga0495580_0056079 3300046472 Bacteria 2775
465 Ga0495580_0188810 3300046472 Bacteria 1422
466 Ga0495580_0331796 3300046472 Bacteria 1033
467 Ga0495582_0042259 3300046473 Bacteria 2511
468 Ga0495582_0061754 3300046473 Bacteria 2069
469 Ga0495582_0304955 3300046473 Bacteria 915
470 Ga0495639_0020866 3300046475 Bacteria 2864
471 Ga0495639_0056907 3300046475 Bacteria 1786
472 Ga0495662_0007094 3300046476 Bacteria 5560
473 Ga0495662_0061466 3300046476 Bacteria 1815
474 Ga0495662_0080368 3300046476 Bacteria 1585
475 Ga0495664_0021631 3300046477 Bacteria 3715
476 Ga0495664_0122215 3300046477 Bacteria 1574
477 Ga0495664_0278092 3300046477 Bacteria 1011
478 Ga0495664_0480821 3300046477 Bacteria 742
479 Ga0495594_0103095 3300046499 Bacteria 1606
480 Ga0495608_0016503 3300046511 Bacteria 5110
481 Ga0495608_0099298 3300046511 Bacteria 1878
482 Ga0495608_0372475 3300046511 Bacteria 876
483 Ga0495618_0034424 3300046514 Bacteria 3176
484 Ga0495618_0038952 3300046514 Bacteria 2988
485 Ga0495618_0293207 3300046514 Bacteria 1012
486 Ga0495618_0854013 3300046514 Bacteria 527
487 Ga0495628_1128810 3300046516 Bacteria 534
488 Ga0495630_0009985 3300046517 Bacteria 6834
489 Ga0495630_0109104 3300046517 Bacteria 2096
490 Ga0495630_0146692 3300046517 Bacteria 1794
491 Ga0495630_0294754 3300046517 Bacteria 1239
492 Ga0495630_0513796 3300046517 Bacteria 918
493 Ga0495630_1081934 3300046517 Bacteria 608
494 Ga0495666_0002192 3300046526 Bacteria 9732
495 Ga0495666_0307118 3300046526 Bacteria 717
496 Ga0495652_0093805 3300046529 Bacteria 2450
497 Ga0495652_0196150 3300046529 Bacteria 1536
498 Ga0495652_0575785 3300046529 Bacteria 771
499 Ga0495665_0034830 3300046531 Bacteria 2692
500 Ga0495665_0438578 3300046531 Bacteria 661
501 Ga0495640_0011544 3300046533 Bacteria 6792
502 Ga0495640_0050437 3300046533 Bacteria 2866
503 Ga0495640_0239619 3300046533 Bacteria 1139
504 Ga0495640_0703054 3300046533 Bacteria 606
505 Ga0495586_0008595 3300046535 Bacteria 5436
506 Ga0495586_0091657 3300046535 Bacteria 1679
507 Ga0495587_0321404 3300046536 Bacteria 864
508 Ga0495645_0012102 3300046543 Bacteria 6078
509 Ga0495645_0182910 3300046543 Bacteria 1434
510 Ga0495645_0477492 3300046543 Bacteria 782
511 Ga0495622_0338950 3300046557 Bacteria 652
512 Ga0495667_0013950 3300046559 Bacteria 5426
513 Ga0495667_0154158 3300046559 Bacteria 1479
514 Ga0495667_0386974 3300046559 Bacteria 882
515 Ga0495667_0511884 3300046559 Bacteria 751
516 Ga0495667_0745733 3300046559 Bacteria 605
517 Ga0495634_0049928 3300046642 Bacteria 2811
518 Ga0495634_0150508 3300046642 Bacteria 1472
519 Ga0495634_0184963 3300046642 Bacteria 1302
520 Ga0495634_0418794 3300046642 Bacteria 794
521 Ga0495635_0029691 3300046663 Bacteria 3803
522 Ga0495635_0075934 3300046663 Bacteria 2302
523 Ga0495635_0207804 3300046663 Bacteria 1326
524 Ga0495635_0309489 3300046663 Bacteria 1058
525 Ga0495657_0072837 3300046675 Bacteria 2240
526 Ga0495657_0204335 3300046675 Bacteria 1203
527 Ga0495657_0258318 3300046675 Bacteria 1047
528 Ga0495599_0350691 3300046678 Bacteria 885
529 Ga0495623_0121914 3300046679 Bacteria 1569
530 Ga0495646_0097623 3300046680 Bacteria 1688
531 Ga0495646_0170128 3300046680 Bacteria 1201
532 Ga0495647_0003731 3300046681 Bacteria 4892
533 Ga0495647_0018568 3300046681 Bacteria 2478
534 Ga0495647_0091281 3300046681 Bacteria 1249
535 Ga0495647_0419902 3300046681 Bacteria 616
536 Ga0495658_0004658 3300046683 Bacteria 6747
537 Ga0495658_0030384 3300046683 Bacteria 2933
538 Ga0495658_0161638 3300046683 Bacteria 1382
539 Ga0495658_0305137 3300046683 Bacteria 1007
540 Ga0495613_0008663 3300046689 Bacteria 7544
541 Ga0495613_0014645 3300046689 Bacteria 5819
542 Ga0495613_0180533 3300046689 Bacteria 1495
543 Ga0495613_0250234 3300046689 Bacteria 1237
544 Ga0495613_0661285 3300046689 Bacteria 690
545 Ga0495624_0009082 3300046690 Bacteria 6897
546 Ga0495624_0011507 3300046690 Bacteria 6082
