F478019

General Info

Members Datasets Scaffolds Average Seq Length
732 283 1464 140

Family's Representative Sequence

Representative Sequence 3300005718|Ga0068866_10405671|Ga0068866_104056711
Length 155
Sequence MKVASPIPKKHARIEIIPLIDIMFFLLASFMMVSLSQTHMKGIRVNLPAPQAAPPNTNKDFVSIRVAEGPVYYVENQAMNDDQEVMNRLDQMHRANPDIKVSISAEVMAKHGDVIRVLDHIRTLKIQKVGYQIRAAQLGGARTVAPPPAPGAPPP

Samples

Sample ID Description Type Environment
1 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
106 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
107 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
108 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
109 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
110 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026796 Rhizosphere microbial communities from Harvard Forest, USA - 6Rhizosphere_unsorted metaG (SPAdes) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
190 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
193 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
194 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
195 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
226 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
238 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.88
Rhizosphere 89.48
Stem 0
Stem Tuber 0
Unclassified 20.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068866_10405671 3300005718 Bacteria 880
2 SwRhRL2b_contig_2222690 2162886007 Bacteria 1497
3 CNXas_1000006 3300000545 Bacteria 45010
4 CNXas_1000250 3300000545 Bacteria 6239
5 JGI24738J21930_10121898 3300002075 Bacteria 567
6 JGI24035J26624_1000343 3300002126 Bacteria 4362
7 JGI24035J26624_1003646 3300002126 Bacteria 1454
8 JGI24035J26624_1011157 3300002126 Unclassified 898
9 JGI25405J52794_10000193 3300003911 Bacteria 7817
10 JGI25405J52794_10080984 3300003911 Bacteria 714
11 Ga0065704_10010350 3300005289 Bacteria 3541
12 Ga0065704_10019275 3300005289 Bacteria 2070
13 Ga0065704_10126111 3300005289 Bacteria 1694
14 Ga0065704_10335979 3300005289 Bacteria 827
15 Ga0065712_10000352 3300005290 Bacteria 15992
16 Ga0065712_10020765 3300005290 Bacteria 1735
17 Ga0065712_10069732 3300005290 Bacteria 6789
18 Ga0065712_10241197 3300005290 Bacteria 984
19 Ga0065712_10339517 3300005290 Bacteria 792
20 Ga0065715_10003837 3300005293 Bacteria 3808
21 Ga0065715_10091353 3300005293 Bacteria 5851
22 Ga0065715_10232131 3300005293 Bacteria 1230
23 Ga0065715_10264791 3300005293 Bacteria 1127
24 Ga0065707_10016321 3300005295 Bacteria 2286
25 Ga0065707_10026696 3300005295 Bacteria 1501
26 Ga0070658_10094356 3300005327 Bacteria 2469
27 Ga0070658_10308592 3300005327 Bacteria 1350
28 Ga0070676_10059556 3300005328 Bacteria 2265
29 Ga0070676_10200071 3300005328 Bacteria 1309
30 Ga0070676_10626936 3300005328 Bacteria 778
31 Ga0070683_100001630 3300005329 Bacteria 17370
32 Ga0070683_100327237 3300005329 Bacteria 1459
33 Ga0070683_100503275 3300005329 Viruses 1157
34 Ga0070683_100520519 3300005329 Unclassified 1137
35 Ga0070683_100689922 3300005329 Unclassified 978
36 Ga0070690_100006260 3300005330 Bacteria 6749
37 Ga0070690_100019502 3300005330 Bacteria 4117
38 Ga0070690_100318728 3300005330 Bacteria 1119
39 Ga0070690_100959507 3300005330 Unclassified 672
40 Ga0070690_101069679 3300005330 Unclassified 638
41 Ga0070670_100319471 3300005331 Bacteria 1360
42 Ga0070677_10069065 3300005333 Bacteria 1481
43 Ga0070666_10162364 3300005335 Bacteria 1562
44 Ga0070666_10241087 3300005335 Bacteria 1278
45 Ga0070666_10785390 3300005335 Bacteria 701
46 Ga0070680_100094736 3300005336 Bacteria 2475
47 Ga0068868_100038852 3300005338 Bacteria 3695
48 Ga0068868_100102559 3300005338 Bacteria 2317
49 Ga0068868_100150803 3300005338 Bacteria 1914
50 Ga0068868_100585966 3300005338 Bacteria 986
51 Ga0068868_100640299 3300005338 Bacteria 946
52 Ga0068868_100964580 3300005338 Bacteria 778
53 Ga0070660_100252775 3300005339 Bacteria 1438
54 Ga0070689_100004055 3300005340 Bacteria 9857
55 Ga0070689_100046445 3300005340 Bacteria 3347
56 Ga0070689_100129289 3300005340 Bacteria 2024
57 Ga0070687_100294173 3300005343 Bacteria 1028
58 Ga0070687_100975426 3300005343 Unclassified 613
59 Ga0070661_100023744 3300005344 Bacteria 4398
60 Ga0070661_100410753 3300005344 Bacteria 1072
61 Ga0070692_10067725 3300005345 Unclassified 1896
62 Ga0070668_100035530 3300005347 Bacteria 3800
63 Ga0070668_100104331 3300005347 Bacteria 2250
64 Ga0070668_101136598 3300005347 Unclassified 706
65 Ga0070669_100022002 3300005353 Bacteria 4560
66 Ga0070669_100247784 3300005353 Bacteria 1417
67 Ga0070669_100699422 3300005353 Bacteria 856
68 Ga0070669_101535309 3300005353 Bacteria 579
69 Ga0070675_100005723 3300005354 Bacteria 9511
70 Ga0070675_100026836 3300005354 Bacteria 4623
71 Ga0070675_100042948 3300005354 Bacteria 3693
72 Ga0070675_100052427 3300005354 Bacteria 3354
73 Ga0070675_101294595 3300005354 Unclassified 672
74 Ga0070671_100033630 3300005355 Bacteria 4242
75 Ga0070671_100034781 3300005355 Bacteria 4172
76 Ga0070671_100218498 3300005355 Bacteria 1617
77 Ga0070671_100386203 3300005355 Bacteria 1197
78 Ga0070674_100348374 3300005356 Bacteria 1195
79 Ga0070674_100700705 3300005356 Bacteria 866
80 Ga0070674_100706086 3300005356 Unclassified 863
81 Ga0070673_100094103 3300005364 Bacteria 2455
82 Ga0070673_100174322 3300005364 Bacteria 1837
83 Ga0070673_100272487 3300005364 Bacteria 1482
84 Ga0070673_100554281 3300005364 Unclassified 1044
85 Ga0070688_100009421 3300005365 Bacteria 5339
86 Ga0070688_100022074 3300005365 Bacteria 3724
87 Ga0070688_100026418 3300005365 Bacteria 3450
88 Ga0070688_100185244 3300005365 Bacteria 1446
89 Ga0070688_100635834 3300005365 Bacteria 820
90 Ga0070688_100972287 3300005365 Bacteria 673
91 Ga0070659_100191894 3300005366 Unclassified 1679
92 Ga0070667_100121132 3300005367 Bacteria 2276
93 Ga0070667_100265146 3300005367 Bacteria 1539
94 Ga0070703_10048925 3300005406 Unclassified 1344
95 Ga0070703_10128550 3300005406 Bacteria 928
96 Ga0070709_10065905 3300005434 Unclassified 2320
97 Ga0070709_10077783 3300005434 Bacteria 2157
98 Ga0070709_10092129 3300005434 Bacteria 2001
99 Ga0070709_10207495 3300005434 Bacteria 1391
100 Ga0070709_10884416 3300005434 Unclassified 705