547 Ga0495624_0269582 3300046690 Bacteria 1028
548 Ga0495600_0272767 3300046809 Bacteria 1073
549 Ga0495600_0438966 3300046809 Bacteria 808
550 Ga0495581_0035967 3300047315 Bacteria 2864
551 Ga0495581_0038666 3300047315 Bacteria 2761
552 Ga0495604_0047389 3300047317 Bacteria 3347
553 Ga0495674_0045748 3300047319 Bacteria 3886
554 Ga0495674_0189757 3300047319 Bacteria 1708
555 Ga0495674_0228725 3300047319 Bacteria 1535
556 Ga0495674_0337305 3300047319 Bacteria 1225
557 Ga0495674_1054738 3300047319 Bacteria 620
558 Ga0495676_0064384 3300047321 Bacteria 2852
559 Ga0495676_0160742 3300047321 Bacteria 1589
560 Ga0495676_0228331 3300047321 Bacteria 1279
561 Ga0495676_0387244 3300047321 Bacteria 929
562 Ga0495676_0437261 3300047321 Bacteria 864
563 Ga0495680_0040915 3300047322 Bacteria 3689
564 Ga0495680_0747687 3300047322 Bacteria 642
565 Ga0495680_0804760 3300047322 Bacteria 613
566 Ga0495675_0364802 3300047444 Bacteria 847
567 Ga0495684_0009525 3300047471 Bacteria 7489
568 Ga0495684_0329508 3300047471 Bacteria 1089
569 Ga0495684_0518665 3300047471 Bacteria 816
570 Ga0495593_0004077 3300047673 Bacteria 8694
571 Ga0495602_0659198 3300048088 Unclassified 714
572 Ga0495602_0831243 3300048088 Bacteria 618
573 Ga0495614_0000498 3300048089 Bacteria 16038
574 Ga0496100_0045112 3300048903 Bacteria 2827
575 Ga0496100_0190339 3300048903 Bacteria 1489
576 Ga0496100_0296896 3300048903 Bacteria 1208
577 Ga0496100_0525238 3300048903 Bacteria 914
578 Ga0496101_0012681 3300048904 Bacteria 5632
579 Ga0496101_0100887 3300048904 Bacteria 2160
580 Ga0496101_0102518 3300048904 Bacteria 2143
581 Ga0496101_0133926 3300048904 Bacteria 1884
582 Ga0496101_0576261 3300048904 Bacteria 890
583 Ga0496102_0002973 3300048905 Bacteria 14352
584 Ga0496102_0021317 3300048905 Bacteria 5731
585 Ga0496102_0501193 3300048905 Bacteria 1136
586 Ga0496102_0653637 3300048905 Unclassified 974
587 Ga0496102_1224726 3300048905 Bacteria 670
588 Ga0496103_0004486 3300048906 Bacteria 8462
589 Ga0496103_0072165 3300048906 Bacteria 2162
590 Ga0496103_0218232 3300048906 Bacteria 1227
591 Ga0496104_0076644 3300048907 Bacteria 3185
592 Ga0496104_0109420 3300048907 Bacteria 2648
593 Ga0496104_0136307 3300048907 Bacteria 2358
594 Ga0496104_0258407 3300048907 Bacteria 1655
595 Ga0496104_0399366 3300048907 Bacteria 1287
596 Ga0496104_0550489 3300048907 Bacteria 1064
597 Ga0496104_0741538 3300048907 Unclassified 889
598 Ga0496105_0009379 3300048908 Bacteria 7653
599 Ga0496105_0043138 3300048908 Bacteria 3720
600 Ga0496105_0060934 3300048908 Bacteria 3113
601 Ga0496105_0126362 3300048908 Bacteria 2108
602 Ga0496105_0206200 3300048908 Bacteria 1603
603 Ga0496105_0239651 3300048908 Bacteria 1472
604 Ga0496106_0012999 3300048909 Bacteria 6141
605 Ga0496106_0013479 3300048909 Bacteria 6035
606 Ga0496107_0003330 3300048910 Bacteria 10741
607 Ga0496107_0010143 3300048910 Bacteria 6534
608 Ga0496107_0047369 3300048910 Bacteria 3096
609 Ga0496107_0058346 3300048910 Bacteria 2791
610 Ga0496107_0099906 3300048910 Bacteria 2127
611 Ga0496108_0009721 3300048911 Bacteria 7796
612 Ga0496108_0021737 3300048911 Bacteria 5275
613 Ga0496108_0092303 3300048911 Bacteria 2574
614 Ga0496108_0196326 3300048911 Bacteria 1750
615 Ga0496108_0234569 3300048911 Bacteria 1596
616 Ga0496108_0729214 3300048911 Bacteria 858
617 Ga0496108_1160509 3300048911 Unclassified 654
618 Ga0496109_0010257 3300048912 Bacteria 7999
619 Ga0496109_0030220 3300048912 Bacteria 4856
620 Ga0496109_0033814 3300048912 Bacteria 4601
621 Ga0496109_0089545 3300048912 Bacteria 2845
622 Ga0496109_0497685 3300048912 Bacteria 1150
623 Ga0496109_0917993 3300048912 Bacteria 814
624 Ga0496109_1241211 3300048912 Bacteria 682
625 Ga0496109_1970183 3300048912 Unclassified 516
626 Ga0496109_2053631 3300048912 Unclassified 503
627 Ga0496110_0008688 3300048913 Bacteria 8180
628 Ga0496110_0048826 3300048913 Bacteria 3711
629 Ga0496110_0124504 3300048913 Bacteria 2325
630 Ga0496110_0238380 3300048913 Bacteria 1655
631 Ga0496111_0002119 3300048914 Bacteria 11851
632 Ga0496111_0215291 3300048914 Bacteria 1427
633 Ga0496111_0407579 3300048914 Bacteria 1004
634 Ga0496111_0644509 3300048914 Bacteria 773
635 Ga0496111_0730300 3300048914 Bacteria 719
636 Ga0496112_0009795 3300048915 Bacteria 8654
637 Ga0496112_0067812 3300048915 Bacteria 3522
638 Ga0496112_0134055 3300048915 Bacteria 2447
639 Ga0496112_0134105 3300048915 Bacteria 2447
640 Ga0496112_0162668 3300048915 Bacteria 2198
641 Ga0496112_0255638 3300048915 Bacteria 1702
642 Ga0496112_0293270 3300048915 Bacteria 1572
643 Ga0496112_0389840 3300048915 Bacteria 1333
644 Ga0496112_0651205 3300048915 Bacteria 983
645 Ga0496112_0889194 3300048915 Bacteria 813
646 Ga0496113_0020361 3300048916 Bacteria 4662
647 Ga0496113_0145329 3300048916 Bacteria 1868
648 Ga0496113_0540277 3300048916 Bacteria 935
649 Ga0496113_0849194 3300048916 Bacteria 724
650 Ga0496113_1247083 3300048916 Bacteria 579
651 Ga0496114_0003302 3300048917 Bacteria 12388
652 Ga0496114_0006836 3300048917 Bacteria 8986
653 Ga0496114_0017925 3300048917 Bacteria 5723
654 Ga0496114_0022775 3300048917 Bacteria 5106
655 Ga0496114_0054280 3300048917 Bacteria 3342
656 Ga0496115_0003682 3300048918 Bacteria 11029
657 Ga0496115_0012058 3300048918 Bacteria 6499
658 Ga0496115_0072543 3300048918 Bacteria 2793
659 Ga0496115_0133505 3300048918 Bacteria 2046
660 Ga0496115_0276012 3300048918 Bacteria 1380
661 Ga0496115_0276606 3300048918 Bacteria 1379
662 Ga0496115_0368063 3300048918 Bacteria 1170
663 Ga0501034_0045751 3300049571 Bacteria 4421
664 Ga0501047_0987695 3300049581 Bacteria 655
665 Ga0501067_0030525 3300049583 Bacteria 2989
666 Ga0501068_0155866 3300049584 Bacteria 1438
667 Ga0501069_0067488 3300049585 Bacteria 2001
668 Ga0501070_0074769 3300049586 Bacteria 2805
669 Ga0501070_0908572 3300049586 Bacteria 686
670 Ga0501072_0246925 3300049588 Bacteria 1421
671 Ga0501073_0046759 3300049589 Bacteria 3042
672 Ga0501073_0262289 3300049589 Bacteria 1192
673 Ga0501074_0019738 3300049590 Bacteria 4895
674 Ga0501074_0459485 3300049590 Bacteria 902
675 Ga0501079_0551297 3300049741 Bacteria 906
676 Ga0501079_1257023 3300049741 Bacteria 583
677 Ga0501079_1656494 3300049741 Bacteria 503
678 Ga0501080_0026197 3300049742 Bacteria 5417
679 Ga0501080_0245688 3300049742 Bacteria 1632
680 Ga0501083_0001476 3300049744 Bacteria 16080
681 nmdc:mga08y16_655212_c1 3300050511 Bacteria 1054
682 nmdc:mga0n895_120375_c1 3300050512 Bacteria 2646
683 nmdc:mga0n895_86746_c1 3300050512 Bacteria 3127
684 nmdc:mga08x19_116723_c1 3300050514 Bacteria 1785
685 nmdc:mga08x19_790492_c1 3300050514 Unclassified 674
686 nmdc:mga0a205_52614_c1 3300050515 Bacteria 3929
687 Ga0495601_0061078 3300053077 Bacteria 2392
688 Ga0495601_0070362 3300053077 Bacteria 2233
689 Ga0495601_0164187 3300053077 Bacteria 1451
690 Ga0495601_0232736 3300053077 Bacteria 1203
691 Ga0495612_0182733 3300053078 Bacteria 921
692 Ga0495612_0202714 3300053078 Bacteria 875
693 Ga0495612_0206972 3300053078 Bacteria 866
694 Ga0495595_0054203 3300053084 Bacteria 1864
695 Ga0495595_0199741 3300053084 Bacteria 995
696 Ga0495595_0287640 3300053084 Bacteria 826
697 Ga0495619_0042062 3300053085 Bacteria 2991
698 Ga0495619_0053871 3300053085 Bacteria 2662
699 Ga0495619_0290563 3300053085 Bacteria 1132
700 Ga0500566_0295692 3300053094 Bacteria 764
701 Ga0501084_0389253 3300054114 Bacteria 1178
702 Ga0587066_005506 3300059490 Bacteria 1624
703 Ga0587066_021765 3300059490 Bacteria 1066
704 Ga0587066_177396 3300059490 Unclassified 546
705 Ga0587070_047127 3300059491 Unclassified 847
706 Ga0587073_0080995 3300059492 Bacteria 806
707 Ga0587080_160732 3300059503 Bacteria 527
708 Ga0587082_038246 3300059504 Bacteria 868
709 Ga0587083_0013353 3300059505 Bacteria 1398
710 Ga0587091_016320 3300059511 Bacteria 1237