101 Ga0070709_10956739 3300005434 Bacteria 679
102 Ga0070709_11172281 3300005434 Bacteria 617
103 Ga0070714_100388499 3300005435 Bacteria 1317
104 Ga0070714_101325437 3300005435 Bacteria 703
105 Ga0070714_101544318 3300005435 Unclassified 648
106 Ga0070713_100041635 3300005436 Bacteria 3743
107 Ga0070713_100083340 3300005436 Bacteria 2733
108 Ga0070713_100174494 3300005436 Bacteria 1928
109 Ga0070713_101009357 3300005436 Bacteria 803
110 Ga0070710_10041523 3300005437 Bacteria 2540
111 Ga0070710_10231599 3300005437 Bacteria 1180
112 Ga0070701_10068973 3300005438 Unclassified 1885
113 Ga0070711_100004608 3300005439 Bacteria 8163
114 Ga0070711_100019878 3300005439 Bacteria 4319
115 Ga0070711_100199342 3300005439 Bacteria 1544
116 Ga0070711_100275656 3300005439 Bacteria 1329
117 Ga0070711_100396773 3300005439 Bacteria 1119
118 Ga0070711_100436671 3300005439 Bacteria 1069
119 Ga0070711_100469468 3300005439 Bacteria 1033
120 Ga0070711_100939262 3300005439 Unclassified 740
121 Ga0070711_101179936 3300005439 Bacteria 662
122 Ga0070711_101681187 3300005439 Unclassified 556
123 Ga0070705_100029532 3300005440 Bacteria 3017
124 Ga0070705_100047627 3300005440 Bacteria 2479
125 Ga0070705_101320245 3300005440 Unclassified 599
126 Ga0070700_100024965 3300005441 Bacteria 3516
127 Ga0070694_100156341 3300005444 Unclassified 1669
128 Ga0070694_100589520 3300005444 Bacteria 894
129 Ga0070708_100027395 3300005445 Bacteria 4889
130 Ga0070708_100031031 3300005445 Bacteria 4623
131 Ga0070708_100092802 3300005445 Bacteria 2751
132 Ga0070708_100153884 3300005445 Bacteria 2140
133 Ga0070708_100264905 3300005445 Bacteria 1616
134 Ga0070708_100385374 3300005445 Bacteria 1322
135 Ga0070708_100427316 3300005445 Bacteria 1249
136 Ga0070708_100523524 3300005445 Bacteria 1118
137 Ga0070678_100028152 3300005456 Unclassified 3827
138 Ga0070678_100795265 3300005456 Bacteria 858
139 Ga0070662_100126993 3300005457 Bacteria 1961
140 Ga0070662_100221543 3300005457 Unclassified 1510
141 Ga0070662_100276032 3300005457 Unclassified 1359
142 Ga0070681_10018996 3300005458 Bacteria 6879
143 Ga0068867_100224964 3300005459 Bacteria 1514
144 Ga0070685_10019512 3300005466 Bacteria 3659
145 Ga0070685_10032358 3300005466 Bacteria 2929
146 Ga0070706_100000286 3300005467 Bacteria 61351
147 Ga0070706_100003298 3300005467 Bacteria 15966
148 Ga0070706_100107424 3300005467 Bacteria 2596
149 Ga0070706_100123084 3300005467 Bacteria 2418
150 Ga0070706_100163243 3300005467 Bacteria 2080
151 Ga0070706_100234356 3300005467 Bacteria 1714
152 Ga0070706_100407711 3300005467 Bacteria 1265
153 Ga0070706_100509188 3300005467 Unclassified 1120
154 Ga0070706_100531321 3300005467 Bacteria 1094
155 Ga0070706_100594059 3300005467 Bacteria 1029
156 Ga0070706_101378927 3300005467 Bacteria 645
157 Ga0070707_100158832 3300005468 Bacteria 2202
158 Ga0070707_100331569 3300005468 Unclassified 1478
159 Ga0070707_100339034 3300005468 Unclassified 1460
160 Ga0070707_100803032 3300005468 Bacteria 905
161 Ga0070707_100806288 3300005468 Bacteria 903
162 Ga0070698_100020545 3300005471 Bacteria 6923
163 Ga0070698_100053393 3300005471 Bacteria 4107
164 Ga0070698_100728672 3300005471 Bacteria 934
165 Ga0070699_100019406 3300005518 Bacteria 5852
166 Ga0070699_100174490 3300005518 Bacteria 1905
167 Ga0070699_100195344 3300005518 Bacteria 1799
168 Ga0070699_100866362 3300005518 Bacteria 827
169 Ga0070679_100013738 3300005530 Bacteria 7756
170 Ga0070684_100001714 3300005535 Bacteria 15968
171 Ga0070684_100127081 3300005535 Bacteria 2297
172 Ga0070684_100363249 3300005535 Bacteria 1332
173 Ga0070697_100012869 3300005536 Bacteria 6554
174 Ga0070697_100032866 3300005536 Bacteria 4177
175 Ga0070697_100037643 3300005536 Bacteria 3908
176 Ga0070697_100038604 3300005536 Bacteria 3859
177 Ga0070697_100041341 3300005536 Bacteria 3731
178 Ga0070697_100065591 3300005536 Bacteria 2967
179 Ga0070697_100085833 3300005536 Bacteria 2597
180 Ga0070697_100119947 3300005536 Unclassified 2199
181 Ga0070697_100145983 3300005536 Unclassified 1991
182 Ga0070697_100391106 3300005536 Bacteria 1205
183 Ga0068853_100335460 3300005539 Bacteria 1404
184 Ga0068853_100866238 3300005539 Bacteria 867
185 Ga0070672_100044524 3300005543 Bacteria 3428
186 Ga0070672_100163312 3300005543 Unclassified 1849
187 Ga0070672_100164955 3300005543 Bacteria 1840
188 Ga0070672_100342362 3300005543 Unclassified 1273
189 Ga0070672_101714034 3300005543 Bacteria 564
190 Ga0070686_100102732 3300005544 Bacteria 1934
191 Ga0070695_100025252 3300005545 Bacteria 3668
192 Ga0070696_100064022 3300005546 Unclassified 2576
193 Ga0070696_100825407 3300005546 Bacteria 764
194 Ga0070693_100024879 3300005547 Bacteria 3216
195 Ga0070665_100016081 3300005548 Bacteria 7508
196 Ga0070665_100065178 3300005548 Bacteria 3654
197 Ga0070665_100288031 3300005548 Unclassified 1645
198 Ga0070704_100004877 3300005549 Bacteria 7779
199 Ga0070664_100074588 3300005564 Bacteria 2912
200 Ga0070664_100095356 3300005564 Bacteria 2580
201 Ga0070664_100451298 3300005564 Bacteria 1180
202 Ga0068857_102256311 3300005577 Bacteria 534
203 Ga0068856_100004883 3300005614 Bacteria 13277
204 Ga0068856_100192879 3300005614 Bacteria 2051
205 Ga0068856_100395548 3300005614 Unclassified 1401
206 Ga0070702_100157067 3300005615 Bacteria 1466
207 Ga0070702_100346451 3300005615 Unclassified 1045
208 Ga0068864_100336616 3300005618 Bacteria 1421
209 Ga0068864_101162229 3300005618 Unclassified 769
210 Ga0068864_101417543 3300005618 Unclassified 697
211 Ga0068866_11067762 3300005718 Bacteria 577
212 Ga0068863_100016981 3300005841 Bacteria 6980
213 Ga0068863_100412245 3300005841 Unclassified 1323
214 Ga0068863_102583310 3300005841 Unclassified 517
215 Ga0068858_100005855 3300005842 Bacteria 12010
216 Ga0068858_100139119 3300005842 Bacteria 2279
217 Ga0068858_100541628 3300005842 Bacteria 1127
218 Ga0068860_100077785 3300005843 Bacteria 3155
219 Ga0068860_100834270 3300005843 Bacteria 936
220 Ga0068862_100508201 3300005844 Unclassified 1145
221 Ga0068862_100799420 3300005844 Bacteria 921
222 Ga0081455_10001521 3300005937 Bacteria 28596
223 Ga0081455_10029948 3300005937 Bacteria 4955
224 Ga0081455_10081972 3300005937 Bacteria 2640
225 Ga0081455_10095663 3300005937 Bacteria 2397