711 Ga0587091_081996 3300059511 Bacteria 726
712 Ga0587092_074056 3300059512 Bacteria 661
713 Ga0587094_019247 3300059513 Bacteria 978
714 Ga0587106_006251 3300059605 Bacteria 1396
715 Ga0587106_047799 3300059605 Bacteria 749
716 Ga0587067_012061 3300059640 Bacteria 1343
717 Ga0587067_038041 3300059640 Bacteria 922
718 Ga0587068_059680 3300059641 Bacteria 731
719 Ga0587079_001379 3300059647 Bacteria 2697
720 Ga0587079_031750 3300059647 Bacteria 1019
721 Ga0587079_118514 3300059647 Bacteria 652
722 Ga0587105_003541 3300059651 Bacteria 955
723 Ga0587119_010442 3300059658 Unclassified 1054
724 Ga0501082_0610619 3300060353 Bacteria 954
725 Ga0466962_0000842 3300061719 Bacteria 13849
726 Ga0466962_0002125 3300061719 Bacteria 9360
727 Ga0466962_0021193 3300061719 Bacteria 3121
728 Ga0466962_0034161 3300061719 Bacteria 2433
729 Ga0466962_0061024 3300061719 Bacteria 1800
730 Ga0466962_0206583 3300061719 Bacteria 960
731 Ga0466962_0220803 3300061719 Unclassified 928
732 Ga0466962_0324876 3300061719 Bacteria 763
733 Ga0207661_10451920
734 rootH2_10242497
735 Ga0070658_10165264
736 Ga0070658_10285233
737 Ga0070658_10533998
738 Ga0070658_10827512
739 Ga0070683_100057022
740 Ga0070683_100502911
741 Ga0070683_100644605
742 Ga0070680_100797262
743 Ga0070680_101824412
744 Ga0070680_102004643
745 Ga0070682_100236095
746 Ga0070682_101030193
747 Ga0068868_101402631
748 Ga0070660_100014749
749 Ga0070660_100493382
750 Ga0070660_100581076
751 Ga0070660_101291891
752 Ga0070691_10470561
753 Ga0070661_100102660
754 Ga0070661_100850671
755 Ga0070671_100262684
756 Ga0070673_100433353
757 Ga0070659_100507150
758 Ga0070667_102340795
759 Ga0070709_10009852
760 Ga0070709_10119175
761 Ga0070709_10610163
762 Ga0070709_11026629
763 Ga0070714_100009556
764 Ga0070714_100013451
765 Ga0070714_100016784
766 Ga0070714_100091422
767 Ga0070714_100464538
768 Ga0070714_100680885
769 Ga0070714_100742323
770 Ga0070714_101623656
771 Ga0070713_100018202
772 Ga0070713_100066952
773 Ga0070713_100144307
774 Ga0070713_100864383
775 Ga0070710_10004489
776 Ga0070710_10015865
777 Ga0070711_100009830
778 Ga0070711_100103479
779 Ga0070711_101961789
780 Ga0070711_101982945
781 Ga0070708_102163272
782 Ga0070663_100753443
783 Ga0070678_100387042
784 Ga0070681_10122844
785 Ga0070681_10263204
786 Ga0070681_10325630
787 Ga0070681_10455229
788 Ga0070681_10691158
789 Ga0070681_11205607
790 Ga0070706_100444898
791 Ga0070707_100027516
792 Ga0070707_100437140
793 Ga0070707_101899631
794 Ga0070698_100037982
795 Ga0070698_100294250
796 Ga0070698_100669878
797 Ga0070699_100059619
798 Ga0070679_100273046
799 Ga0070679_100366936
800 Ga0070679_101106015
801 Ga0070679_101145457
802 Ga0070684_100023525
803 Ga0070684_100077503
804 Ga0070684_100475811
805 Ga0070697_100417963
806 Ga0070697_101070117
807 Ga0068853_100086737
808 Ga0070695_100396879
809 Ga0070695_100901717
810 Ga0070695_101009387
811 Ga0070696_100267827
812 Ga0070665_100740264
813 Ga0070704_100027480
814 Ga0068855_100949609
815 Ga0068855_101180815
816 Ga0068855_102335757
817 Ga0068856_100084012
818 Ga0068856_102126569
819 Ga0068852_100235342
820 Ga0068864_102691603
821 Ga0068866_10466455
822 Ga0068863_100334169
823 Ga0068863_100683010
824 Ga0068858_101934521
825 Ga0070717_10001309
826 Ga0070717_10002987
827 Ga0070717_10006721
828 Ga0070717_10012873
829 Ga0070717_10058761
830 Ga0070715_10000128
831 Ga0070716_100018752
832 Ga0070716_100237638
833 Ga0070716_100270202
834 Ga0070716_101466096
835 Ga0070712_100046418
836 Ga0070712_100139545
837 Ga0070712_100369112
838 Ga0070712_100625706
839 Ga0070712_100675348
840 Ga0070712_101444311
841 Ga0068871_100300373
842 Ga0075433_10062389
843 Ga0075434_100052927
844 Ga0068865_100332247
845 Ga0075436_100122419
846 Ga0075436_100383296
847 Ga0105240_10040447
848 Ga0105240_11485853
849 Ga0111539_10435828
850 Ga0105245_10056263
851 Ga0105245_10360289
852 Ga0105247_10444176
853 Ga0105243_12936970
854 Ga0105242_10945001
855 Ga0105248_10128263
856 Ga0105248_10643864
857 Ga0105237_10013009
858 Ga0105238_10070118
859 Ga0105238_10932210
860 Ga0105238_11429616
861 Ga0105239_12484029
862 Ga0157373_10747666
863 Ga0157373_10969027
864 Ga0157373_11321126
865 Ga0157370_10044813
866 Ga0157370_10211925
867 Ga0157370_10223079
868 Ga0157369_10007929
869 Ga0157369_10201450
870 Ga0157369_10438060
871 Ga0157369_12046922
872 Ga0157374_10015556
873 Ga0163162_10378448
874 Ga0157372_10090949
875 Ga0157372_12158510
876 Ga0157372_12375241
877 Ga0157375_11465055
878 Ga0163163_10236022
879 Ga0157380_10697635
880 Ga0182008_10125148
881 Ga0182008_10235020
882 Ga0182008_10278497
883 Ga0157377_10115554
884 Ga0157377_10560323
885 Ga0157379_11642913
886 Ga0157379_12147933
887 Ga0157376_10135273
888 Ga0157376_11127080
889 Ga0197907_10658307
890 Ga0197907_10930357
891 Ga0197907_11490104
892 Ga0206356_10315597
893 Ga0206356_10592217
894 Ga0206356_11558539
895 Ga0206354_11269589
896 Ga0206354_11673090
897 Ga0206353_10800247
898 Ga0206353_11130274
899 Ga0206353_11636931
900 Ga0154015_1293283
901 Ga0224712_10029772
902 Ga0224712_10241706
903 Ga0207692_10028233
904 Ga0207692_10068704
905 Ga0207692_10382714
906 Ga0207642_10393663
907 Ga0207710_10563866
908 Ga0207685_10001914
909 Ga0207699_10033221
910 Ga0207699_10102253
911 Ga0207699_11080158
912 Ga0207705_10050078
913 Ga0207705_10659118
914 Ga0207684_10211748
915 Ga0207707_10039266
916 Ga0207707_10156923
917 Ga0207707_10181760
918 Ga0207707_10372190
919 Ga0207707_10443114
920 Ga0207695_10221153
921 Ga0207693_10001852
922 Ga0207693_10002202
923 Ga0207693_10261452
924 Ga0207693_10387199
925 Ga0207693_10392841
926 Ga0207693_10609387
927 Ga0207693_11304383
928 Ga0207663_10003571
929 Ga0207663_10006777
930 Ga0207663_10364123
931 Ga0207660_10065540
932 Ga0207660_10543471
933 Ga0207660_10716263
934 Ga0207660_11482922
935 Ga0207657_10024027
936 Ga0207657_10218386
937 Ga0207657_10277518
938 Ga0207657_10546189
939 Ga0207657_10589688
940 Ga0207649_10081336
941 Ga0207652_10020914
942 Ga0207652_10051514
943 Ga0207652_10564496
944 Ga0207652_10919581
945 Ga0207652_11875598
946 Ga0207646_10002470
947 Ga0207646_10144468
948 Ga0207646_10208876
949 Ga0207687_10080371
950 Ga0207687_10254123
951 Ga0207700_10024718
952 Ga0207700_10219661
953 Ga0207700_10890208
954 Ga0207700_11171900
955 Ga0207700_11552531
956 Ga0207664_10004974
957 Ga0207664_10025030
958 Ga0207664_10036123
959 Ga0207664_10090502
960 Ga0207664_10148476
961 Ga0207664_10155850
962 Ga0207664_10183927
963 Ga0207664_10291142
964 Ga0207664_10317772
965 Ga0207664_10455319
966 Ga0207664_10475102
967 Ga0207664_11058804
968 Ga0207644_10189502
969 Ga0207690_10093928
970 Ga0207686_10580547
971 Ga0207704_10267739
972 Ga0207665_10001140
973 Ga0207665_10184865
974 Ga0207665_10781820
975 Ga0207711_10433726
976 Ga0207661_10076588
977 Ga0207661_10120352
978 Ga0207661_11874339
979 Ga0207667_10382017
980 Ga0207667_10582644
981 Ga0207667_11464360
982 Ga0207640_11353799
983 Ga0207658_11960730
984 Ga0207639_11131418
985 Ga0207702_12515138
986 Ga0207683_11164028
987 Ga0207698_10094247
988 Ga0207698_10921616
989 Ga0207698_12237236
990 Ga0207428_10321631
991 Ga0268266_10643785
992 Ga0265337_1037492
993 Ga0265334_10150591
994 Ga0265318_10085108
995 Ga0265336_10031965
996 Ga0265336_10084073
997 Ga0265338_10003515
998 Ga0265338_10005836
999 Ga0265338_10270543
1000 Ga0265330_10020448
1001 Ga0265325_10130880
1002 Ga0265325_10235078
1003 Ga0265329_10126386
1004 Ga0265340_10207618
1005 Ga0265339_10014897
1006 Ga0265339_10283430
1007 Ga0265331_10044132
1008 Ga0265316_10110084
1009 Ga0265313_10121675
1010 Ga0265342_10139239
1011 Ga0373936_0092530
1012 Ga0373936_0242939
1013 Ga0373939_0094469
1014 Ga0373945_0060945
1015 Ga0373954_0139041
1016 Ga0373954_0327090
1017 Ga0373956_0276603
1018 Ga0373960_0135159
1019 Ga0373943_0007035