226 Ga0081455_10324818 3300005937 Bacteria 1095
227 Ga0081539_10001104 3300005985 Bacteria 49011
228 Ga0081539_10119418 3300005985 Bacteria 1312
229 Ga0070717_10003704 3300006028 Bacteria 10984
230 Ga0070717_10029096 3300006028 Bacteria 4429
231 Ga0070717_10229972 3300006028 Bacteria 1632
232 Ga0070717_10269262 3300006028 Bacteria 1509
233 Ga0070717_10430506 3300006028 Unclassified 1187
234 Ga0070717_10592678 3300006028 Bacteria 1005
235 Ga0070715_10104145 3300006163 Unclassified 1329
236 Ga0070715_10514524 3300006163 Unclassified 688
237 Ga0070716_100027561 3300006173 Bacteria 3053
238 Ga0070716_100032249 3300006173 Bacteria 2856
239 Ga0070716_100060611 3300006173 Bacteria 2186
240 Ga0070716_100064385 3300006173 Bacteria 2132
241 Ga0070716_100172530 3300006173 Bacteria 1413
242 Ga0070712_100010408 3300006175 Bacteria 5867
243 Ga0070712_100089536 3300006175 Bacteria 2251
244 Ga0070712_100166814 3300006175 Bacteria 1705
245 Ga0070712_100172237 3300006175 Bacteria 1680
246 Ga0070712_100178065 3300006175 Bacteria 1655
247 Ga0070712_100182503 3300006175 Unclassified 1636
248 Ga0070712_100187874 3300006175 Bacteria 1614
249 Ga0070712_100318960 3300006175 Bacteria 1263
250 Ga0070712_100354221 3300006175 Unclassified 1202
251 Ga0070712_100744005 3300006175 Bacteria 839
252 Ga0070712_100878779 3300006175 Bacteria 772
253 Ga0070712_101528399 3300006175 Unclassified 583
254 Ga0097621_100093184 3300006237 Bacteria 2524
255 Ga0097621_100200389 3300006237 Bacteria 1733
256 Ga0097621_100535148 3300006237 Bacteria 1065
257 Ga0068871_100094526 3300006358 Bacteria 2495
258 Ga0068871_100890192 3300006358 Unclassified 825
259 Ga0068871_100959705 3300006358 Bacteria 795
260 Ga0075428_100178732 3300006844 Bacteria 2297
261 Ga0075434_100421377 3300006871 Unclassified 1356
262 Ga0075434_100592621 3300006871 Unclassified 1128
263 Ga0075434_100637715 3300006871 Bacteria 1084
264 Ga0075434_101792655 3300006871 Bacteria 621
265 Ga0068865_100028325 3300006881 Unclassified 3707
266 Ga0068865_100058541 3300006881 Bacteria 2692
267 Ga0068865_100219310 3300006881 Bacteria 1486
268 Ga0068865_101448432 3300006881 Bacteria 614
269 Ga0075436_100062987 3300006914 Bacteria 2563
270 Ga0075436_100283900 3300006914 Bacteria 1184
271 Ga0075435_100149924 3300007076 Unclassified 1960
272 Ga0099794_10112573 3300007265 Unclassified 1365
273 Ga0099795_10031323 3300007788 Bacteria 1831
274 Ga0105250_10305513 3300009092 Bacteria 689
275 Ga0105240_10000022 3300009093 Bacteria 387911
276 Ga0105240_10000402 3300009093 Bacteria 80414
277 Ga0105240_10205383 3300009093 Bacteria 2306
278 Ga0105240_10456100 3300009093 Bacteria 1429
279 Ga0111539_10515144 3300009094 Unclassified 1393
280 Ga0111539_10730533 3300009094 Bacteria 1153
281 Ga0105245_10037816 3300009098 Bacteria 4292
282 Ga0105245_10059835 3300009098 Bacteria 3431
283 Ga0105245_10152367 3300009098 Bacteria 2187
284 Ga0105245_10606678 3300009098 Unclassified 1121
285 Ga0105247_10101161 3300009101 Bacteria 1843
286 Ga0105247_11428051 3300009101 Bacteria 561
287 Ga0114129_10031857 3300009147 Bacteria 7453
288 Ga0114129_10209977 3300009147 Bacteria 2632
289 Ga0114129_10316271 3300009147 Bacteria 2076
290 Ga0114129_10444804 3300009147 Bacteria 1701
291 Ga0114129_12216608 3300009147 Bacteria 661
292 Ga0105243_10080571 3300009148 Bacteria 2656
293 Ga0105243_10355624 3300009148 Bacteria 1346
294 Ga0105243_12585812 3300009148 Bacteria 547
295 Ga0105241_10026639 3300009174 Bacteria 4302
296 Ga0105242_10007333 3300009176 Bacteria 8488
297 Ga0105242_10408735 3300009176 Unclassified 1269
298 Ga0105242_10706865 3300009176 Bacteria 987
299 Ga0105242_10941866 3300009176 Bacteria 867
300 Ga0105242_12622461 3300009176 Bacteria 553
301 Ga0105248_10666372 3300009177 Unclassified 1174
302 Ga0105248_11767276 3300009177 Bacteria 701
303 Ga0105248_12038756 3300009177 Bacteria 652
304 Ga0105237_10434919 3300009545 Bacteria 1318
305 Ga0105237_11561243 3300009545 Bacteria 667
306 Ga0105238_10623407 3300009551 Bacteria 1087
307 Ga0105249_10203737 3300009553 Bacteria 1937
308 Ga0105249_10953054 3300009553 Bacteria 926
309 Ga0105249_11043982 3300009553 Bacteria 887
310 Ga0099796_10064664 3300010159 Unclassified 1306
311 Ga0099796_10242634 3300010159 Bacteria 745
312 Ga0105239_10091577 3300010375 Bacteria 3355
313 Ga0105239_10506762 3300010375 Bacteria 1372
314 Ga0105239_10521037 3300010375 Unclassified 1352
315 Ga0105239_11237784 3300010375 Bacteria 860
316 Ga0105239_12408371 3300010375 Bacteria 613
317 Ga0105246_10139446 3300011119 Bacteria 1821
318 Ga0105246_10142120 3300011119 Bacteria 1806
319 Ga0157336_1001788 3300012477 Unclassified 1151
320 Ga0157321_1006534 3300012487 Bacteria 797
321 Ga0157339_1007027 3300012505 Bacteria 935
322 Ga0157327_1005082 3300012512 Bacteria 1049
323 Ga0157326_1020676 3300012513 Unclassified 810
324 Ga0157338_1028405 3300012515 Bacteria 699
325 Ga0157373_10279336 3300013100 Viruses 1183
326 Ga0157371_10232172 3300013102 Unclassified 1326
327 Ga0157371_10581886 3300013102 Bacteria 832
328 Ga0157369_10052723 3300013105 Bacteria 4399
329 Ga0157369_10981595 3300013105 Bacteria 865
330 Ga0157369_11746148 3300013105 Unclassified 632
331 Ga0157374_10061584 3300013296 Bacteria 3515
332 Ga0157374_10061655 3300013296 Bacteria 3513
333 Ga0157374_10111369 3300013296 Bacteria 2633
334 Ga0157374_10168974 3300013296 Bacteria 2132
335 Ga0157374_10209800 3300013296 Bacteria 1909
336 Ga0157374_10403143 3300013296 Bacteria 1365
337 Ga0157374_10442095 3300013296 Unclassified 1301
338 Ga0157374_10873211 3300013296 Unclassified 917
339 Ga0157374_10956084 3300013296 Bacteria 875
340 Ga0157374_11201092 3300013296 Unclassified 780
341 Ga0157378_10013277 3300013297 Bacteria 7202
342 Ga0157378_10019408 3300013297 Bacteria 5976
343 Ga0157378_10241734 3300013297 Unclassified 1725
344 Ga0157378_10293888 3300013297 Bacteria 1570
345 Ga0157378_10638795 3300013297 Unclassified 1079
346 Ga0157378_10739872 3300013297 Bacteria 1005
347 Ga0157378_11432040 3300013297 Bacteria 734
348 Ga0157378_11981917 3300013297 Unclassified 632
349 Ga0157378_12089107 3300013297 Bacteria 617
350 Ga0163162_10014606 3300013306 Bacteria 7673
351 Ga0163162_10085087 3300013306 Bacteria 3239
352 Ga0163162_10898352 3300013306 Bacteria 999
353 Ga0163162_13302501 3300013306 Unclassified 516
354 Ga0157372_10018935 3300013307 Bacteria 7409
355 Ga0157372_10145651 3300013307 Bacteria 2732
356 Ga0157372_10193155 3300013307 Unclassified 2358
357 Ga0157372_11275282 3300013307 Bacteria 848
358 Ga0157375_10016723 3300013308 Bacteria 6599
359 Ga0157375_10042081 3300013308 Bacteria 4418
360 Ga0157375_10058852 3300013308 Bacteria 3803
361 Ga0157375_10086343 3300013308 Bacteria 3188
362 Ga0157375_10399693 3300013308 Unclassified 1541
363 Ga0157375_10621451 3300013308 Bacteria 1238
364 Ga0157375_11582841 3300013308 Bacteria 774
365 Ga0163163_10031464 3300014325 Bacteria 5121
366 Ga0163163_10223594 3300014325 Bacteria 1931
367 Ga0163163_12957264 3300014325 Bacteria 530
368 Ga0157377_10017975 3300014745 Bacteria 3668
369 Ga0157377_10032471 3300014745 Bacteria 2842
370 Ga0157377_10367877 3300014745 Bacteria 970
371 Ga0157379_10108891 3300014968 Bacteria 2488
372 Ga0157376_10016858 3300014969 Bacteria 5557
373 Ga0157376_10062489 3300014969 Bacteria 3134
374 Ga0157376_10121590 3300014969 Bacteria 2315
375 Ga0157376_10345395 3300014969 Unclassified 1422
376 Ga0157376_10474261 3300014969 Bacteria 1225
377 Ga0157376_10579253 3300014969 Bacteria 1114
378 Ga0157376_13150484 3300014969 Unclassified 500
379 Ga0182005_1028217 3300015265 Bacteria 1531
380 Ga0163161_10018151 3300017792 Unclassified 4932
381 Ga0213874_10017777 3300021377 Bacteria 1913
382 Ga0213876_10295069 3300021384 Bacteria 862
383 Ga0207666_1001794 3300025271 Bacteria 2550
384 Ga0207666_1006635 3300025271 Bacteria 1505
385 Ga0207666_1008957 3300025271 Bacteria 1345
386 Ga0207666_1015344 3300025271 Unclassified 1090
387 Ga0207673_1007265 3300025290 Bacteria 1386
388 Ga0207673_1010108 3300025290 Unclassified 1210
389 Ga0207697_10000444 3300025315 Bacteria 23320
390 Ga0207697_10003168 3300025315 Bacteria 8194
391 Ga0207697_10003199 3300025315 Bacteria 8146
392 Ga0207697_10005922 3300025315 Bacteria 5609
393 Ga0207697_10021697 3300025315 Bacteria 2630
394 Ga0207697_10023954 3300025315 Bacteria 2500
395 Ga0207697_10042783 3300025315 Bacteria 1862
396 Ga0207653_10050774 3300025885 Unclassified 1379
397 Ga0207653_10198265 3300025885 Bacteria 756
398 Ga0207692_10323599 3300025898 Bacteria 944
399 Ga0207642_10194709 3300025899 Bacteria 1115
400 Ga0207688_10009933 3300025901 Bacteria 5178
401 Ga0207688_10868975 3300025901 Bacteria 571
402 Ga0207680_10118846 3300025903 Bacteria 1726
403 Ga0207680_10172064 3300025903 Bacteria 1459
404 Ga0207680_10216182 3300025903 Bacteria 1312
405 Ga0207647_10003648 3300025904 Bacteria 11517
406 Ga0207685_10038980 3300025905 Bacteria 1760
407 Ga0207685_10058558 3300025905 Bacteria 1516
408 Ga0207685_10142299 3300025905 Bacteria 1077
409 Ga0207699_10023315 3300025906 Bacteria 3367
410 Ga0207699_10098138 3300025906 Bacteria 1853
411 Ga0207699_10189134 3300025906 Bacteria 1388
412 Ga0207699_10390895 3300025906 Bacteria 989
413 Ga0207645_10001285 3300025907 Bacteria 20617
414 Ga0207645_10084985 3300025907 Bacteria 2031
415 Ga0207645_10523121 3300025907 Bacteria 804
416 Ga0207684_10000361 3300025910 Bacteria 61371
417 Ga0207684_10009863 3300025910 Bacteria 8428
418 Ga0207684_10010162 3300025910 Bacteria 8288
419 Ga0207684_10014196 3300025910 Bacteria 6876
420 Ga0207684_10027654 3300025910 Bacteria 4830
421 Ga0207684_10152653 3300025910 Unclassified 1987
422 Ga0207684_10153195 3300025910 Bacteria 1984
423 Ga0207684_10420723 3300025910 Bacteria 1148
424 Ga0207684_10908830 3300025910 Bacteria 740
425 Ga0207707_10074776 3300025912 Bacteria 2955
426 Ga0207695_10000528 3300025913 Bacteria 80449
427 Ga0207695_10352781 3300025913 Bacteria 1358
428 Ga0207695_10525927 3300025913 Unclassified 1064
429 Ga0207671_10388045 3300025914 Unclassified 1110
430 Ga0207671_10975276 3300025914 Bacteria 668
431 Ga0207693_10001355 3300025915 Bacteria 21674
432 Ga0207693_10013891 3300025915 Bacteria 6484
433 Ga0207693_10075701 3300025915 Bacteria 2636
434 Ga0207693_10144321 3300025915 Unclassified 1872
435 Ga0207693_10180922 3300025915 Bacteria 1659
436 Ga0207693_10294440 3300025915 Bacteria 1272
437 Ga0207693_10425100 3300025915 Unclassified 1038
438 Ga0207693_10713739 3300025915 Bacteria 776
439 Ga0207693_10779352 3300025915 Bacteria 738
440 Ga0207693_10912404 3300025915 Bacteria 674
441 Ga0207693_10932719 3300025915 Bacteria 665
442 Ga0207663_10032512 3300025916 Bacteria 3098
443 Ga0207663_10054655 3300025916 Bacteria 2501
444 Ga0207663_10194389 3300025916 Bacteria 1459
445 Ga0207663_11012403 3300025916 Unclassified 667
446 Ga0207660_10021081 3300025917 Bacteria 4379
447 Ga0207662_10943202 3300025918 Unclassified 612
448 Ga0207657_10787310 3300025919 Bacteria 736
449 Ga0207649_10014176 3300025920 Bacteria 4461
450 Ga0207652_10016896 3300025921 Bacteria 5966
451 Ga0207646_10001435 3300025922 Bacteria 29563
452 Ga0207646_10067757 3300025922 Bacteria 3186
453 Ga0207646_10165679 3300025922 Bacteria 1995
454 Ga0207646_10216605 3300025922 Bacteria 1730
455 Ga0207646_10223986 3300025922 Bacteria 1699
456 Ga0207646_10343732 3300025922 Unclassified 1348
457 Ga0207646_10388102 3300025922 Unclassified 1261
458 Ga0207646_10528977 3300025922 Bacteria 1061
459 Ga0207646_10696523 3300025922 Unclassified 908
460 Ga0207646_11063384 3300025922 Bacteria 713
461 Ga0207681_10028142 3300025923 Bacteria 3639
462 Ga0207694_10600487 3300025924 Bacteria 926
463 Ga0207659_10008473 3300025926 Bacteria 6384
464 Ga0207659_10102193 3300025926 Unclassified 2163
465 Ga0207659_10167428 3300025926 Bacteria 1731
466 Ga0207659_10218984 3300025926 Bacteria 1529
467 Ga0207659_10463757 3300025926 Bacteria 1068
468 Ga0207687_10096800 3300025927 Bacteria 2164
469 Ga0207687_10273555 3300025927 Bacteria 1351
470 Ga0207700_10081408 3300025928 Bacteria 2528
471 Ga0207700_10110038 3300025928 Bacteria 2215
472 Ga0207700_10384403 3300025928 Unclassified 1228
473 Ga0207700_10538994 3300025928 Bacteria 1035
474 Ga0207700_10973902 3300025928 Bacteria 759
475 Ga0207664_10068314 3300025929 Bacteria 2854
476 Ga0207664_10340367 3300025929 Bacteria 1326
477 Ga0207664_10557326 3300025929 Bacteria 1028
478 Ga0207664_10672135 3300025929 Bacteria 931
479 Ga0207664_10815605 3300025929 Unclassified 839