1020 Ga0373943_0912893
1021 Ga0373946_0651163
1022 Ga0373955_0894893
1023 Ga0373924_0215326
1024 Ga0373931_0016344
1025 Ga0373931_0777757
1026 Ga0373935_0227728
1027 Ga0373935_1514840
1028 Ga0373927_0309532
1029 Ga0373933_1102737
1030 Ga0373933_1138113
1031 Ga0373947_0012958
1032 Ga0373937_0918629
1033 Ga0373937_1044691
1034 Ga0373925_0001504
1035 Ga0373925_0931338
1036 Ga0395899_0221288
1037 Ga0395899_0738319
1038 Ga0395900_1014480
1039 Ga0395900_1119187
1040 Ga0395898_0026348
1041 Ga0395898_0303511
1042 Ga0395905_0263269
1043 Ga0395905_0805580
1044 Ga0395901_0244976
1045 Ga0395901_0261248
1046 Ga0395901_1088225
1047 Ga0451807_0172388
1048 Ga0451853_2907895
1049 Ga0451853_3352851
1050 Ga0439459_0071253
1051 Ga0466969_0001728
1052 Ga0466969_0014328
1053 Ga0466969_0289061
1054 Ga0466969_0570390
1055 Ga0466972_0003611
1056 Ga0466965_0022263
1057 Ga0466965_0024918
1058 Ga0466965_0057541
1059 Ga0466965_0074413
1060 Ga0466965_0371919
1061 Ga0466966_0021143
1062 Ga0466966_0054866
1063 Ga0466966_0067455
1064 Ga0466966_0077354
1065 Ga0466966_0361168
1066 Ga0466966_0376078
1067 Ga0466966_1013604
1068 Ga0466961_0012267
1069 Ga0466961_0012971
1070 Ga0466961_0020428
1071 Ga0466961_0052103
1072 Ga0466961_0248860
1073 Ga0466961_0273387
1074 Ga0466961_0790877
1075 Ga0466963_0002677
1076 Ga0466963_0003734
1077 Ga0466963_0003889
1078 Ga0466963_0004523
1079 Ga0466963_0017986
1080 Ga0466963_0024454
1081 Ga0466963_0029057
1082 Ga0466963_0049994
1083 Ga0466963_0060809
1084 Ga0466963_0062243
1085 Ga0466963_0066702
1086 Ga0466963_0088349
1087 Ga0466963_0154117
1088 Ga0466963_0971554
1089 Ga0466963_1141781
1090 Ga0466964_0000362
1091 Ga0466964_0003274
1092 Ga0466964_0005636
1093 Ga0466964_0013029
1094 Ga0466964_0021996
1095 Ga0466964_0049083
1096 Ga0466964_0054016
1097 Ga0466964_0057899
1098 Ga0466964_0121606
1099 Ga0466964_0152791
1100 Ga0466964_0614159
1101 Ga0466964_0870461
1102 Ga0466971_0004244
1103 Ga0466971_0007535
1104 Ga0466971_0015897
1105 Ga0466971_0039481
1106 Ga0466971_0088107
1107 Ga0466971_0094646
1108 Ga0466971_0167875
1109 Ga0466971_0259356
1110 Ga0466968_0003489
1111 Ga0466968_0004050
1112 Ga0466968_0015982
1113 Ga0466968_0061187
1114 Ga0466968_0173043
1115 Ga0466968_0339798
1116 Ga0466970_0006773
1117 Ga0466970_0011420
1118 Ga0466970_0161314
1119 Ga0466970_0742370
1120 Ga0466957_0002871
1121 Ga0466957_0022414
1122 Ga0466957_0027711
1123 Ga0466957_0063359
1124 Ga0466957_0082741
1125 Ga0466957_0089088
1126 Ga0466957_0177289
1127 Ga0466957_0221439
1128 Ga0466957_0243526
1129 Ga0466957_0255640
1130 Ga0466960_0003431
1131 Ga0466960_0007474
1132 Ga0466960_0264269
1133 Ga0466960_0476464
1134 Ga0466959_0015151
1135 Ga0466959_0028595
1136 Ga0466959_0045372
1137 Ga0466959_0047599
1138 Ga0466959_0098424
1139 Ga0466959_0108746
1140 Ga0466959_0200013
1141 Ga0466959_0247458
1142 Ga0466959_0291873
1143 Ga0466959_0654105
1144 Ga0466958_0005502
1145 Ga0466958_0010539
1146 Ga0466958_0019328
1147 Ga0466958_0023800
1148 Ga0466958_0037277
1149 Ga0466958_0065093
1150 Ga0466958_0159614
1151 Ga0466958_0211253
1152 Ga0466958_0224876
1153 Ga0466958_0683554
1154 Ga0466967_0000588
1155 Ga0466967_0002741
1156 Ga0466967_0009087
1157 Ga0466967_0011112
1158 Ga0466967_0015563
1159 Ga0466967_0015869
1160 Ga0466967_0024931
1161 Ga0466967_0025315
1162 Ga0466967_0041434
1163 Ga0466967_0066511
1164 Ga0466967_0069791
1165 Ga0466967_0086823
1166 Ga0466967_0089734
1167 Ga0466967_0118182
1168 Ga0466967_0144935
1169 Ga0466967_0153955
1170 Ga0466967_0171971
1171 Ga0466967_0277610
1172 Ga0466967_0367674
1173 Ga0466967_0384811
1174 Ga0466967_0527439
1175 Ga0466967_0533931
1176 Ga0466967_0636014
1177 Ga0466967_0866785
1178 Ga0495592_0073320
1179 Ga0495592_0108898
1180 Ga0495603_0361147
1181 Ga0495629_0052079
1182 Ga0495629_0122416
1183 Ga0495629_0191158
1184 Ga0495629_0227609
1185 Ga0495629_0434542
1186 Ga0495629_0686604
1187 Ga0495629_1141041