480 Ga0207644_10025387 3300025931 Bacteria 4076
481 Ga0207644_10283123 3300025931 Bacteria 1331
482 Ga0207690_10018004 3300025932 Bacteria 4326
483 Ga0207690_10652586 3300025932 Bacteria 862
484 Ga0207690_10932915 3300025932 Bacteria 721
485 Ga0207706_10045299 3300025933 Bacteria 3898
486 Ga0207706_10045318 3300025933 Bacteria 3897
487 Ga0207706_10082297 3300025933 Bacteria 2829
488 Ga0207706_10305553 3300025933 Unclassified 1385
489 Ga0207706_11334905 3300025933 Bacteria 591
490 Ga0207686_10063032 3300025934 Bacteria 2356
491 Ga0207709_10070287 3300025935 Bacteria 2219
492 Ga0207670_10102641 3300025936 Bacteria 2045
493 Ga0207670_10141861 3300025936 Bacteria 1772
494 Ga0207670_10402735 3300025936 Unclassified 1094
495 Ga0207669_10029298 3300025937 Unclassified 3042
496 Ga0207704_10084983 3300025938 Unclassified 2058
497 Ga0207704_10282933 3300025938 Bacteria 1262
498 Ga0207704_10403847 3300025938 Bacteria 1079
499 Ga0207665_10009877 3300025939 Bacteria 6262
500 Ga0207665_10028345 3300025939 Bacteria 3698
501 Ga0207665_10083369 3300025939 Bacteria 2205
502 Ga0207665_10151039 3300025939 Bacteria 1664
503 Ga0207665_10213956 3300025939 Bacteria 1409
504 Ga0207665_10648633 3300025939 Unclassified 827
505 Ga0207665_11104512 3300025939 Bacteria 632
506 Ga0207691_10001851 3300025940 Bacteria 20664
507 Ga0207691_10087968 3300025940 Bacteria 2786
508 Ga0207691_10522594 3300025940 Bacteria 1007
509 Ga0207661_10015464 3300025944 Bacteria 5615
510 Ga0207661_10264121 3300025944 Bacteria 1534
511 Ga0207661_10847557 3300025944 Unclassified 841
512 Ga0207679_10373967 3300025945 Bacteria 1248
513 Ga0207679_10468630 3300025945 Unclassified 1120
514 Ga0207679_10752378 3300025945 Bacteria 886
515 Ga0207651_10049796 3300025960 Bacteria 2841
516 Ga0207651_10201738 3300025960 Bacteria 1594
517 Ga0207651_10251794 3300025960 Bacteria 1445
518 Ga0207712_10517780 3300025961 Unclassified 1022
519 Ga0207668_10094626 3300025972 Unclassified 2203
520 Ga0207668_10369397 3300025972 Bacteria 1204
521 Ga0207658_10159828 3300025986 Bacteria 1846
522 Ga0207658_10430328 3300025986 Bacteria 1165
523 Ga0207658_10600964 3300025986 Bacteria 988
524 Ga0207677_10031994 3300026023 Bacteria 3376
525 Ga0207677_10073922 3300026023 Unclassified 2416
526 Ga0207677_10134807 3300026023 Bacteria 1881
527 Ga0207703_10010722 3300026035 Bacteria 7153
528 Ga0207703_10742481 3300026035 Bacteria 935
529 Ga0207639_10315543 3300026041 Bacteria 1386
530 Ga0207678_10003519 3300026067 Bacteria 14087
531 Ga0207708_10035995 3300026075 Bacteria 3767
532 Ga0207702_10049500 3300026078 Bacteria 3546
533 Ga0207702_10688734 3300026078 Bacteria 1007
534 Ga0207641_10053770 3300026088 Bacteria 3415
535 Ga0207641_11350701 3300026088 Unclassified 713
536 Ga0207676_10875821 3300026095 Bacteria 879
537 Ga0207674_10317701 3300026116 Unclassified 1507
538 Ga0207675_100196031 3300026118 Bacteria 1939
539 Ga0207675_101283159 3300026118 Bacteria 753
540 Ga0207683_10018512 3300026121 Bacteria 5944
541 Ga0207683_10049221 3300026121 Unclassified 3689
542 Ga0207683_10060516 3300026121 Bacteria 3329
543 Ga0207683_10653063 3300026121 Bacteria 974
544 Ga0207698_10703820 3300026142 Unclassified 1005
545 Ga0208943_100074 3300026796 Unclassified 873
546 Ga0268266_10012621 3300028379 Bacteria 7299
547 Ga0268266_10032992 3300028379 Bacteria 4402
548 Ga0268266_10045797 3300028379 Bacteria 3743
549 Ga0268266_10224333 3300028379 Bacteria 1729
550 Ga0268266_10320774 3300028379 Bacteria 1450
551 Ga0268265_10358949 3300028380 Unclassified 1333
552 Ga0268264_10014336 3300028381 Bacteria 6518
553 Ga0265326_10008089 3300028558 Bacteria 3187
554 Ga0265338_10003023 3300028800 Bacteria 24243
555 Ga0265324_10047338 3300029957 Bacteria 1479
556 Ga0265324_10167276 3300029957 Bacteria 747
557 Ga0265332_10036220 3300031238 Bacteria 2142
558 Ga0265325_10361946 3300031241 Unclassified 639
559 Ga0265329_10010104 3300031242 Bacteria 3483
560 Ga0265327_10010069 3300031251 Bacteria 6708
561 Ga0265316_10245999 3300031344 Bacteria 1314
562 Ga0307513_10016611 3300031456 Bacteria 8870
563 Ga0265313_10119633 3300031595 Bacteria 1150
564 Ga0265314_10004395 3300031711 Bacteria 13095
565 Ga0373926_0060407 3300035083 Unclassified 1381
566 Ga0373934_0077671 3300035086 Bacteria 1332
567 Ga0373944_0034784 3300035089 Unclassified 1533
568 Ga0373944_0270233 3300035089 Unclassified 632
569 Ga0373923_0085232 3300035111 Bacteria 1375
570 Ga0373939_0119504 3300035114 Bacteria 928
571 Ga0373945_0092154 3300035116 Unclassified 1175
572 Ga0373945_0098225 3300035116 Bacteria 1143
573 Ga0373953_0333833 3300035117 Bacteria 663
574 Ga0373957_0167294 3300035120 Bacteria 908
575 Ga0373943_0062711 3300035170 Bacteria 1862
576 Ga0373943_0113410 3300035170 Bacteria 1432
577 Ga0373943_0297825 3300035170 Bacteria 915
578 Ga0373943_0463860 3300035170 Bacteria 737
579 Ga0373946_0058627 3300035171 Bacteria 1632
580 Ga0373955_0082136 3300035172 Bacteria 1823
581 Ga0373955_0397091 3300035172 Unclassified 838
582 Ga0373924_0044071 3300035410 Bacteria 1833
583 Ga0373931_0347755 3300035691 Bacteria 927
584 Ga0373935_0033859 3300035692 Bacteria 3182
585 Ga0373935_0077364 3300035692 Bacteria 2156
586 Ga0373935_0092645 3300035692 Unclassified 1980
587 Ga0373935_0424569 3300035692 Unclassified 957
588 Ga0373935_0503125 3300035692 Bacteria 880
589 Ga0373927_0110777 3300035695 Bacteria 1788
590 Ga0373927_0263835 3300035695 Bacteria 1133
591 Ga0373933_0307493 3300035724 Bacteria 1027
592 Ga0373947_0026416 3300035725 Bacteria 3393
593 Ga0373947_0040301 3300035725 Bacteria 2782
594 Ga0373947_0053027 3300035725 Bacteria 2445
595 Ga0373947_0118571 3300035725 Unclassified 1679
596 Ga0373947_0139349 3300035725 Unclassified 1555
597 Ga0373937_0122003 3300036401 Bacteria 2429
598 Ga0373937_0628577 3300036401 Unclassified 1019
599 Ga0373925_0130779 3300037068 Bacteria 1957
600 Ga0373925_0623276 3300037068 Bacteria 889
601 Ga0373925_0862065 3300037068 Unclassified 746
602 Ga0395899_0056258 3300037312 Bacteria 2908
603 Ga0395900_0027545 3300037418 Bacteria 5822
604 Ga0395900_0483590 3300037418 Bacteria 1190
605 Ga0395898_0627771 3300037466 Unclassified 1017
606 Ga0395905_0217266 3300037471 Bacteria 1790
607 Ga0436364_1329891 3300037853 Bacteria 3904
608 Ga0395901_0204177 3300038443 Bacteria 2071
609 Ga0436363_0655579 3300039450 Bacteria 600
610 Ga0436363_1274071 3300039450 Bacteria 1501
611 Ga0436363_1670280 3300039450 Bacteria 1913
612 Ga0436362_1160721 3300039453 Unclassified 747
613 Ga0451833_1293311 3300041491 Bacteria 698
614 Ga0451841_0540725 3300041498 Bacteria 1032
615 Ga0451849_0375274 3300041505 Bacteria 603
616 Ga0451853_1277715 3300041512 Bacteria 771
617 Ga0451853_2292548 3300041512 Bacteria 610
618 Ga0439448_0025828 3300042005 Bacteria 1844
619 Ga0439448_0029634 3300042005 Bacteria 1733
620 Ga0439455_0009917 3300042012 Bacteria 2079
621 Ga0439458_0017325 3300042157 Bacteria 1644
622 Ga0439464_0029519 3300042439 Bacteria 1533
623 Ga0451577_1601142 3300042876 Unclassified 574
624 Ga0466964_0287229 3300044706 Bacteria 824
625 Ga0466959_0420761 3300045049 Unclassified 907
626 Ga0466967_0166057 3300045976 Bacteria 2075
627 Ga0466967_0939354 3300045976 Unclassified 860
628 Ga0495592_0003725 3300046454 Bacteria 10986
629 Ga0495641_0049605 3300046461 Bacteria 1921
630 Ga0495653_0274851 3300046463 Bacteria 1108
631 Ga0495664_0135879 3300046477 Bacteria 1490
632 Ga0495584_0153456 3300046491 Unclassified 1170
633 Ga0495666_0190564 3300046526 Bacteria 945
634 Ga0495652_0054888 3300046529 Bacteria 3390
635 Ga0495586_0075474 3300046535 Bacteria 1845
636 Ga0495598_0020874 3300046537 Bacteria 1735
637 Ga0495645_0004254 3300046543 Bacteria 9776
638 Ga0495635_0351718 3300046663 Bacteria 983
639 Ga0495659_0013311 3300046664 Bacteria 2679
640 Ga0495599_0003768 3300046678 Bacteria 8902
641 Ga0495646_0252193 3300046680 Bacteria 945
642 Ga0495647_0236729 3300046681 Unclassified 810
643 Ga0495669_0012157 3300046684 Bacteria 3660
644 Ga0495624_0144232 3300046690 Bacteria 1458
645 Ga0495600_0566683 3300046809 Bacteria 693
646 Ga0495660_0427033 3300046810 Unclassified 576
647 Ga0495581_0027893 3300047315 Bacteria 3275
648 Ga0495581_0842266 3300047315 Unclassified 525
649 Ga0495674_0063504 3300047319 Bacteria 3212
650 Ga0495674_0881398 3300047319 Unclassified 692
651 Ga0495676_0356009 3300047321 Bacteria 978
652 Ga0495675_0051447 3300047444 Bacteria 2616
653 Ga0495675_0621631 3300047444 Bacteria 611
654 Ga0495684_0018751 3300047471 Bacteria 5330
655 Ga0496100_0006076 3300048903 Bacteria 6561
656 Ga0496100_0490067 3300048903 Unclassified 946
657 Ga0496100_0703807 3300048903 Unclassified 789
658 Ga0496101_0047030 3300048904 Bacteria 3096
659 Ga0496101_0175310 3300048904 Bacteria 1649
660 Ga0496101_0525419 3300048904 Unclassified 935
661 Ga0496101_0622871 3300048904 Bacteria 853
662 Ga0496102_0002637 3300048905 Bacteria 15241
663 Ga0496102_0179713 3300048905 Unclassified 1993
664 Ga0496102_0380372 3300048905 Bacteria 1329
665 Ga0496102_0418763 3300048905 Unclassified 1258
666 Ga0496102_1174697 3300048905 Bacteria 687
667 Ga0496103_0074544 3300048906 Bacteria 2128
668 Ga0496103_0481788 3300048906 Bacteria 795
669 Ga0496103_0708332 3300048906 Bacteria 638
670 Ga0496104_0118373 3300048907 Bacteria 2543
671 Ga0496104_0119360 3300048907 Bacteria 2532
672 Ga0496104_0182306 3300048907 Bacteria 2010
673 Ga0496104_0302847 3300048907 Bacteria 1510
674 Ga0496104_0311468 3300048907 Bacteria 1487
675 Ga0496105_0047692 3300048908 Unclassified 3536
676 Ga0496105_0062706 3300048908 Bacteria 3068
677 Ga0496105_0193612 3300048908 Unclassified 1662
678 Ga0496105_0272881 3300048908 Bacteria 1365
679 Ga0496105_0306076 3300048908 Bacteria 1277
680 Ga0496106_0061628 3300048909 Bacteria 2846
681 Ga0496106_0273634 3300048909 Unclassified 1352
682 Ga0496106_0559064 3300048909 Bacteria 918
683 Ga0496107_0053736 3300048910 Unclassified 2905
684 Ga0496107_0268415 3300048910 Unclassified 1270
685 Ga0496108_0015442 3300048911 Bacteria 6229
686 Ga0496108_0025575 3300048911 Bacteria 4866
687 Ga0496108_0098617 3300048911 Bacteria 2490
688 Ga0496108_0161458 3300048911 Unclassified 1937
689 Ga0496109_0073782 3300048912 Bacteria 3136
690 Ga0496109_0284031 3300048912 Unclassified 1560
691 Ga0496109_0316638 3300048912 Unclassified 1472
692 Ga0496109_0350812 3300048912 Bacteria 1394
693 Ga0496109_0351056 3300048912 Bacteria 1393
694 Ga0496109_0479486 3300048912 Bacteria 1174
695 Ga0496109_0969133 3300048912 Unclassified 788
696 Ga0496110_0019405 3300048913 Bacteria 5720
697 Ga0496110_0157301 3300048913 Unclassified 2059
698 Ga0496111_0068471 3300048914 Bacteria 2580
699 Ga0496111_0173460 3300048914 Bacteria 1603
700 Ga0496111_0232293 3300048914 Bacteria 1370
701 Ga0496111_0637425 3300048914 Unclassified 778
702 Ga0496111_0693294 3300048914 Bacteria 741
703 Ga0496112_0016662 3300048915 Bacteria 6891
704 Ga0496112_0028618 3300048915 Bacteria 5380
705 Ga0496112_0060101 3300048915 Bacteria 3744
706 Ga0496112_0187444 3300048915 Bacteria 2032
707 Ga0496112_0665451 3300048915 Bacteria 970
708 Ga0496112_1314662 3300048915 Bacteria 638
709 Ga0496113_0002216 3300048916 Bacteria 11213
710 Ga0496113_0048279 3300048916 Bacteria 3167
711 Ga0496113_0150125 3300048916 Bacteria 1838
712 Ga0496114_0010811 3300048917 Bacteria 7265
713 Ga0496114_0255446 3300048917 Bacteria 1542
714 Ga0496115_0002913 3300048918 Bacteria 12348
715 Ga0496115_0006579 3300048918 Bacteria 8516
716 Ga0496115_0098053 3300048918 Bacteria 2400
717 Ga0496115_0146098 3300048918 Bacteria 1952
718 Ga0496115_0226220 3300048918 Bacteria 1543
719 Ga0496115_0761608 3300048918 Unclassified 756
720 nmdc:mga05p37_1214559_c1 3300050507 Bacteria 777
721 nmdc:mga05p37_128604_c1 3300050507 Bacteria 3109
722 nmdc:mga05p37_8732_c1 3300050507 Bacteria 11967
723 nmdc:mga0n895_164179_c1 3300050512 Bacteria 2252
724 nmdc:mga0n895_432277_c1 3300050512 Unclassified 1330
725 nmdc:mga0n895_833013_c1 3300050512 Bacteria 911
726 nmdc:mga0rr50_1483296_c1 3300050513 Bacteria 573
727 nmdc:mga0rr50_176224_c1 3300050513 Unclassified 1745
728 nmdc:mga0rr50_629838_c1 3300050513 Bacteria 915
729 nmdc:mga0rr50_751166_c1 3300050513 Unclassified 832
730 nmdc:mga0rr50_951128_c1 3300050513 Bacteria 732
731 nmdc:mga08x19_15186_c1 3300050514 Bacteria 4682
732 Ga0495612_0032931 3300053078 Bacteria 2096
733 Ga0068866_10405671
734 SwRhRL2b_contig_2222690
735 CNXas_1000006
736 CNXas_1000250
737 JGI24738J21930_10121898
738 JGI24035J26624_1000343