1188 Ga0495641_0006277
1189 Ga0495641_0050149
1190 Ga0495641_0539589
1191 Ga0495651_0371533
1192 Ga0495651_0475908
1193 Ga0495653_0025246
1194 Ga0495653_0202250
1195 Ga0495653_0447987
1196 Ga0495580_0056079
1197 Ga0495580_0188810
1198 Ga0495580_0331796
1199 Ga0495582_0042259
1200 Ga0495582_0061754
1201 Ga0495582_0304955
1202 Ga0495639_0020866
1203 Ga0495639_0056907
1204 Ga0495662_0007094
1205 Ga0495662_0061466
1206 Ga0495662_0080368
1207 Ga0495664_0021631
1208 Ga0495664_0122215
1209 Ga0495664_0278092
1210 Ga0495664_0480821
1211 Ga0495594_0103095
1212 Ga0495608_0016503
1213 Ga0495608_0099298
1214 Ga0495608_0372475
1215 Ga0495618_0034424
1216 Ga0495618_0038952
1217 Ga0495618_0293207
1218 Ga0495618_0854013
1219 Ga0495628_1128810
1220 Ga0495630_0009985
1221 Ga0495630_0109104
1222 Ga0495630_0146692
1223 Ga0495630_0294754
1224 Ga0495630_0513796
1225 Ga0495630_1081934
1226 Ga0495666_0002192
1227 Ga0495666_0307118
1228 Ga0495652_0093805
1229 Ga0495652_0196150
1230 Ga0495652_0575785
1231 Ga0495665_0034830
1232 Ga0495665_0438578
1233 Ga0495640_0011544
1234 Ga0495640_0050437
1235 Ga0495640_0239619
1236 Ga0495640_0703054
1237 Ga0495586_0008595
1238 Ga0495586_0091657
1239 Ga0495587_0321404
1240 Ga0495645_0012102
1241 Ga0495645_0182910
1242 Ga0495645_0477492
1243 Ga0495622_0338950
1244 Ga0495667_0013950
1245 Ga0495667_0154158
1246 Ga0495667_0386974
1247 Ga0495667_0511884
1248 Ga0495667_0745733
1249 Ga0495634_0049928
1250 Ga0495634_0150508
1251 Ga0495634_0184963
1252 Ga0495634_0418794
1253 Ga0495635_0029691
1254 Ga0495635_0075934
1255 Ga0495635_0207804
1256 Ga0495635_0309489
1257 Ga0495657_0072837
1258 Ga0495657_0204335
1259 Ga0495657_0258318
1260 Ga0495599_0350691
1261 Ga0495623_0121914
1262 Ga0495646_0097623
1263 Ga0495646_0170128
1264 Ga0495647_0003731
1265 Ga0495647_0018568
1266 Ga0495647_0091281
1267 Ga0495647_0419902
1268 Ga0495658_0004658
1269 Ga0495658_0030384
1270 Ga0495658_0161638
1271 Ga0495658_0305137
1272 Ga0495613_0008663
1273 Ga0495613_0014645
1274 Ga0495613_0180533
1275 Ga0495613_0250234
1276 Ga0495613_0661285
1277 Ga0495624_0009082
1278 Ga0495624_0011507
1279 Ga0495624_0269582
1280 Ga0495600_0272767
1281 Ga0495600_0438966
1282 Ga0495581_0035967
1283 Ga0495581_0038666
1284 Ga0495604_0047389
1285 Ga0495674_0045748
1286 Ga0495674_0189757
1287 Ga0495674_0228725
1288 Ga0495674_0337305
1289 Ga0495674_1054738
1290 Ga0495676_0064384
1291 Ga0495676_0160742
1292 Ga0495676_0228331
1293 Ga0495676_0387244
1294 Ga0495676_0437261
1295 Ga0495680_0040915
1296 Ga0495680_0747687
1297 Ga0495680_0804760
1298 Ga0495675_0364802
1299 Ga0495684_0009525
1300 Ga0495684_0329508
1301 Ga0495684_0518665
1302 Ga0495593_0004077
1303 Ga0495602_0659198
1304 Ga0495602_0831243
1305 Ga0495614_0000498
1306 Ga0496100_0045112
1307 Ga0496100_0190339
1308 Ga0496100_0296896
1309 Ga0496100_0525238
1310 Ga0496101_0012681
1311 Ga0496101_0100887
1312 Ga0496101_0102518
1313 Ga0496101_0133926
1314 Ga0496101_0576261
1315 Ga0496102_0002973
1316 Ga0496102_0021317
1317 Ga0496102_0501193
1318 Ga0496102_0653637
1319 Ga0496102_1224726
1320 Ga0496103_0004486
1321 Ga0496103_0072165
1322 Ga0496103_0218232
1323 Ga0496104_0076644
1324 Ga0496104_0109420
1325 Ga0496104_0136307
1326 Ga0496104_0258407
1327 Ga0496104_0399366
1328 Ga0496104_0550489
1329 Ga0496104_0741538
1330 Ga0496105_0009379
1331 Ga0496105_0043138
1332 Ga0496105_0060934
1333 Ga0496105_0126362
1334 Ga0496105_0206200
1335 Ga0496105_0239651
1336 Ga0496106_0012999
1337 Ga0496106_0013479
1338 Ga0496107_0003330
1339 Ga0496107_0010143
1340 Ga0496107_0047369
1341 Ga0496107_0058346
1342 Ga0496107_0099906
1343 Ga0496108_0009721
1344 Ga0496108_0021737
1345 Ga0496108_0092303
1346 Ga0496108_0196326
1347 Ga0496108_0234569
1348 Ga0496108_0729214
1349 Ga0496108_1160509
1350 Ga0496109_0010257
1351 Ga0496109_0030220
1352 Ga0496109_0033814
1353 Ga0496109_0089545
1354 Ga0496109_0497685
1355 Ga0496109_0917993