739 JGI24035J26624_1003646
740 JGI24035J26624_1011157
741 JGI25405J52794_10000193
742 JGI25405J52794_10080984
743 Ga0065704_10010350
744 Ga0065704_10019275
745 Ga0065704_10126111
746 Ga0065704_10335979
747 Ga0065712_10000352
748 Ga0065712_10020765
749 Ga0065712_10069732
750 Ga0065712_10241197
751 Ga0065712_10339517
752 Ga0065715_10003837
753 Ga0065715_10091353
754 Ga0065715_10232131
755 Ga0065715_10264791
756 Ga0065707_10016321
757 Ga0065707_10026696
758 Ga0070658_10094356
759 Ga0070658_10308592
760 Ga0070676_10059556
761 Ga0070676_10200071
762 Ga0070676_10626936
763 Ga0070683_100001630
764 Ga0070683_100327237
765 Ga0070683_100503275
766 Ga0070683_100520519
767 Ga0070683_100689922
768 Ga0070690_100006260
769 Ga0070690_100019502
770 Ga0070690_100318728
771 Ga0070690_100959507
772 Ga0070690_101069679
773 Ga0070670_100319471
774 Ga0070677_10069065
775 Ga0070666_10162364
776 Ga0070666_10241087
777 Ga0070666_10785390
778 Ga0070680_100094736
779 Ga0068868_100038852
780 Ga0068868_100102559
781 Ga0068868_100150803
782 Ga0068868_100585966
783 Ga0068868_100640299
784 Ga0068868_100964580
785 Ga0070660_100252775
786 Ga0070689_100004055
787 Ga0070689_100046445
788 Ga0070689_100129289
789 Ga0070687_100294173
790 Ga0070687_100975426
791 Ga0070661_100023744
792 Ga0070661_100410753
793 Ga0070692_10067725
794 Ga0070668_100035530
795 Ga0070668_100104331
796 Ga0070668_101136598
797 Ga0070669_100022002
798 Ga0070669_100247784
799 Ga0070669_100699422
800 Ga0070669_101535309
801 Ga0070675_100005723
802 Ga0070675_100026836
803 Ga0070675_100042948
804 Ga0070675_100052427
805 Ga0070675_101294595
806 Ga0070671_100033630
807 Ga0070671_100034781
808 Ga0070671_100218498
809 Ga0070671_100386203
810 Ga0070674_100348374
811 Ga0070674_100700705
812 Ga0070674_100706086
813 Ga0070673_100094103
814 Ga0070673_100174322
815 Ga0070673_100272487
816 Ga0070673_100554281
817 Ga0070688_100009421
818 Ga0070688_100022074
819 Ga0070688_100026418
820 Ga0070688_100185244
821 Ga0070688_100635834
822 Ga0070688_100972287
823 Ga0070659_100191894
824 Ga0070667_100121132
825 Ga0070667_100265146
826 Ga0070703_10048925
827 Ga0070703_10128550
828 Ga0070709_10065905
829 Ga0070709_10077783
830 Ga0070709_10092129
831 Ga0070709_10207495
832 Ga0070709_10884416
833 Ga0070709_10956739
834 Ga0070709_11172281
835 Ga0070714_100388499
836 Ga0070714_101325437
837 Ga0070714_101544318
838 Ga0070713_100041635
839 Ga0070713_100083340
840 Ga0070713_100174494
841 Ga0070713_101009357
842 Ga0070710_10041523
843 Ga0070710_10231599
844 Ga0070701_10068973
845 Ga0070711_100004608
846 Ga0070711_100019878
847 Ga0070711_100199342
848 Ga0070711_100275656
849 Ga0070711_100396773
850 Ga0070711_100436671
851 Ga0070711_100469468
852 Ga0070711_100939262
853 Ga0070711_101179936
854 Ga0070711_101681187
855 Ga0070705_100029532
856 Ga0070705_100047627
857 Ga0070705_101320245
858 Ga0070700_100024965
859 Ga0070694_100156341
860 Ga0070694_100589520
861 Ga0070708_100027395
862 Ga0070708_100031031
863 Ga0070708_100092802
864 Ga0070708_100153884
865 Ga0070708_100264905
866 Ga0070708_100385374
867 Ga0070708_100427316
868 Ga0070708_100523524
869 Ga0070678_100028152
870 Ga0070678_100795265
871 Ga0070662_100126993
872 Ga0070662_100221543
873 Ga0070662_100276032
874 Ga0070681_10018996
875 Ga0068867_100224964
876 Ga0070685_10019512
877 Ga0070685_10032358
878 Ga0070706_100000286
879 Ga0070706_100003298
880 Ga0070706_100107424
881 Ga0070706_100123084
882 Ga0070706_100163243
883 Ga0070706_100234356
884 Ga0070706_100407711
885 Ga0070706_100509188
886 Ga0070706_100531321
887 Ga0070706_100594059
888 Ga0070706_101378927
889 Ga0070707_100158832
890 Ga0070707_100331569
891 Ga0070707_100339034
892 Ga0070707_100803032
893 Ga0070707_100806288
894 Ga0070698_100020545
895 Ga0070698_100053393
896 Ga0070698_100728672
897 Ga0070699_100019406
898 Ga0070699_100174490
899 Ga0070699_100195344
900 Ga0070699_100866362
901 Ga0070679_100013738
902 Ga0070684_100001714
903 Ga0070684_100127081
904 Ga0070684_100363249
905 Ga0070697_100012869
906 Ga0070697_100032866
907 Ga0070697_100037643
908 Ga0070697_100038604
909 Ga0070697_100041341
910 Ga0070697_100065591
911 Ga0070697_100085833
912 Ga0070697_100119947
913 Ga0070697_100145983
914 Ga0070697_100391106
915 Ga0068853_100335460
916 Ga0068853_100866238
917 Ga0070672_100044524
918 Ga0070672_100163312
919 Ga0070672_100164955
920 Ga0070672_100342362
921 Ga0070672_101714034
922 Ga0070686_100102732
923 Ga0070695_100025252
924 Ga0070696_100064022
925 Ga0070696_100825407
926 Ga0070693_100024879
927 Ga0070665_100016081
928 Ga0070665_100065178
929 Ga0070665_100288031
930 Ga0070704_100004877
931 Ga0070664_100074588
932 Ga0070664_100095356
933 Ga0070664_100451298
934 Ga0068857_102256311
935 Ga0068856_100004883
936 Ga0068856_100192879
937 Ga0068856_100395548
938 Ga0070702_100157067
939 Ga0070702_100346451
940 Ga0068864_100336616
941 Ga0068864_101162229
942 Ga0068864_101417543
943 Ga0068866_11067762
944 Ga0068863_100016981
945 Ga0068863_100412245
946 Ga0068863_102583310
947 Ga0068858_100005855
948 Ga0068858_100139119
949 Ga0068858_100541628
950 Ga0068860_100077785
951 Ga0068860_100834270
952 Ga0068862_100508201
953 Ga0068862_100799420
954 Ga0081455_10001521
955 Ga0081455_10029948
956 Ga0081455_10081972
957 Ga0081455_10095663
958 Ga0081455_10324818
959 Ga0081539_10001104
960 Ga0081539_10119418
961 Ga0070717_10003704
962 Ga0070717_10029096
963 Ga0070717_10229972
964 Ga0070717_10269262
965 Ga0070717_10430506
966 Ga0070717_10592678
967 Ga0070715_10104145
968 Ga0070715_10514524
969 Ga0070716_100027561
970 Ga0070716_100032249
971 Ga0070716_100060611
972 Ga0070716_100064385
973 Ga0070716_100172530
974 Ga0070712_100010408
975 Ga0070712_100089536
976 Ga0070712_100166814
977 Ga0070712_100172237
978 Ga0070712_100178065
979 Ga0070712_100182503
980 Ga0070712_100187874
981 Ga0070712_100318960
982 Ga0070712_100354221
983 Ga0070712_100744005
984 Ga0070712_100878779
985 Ga0070712_101528399
986 Ga0097621_100093184
987 Ga0097621_100200389
988 Ga0097621_100535148
989 Ga0068871_100094526
990 Ga0068871_100890192
991 Ga0068871_100959705
992 Ga0075428_100178732
993 Ga0075434_100421377
994 Ga0075434_100592621
995 Ga0075434_100637715
996 Ga0075434_101792655
997 Ga0068865_100028325
998 Ga0068865_100058541