1356 Ga0496109_1241211
1357 Ga0496109_1970183
1358 Ga0496109_2053631
1359 Ga0496110_0008688
1360 Ga0496110_0048826
1361 Ga0496110_0124504
1362 Ga0496110_0238380
1363 Ga0496111_0002119
1364 Ga0496111_0215291
1365 Ga0496111_0407579
1366 Ga0496111_0644509
1367 Ga0496111_0730300
1368 Ga0496112_0009795
1369 Ga0496112_0067812
1370 Ga0496112_0134055
1371 Ga0496112_0134105
1372 Ga0496112_0162668
1373 Ga0496112_0255638
1374 Ga0496112_0293270
1375 Ga0496112_0389840
1376 Ga0496112_0651205
1377 Ga0496112_0889194
1378 Ga0496113_0020361
1379 Ga0496113_0145329
1380 Ga0496113_0540277
1381 Ga0496113_0849194
1382 Ga0496113_1247083
1383 Ga0496114_0003302
1384 Ga0496114_0006836
1385 Ga0496114_0017925
1386 Ga0496114_0022775
1387 Ga0496114_0054280
1388 Ga0496115_0003682
1389 Ga0496115_0012058
1390 Ga0496115_0072543
1391 Ga0496115_0133505
1392 Ga0496115_0276012
1393 Ga0496115_0276606
1394 Ga0496115_0368063
1395 Ga0501034_0045751
1396 Ga0501047_0987695
1397 Ga0501067_0030525
1398 Ga0501068_0155866
1399 Ga0501069_0067488
1400 Ga0501070_0074769
1401 Ga0501070_0908572
1402 Ga0501072_0246925
1403 Ga0501073_0046759
1404 Ga0501073_0262289
1405 Ga0501074_0019738
1406 Ga0501074_0459485
1407 Ga0501079_0551297
1408 Ga0501079_1257023
1409 Ga0501079_1656494
1410 Ga0501080_0026197
1411 Ga0501080_0245688
1412 Ga0501083_0001476
1413 nmdc:mga08y16_655212_c1
1414 nmdc:mga0n895_120375_c1
1415 nmdc:mga0n895_86746_c1
1416 nmdc:mga08x19_116723_c1
1417 nmdc:mga08x19_790492_c1
1418 nmdc:mga0a205_52614_c1
1419 Ga0495601_0061078
1420 Ga0495601_0070362
1421 Ga0495601_0164187
1422 Ga0495601_0232736
1423 Ga0495612_0182733
1424 Ga0495612_0202714
1425 Ga0495612_0206972
1426 Ga0495595_0054203
1427 Ga0495595_0199741
1428 Ga0495595_0287640
1429 Ga0495619_0042062
1430 Ga0495619_0053871
1431 Ga0495619_0290563
1432 Ga0500566_0295692
1433 Ga0501084_0389253
1434 Ga0587066_005506
1435 Ga0587066_021765
1436 Ga0587066_177396
1437 Ga0587070_047127
1438 Ga0587073_0080995
1439 Ga0587080_160732
1440 Ga0587082_038246
1441 Ga0587083_0013353
1442 Ga0587091_016320
1443 Ga0587091_081996
1444 Ga0587092_074056
1445 Ga0587094_019247
1446 Ga0587106_006251
1447 Ga0587106_047799
1448 Ga0587067_012061
1449 Ga0587067_038041
1450 Ga0587068_059680
1451 Ga0587079_001379
1452 Ga0587079_031750
1453 Ga0587079_118514
1454 Ga0587105_003541
1455 Ga0587119_010442
1456 Ga0501082_0610619
1457 Ga0466962_0000842
1458 Ga0466962_0002125
1459 Ga0466962_0021193
1460 Ga0466962_0034161
1461 Ga0466962_0061024
1462 Ga0466962_0206583
1463 Ga0466962_0220803
1464 Ga0466962_0324876

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7765 1 93
2ftr-assembly1.cif.gz_B crystal structure of an ethyl tert-butyl ether d (ethd) family protein (bh0200) from bacillus halodurans c-125 at 1.40 a resolution 0.7696 1 93
2q3p-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at3g17210 from arabidopsis thaliana 0.7309 2 93
2q3p-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of at3g17210 from arabidopsis thaliana 0.7185 2 93
1si9-assembly1.cif.gz_A boiling stable protein isolated from populus tremula 0.7177 2 93
ID Description Score Start End Superfamily
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7375 2 93 3.30.70.100
1si9C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7249 2 93 3.30.70.100
3hdsA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7217 1 91 3.30.70.100
3lo3U00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7053 2 91 3.30.70.100
3hdsA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7027 1 91 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A7W1N3B7-F1-model_v4 ABM domain-containing protein 0.9771 5 93
AF-A0A538F0E6-F1-model_v4 EthD family reductase 0.9474 1 93
AF-A0A538F0E6-F1-model_v4 EthD family reductase 0.9376 1 93
AF-A0A7W1N3B7-F1-model_v4 ABM domain-containing protein 0.9359 5 93
AF-A0A7V9FN34-F1-model_v4 ABM domain-containing protein 0.9346 1 93

Map