999 Ga0068865_100219310
1000 Ga0068865_101448432
1001 Ga0075436_100062987
1002 Ga0075436_100283900
1003 Ga0075435_100149924
1004 Ga0099794_10112573
1005 Ga0099795_10031323
1006 Ga0105250_10305513
1007 Ga0105240_10000022
1008 Ga0105240_10000402
1009 Ga0105240_10205383
1010 Ga0105240_10456100
1011 Ga0111539_10515144
1012 Ga0111539_10730533
1013 Ga0105245_10037816
1014 Ga0105245_10059835
1015 Ga0105245_10152367
1016 Ga0105245_10606678
1017 Ga0105247_10101161
1018 Ga0105247_11428051
1019 Ga0114129_10031857
1020 Ga0114129_10209977
1021 Ga0114129_10316271
1022 Ga0114129_10444804
1023 Ga0114129_12216608
1024 Ga0105243_10080571
1025 Ga0105243_10355624
1026 Ga0105243_12585812
1027 Ga0105241_10026639
1028 Ga0105242_10007333
1029 Ga0105242_10408735
1030 Ga0105242_10706865
1031 Ga0105242_10941866
1032 Ga0105242_12622461
1033 Ga0105248_10666372
1034 Ga0105248_11767276
1035 Ga0105248_12038756
1036 Ga0105237_10434919
1037 Ga0105237_11561243
1038 Ga0105238_10623407
1039 Ga0105249_10203737
1040 Ga0105249_10953054
1041 Ga0105249_11043982
1042 Ga0099796_10064664
1043 Ga0099796_10242634
1044 Ga0105239_10091577
1045 Ga0105239_10506762
1046 Ga0105239_10521037
1047 Ga0105239_11237784
1048 Ga0105239_12408371
1049 Ga0105246_10139446
1050 Ga0105246_10142120
1051 Ga0157336_1001788
1052 Ga0157321_1006534
1053 Ga0157339_1007027
1054 Ga0157327_1005082
1055 Ga0157326_1020676
1056 Ga0157338_1028405
1057 Ga0157373_10279336
1058 Ga0157371_10232172
1059 Ga0157371_10581886
1060 Ga0157369_10052723
1061 Ga0157369_10981595
1062 Ga0157369_11746148
1063 Ga0157374_10061584
1064 Ga0157374_10061655
1065 Ga0157374_10111369
1066 Ga0157374_10168974
1067 Ga0157374_10209800
1068 Ga0157374_10403143
1069 Ga0157374_10442095
1070 Ga0157374_10873211
1071 Ga0157374_10956084
1072 Ga0157374_11201092
1073 Ga0157378_10013277
1074 Ga0157378_10019408
1075 Ga0157378_10241734
1076 Ga0157378_10293888
1077 Ga0157378_10638795
1078 Ga0157378_10739872
1079 Ga0157378_11432040
1080 Ga0157378_11981917
1081 Ga0157378_12089107
1082 Ga0163162_10014606
1083 Ga0163162_10085087
1084 Ga0163162_10898352
1085 Ga0163162_13302501
1086 Ga0157372_10018935
1087 Ga0157372_10145651
1088 Ga0157372_10193155
1089 Ga0157372_11275282
1090 Ga0157375_10016723
1091 Ga0157375_10042081
1092 Ga0157375_10058852
1093 Ga0157375_10086343
1094 Ga0157375_10399693
1095 Ga0157375_10621451
1096 Ga0157375_11582841
1097 Ga0163163_10031464
1098 Ga0163163_10223594
1099 Ga0163163_12957264
1100 Ga0157377_10017975
1101 Ga0157377_10032471
1102 Ga0157377_10367877
1103 Ga0157379_10108891
1104 Ga0157376_10016858
1105 Ga0157376_10062489
1106 Ga0157376_10121590
1107 Ga0157376_10345395
1108 Ga0157376_10474261
1109 Ga0157376_10579253
1110 Ga0157376_13150484
1111 Ga0182005_1028217
1112 Ga0163161_10018151
1113 Ga0213874_10017777
1114 Ga0213876_10295069
1115 Ga0207666_1001794
1116 Ga0207666_1006635
1117 Ga0207666_1008957
1118 Ga0207666_1015344
1119 Ga0207673_1007265
1120 Ga0207673_1010108
1121 Ga0207697_10000444
1122 Ga0207697_10003168
1123 Ga0207697_10003199
1124 Ga0207697_10005922
1125 Ga0207697_10021697
1126 Ga0207697_10023954
1127 Ga0207697_10042783
1128 Ga0207653_10050774
1129 Ga0207653_10198265
1130 Ga0207692_10323599
1131 Ga0207642_10194709
1132 Ga0207688_10009933
1133 Ga0207688_10868975
1134 Ga0207680_10118846
1135 Ga0207680_10172064
1136 Ga0207680_10216182
1137 Ga0207647_10003648
1138 Ga0207685_10038980
1139 Ga0207685_10058558
1140 Ga0207685_10142299
1141 Ga0207699_10023315
1142 Ga0207699_10098138
1143 Ga0207699_10189134
1144 Ga0207699_10390895
1145 Ga0207645_10001285
1146 Ga0207645_10084985
1147 Ga0207645_10523121
1148 Ga0207684_10000361
1149 Ga0207684_10009863
1150 Ga0207684_10010162
1151 Ga0207684_10014196
1152 Ga0207684_10027654
1153 Ga0207684_10152653
1154 Ga0207684_10153195
1155 Ga0207684_10420723
1156 Ga0207684_10908830
1157 Ga0207707_10074776
1158 Ga0207695_10000528
1159 Ga0207695_10352781
1160 Ga0207695_10525927
1161 Ga0207671_10388045
1162 Ga0207671_10975276
1163 Ga0207693_10001355
1164 Ga0207693_10013891
1165 Ga0207693_10075701
1166 Ga0207693_10144321
1167 Ga0207693_10180922
1168 Ga0207693_10294440
1169 Ga0207693_10425100
1170 Ga0207693_10713739
1171 Ga0207693_10779352
1172 Ga0207693_10912404
1173 Ga0207693_10932719
1174 Ga0207663_10032512
1175 Ga0207663_10054655
1176 Ga0207663_10194389
1177 Ga0207663_11012403
1178 Ga0207660_10021081
1179 Ga0207662_10943202
1180 Ga0207657_10787310
1181 Ga0207649_10014176
1182 Ga0207652_10016896
1183 Ga0207646_10001435
1184 Ga0207646_10067757
1185 Ga0207646_10165679
1186 Ga0207646_10216605
1187 Ga0207646_10223986
1188 Ga0207646_10343732
1189 Ga0207646_10388102
1190 Ga0207646_10528977
1191 Ga0207646_10696523
1192 Ga0207646_11063384
1193 Ga0207681_10028142
1194 Ga0207694_10600487
1195 Ga0207659_10008473
1196 Ga0207659_10102193
1197 Ga0207659_10167428
1198 Ga0207659_10218984
1199 Ga0207659_10463757
1200 Ga0207687_10096800
1201 Ga0207687_10273555
1202 Ga0207700_10081408
1203 Ga0207700_10110038
1204 Ga0207700_10384403
1205 Ga0207700_10538994
1206 Ga0207700_10973902
1207 Ga0207664_10068314
1208 Ga0207664_10340367
1209 Ga0207664_10557326
1210 Ga0207664_10672135
1211 Ga0207664_10815605
1212 Ga0207644_10025387
1213 Ga0207644_10283123
1214 Ga0207690_10018004
1215 Ga0207690_10652586
1216 Ga0207690_10932915
1217 Ga0207706_10045299
1218 Ga0207706_10045318
1219 Ga0207706_10082297
1220 Ga0207706_10305553
1221 Ga0207706_11334905
1222 Ga0207686_10063032
1223 Ga0207709_10070287
1224 Ga0207670_10102641
1225 Ga0207670_10141861
1226 Ga0207670_10402735
1227 Ga0207669_10029298
1228 Ga0207704_10084983
1229 Ga0207704_10282933
1230 Ga0207704_10403847
1231 Ga0207665_10009877
1232 Ga0207665_10028345
1233 Ga0207665_10083369
1234 Ga0207665_10151039
1235 Ga0207665_10213956
1236 Ga0207665_10648633
1237 Ga0207665_11104512
1238 Ga0207691_10001851
1239 Ga0207691_10087968
1240 Ga0207691_10522594
1241 Ga0207661_10015464
1242 Ga0207661_10264121
1243 Ga0207661_10847557
1244 Ga0207679_10373967
1245 Ga0207679_10468630
1246 Ga0207679_10752378
1247 Ga0207651_10049796
1248 Ga0207651_10201738
1249 Ga0207651_10251794
1250 Ga0207712_10517780
1251 Ga0207668_10094626
1252 Ga0207668_10369397
1253 Ga0207658_10159828
1254 Ga0207658_10430328
1255 Ga0207658_10600964
1256 Ga0207677_10031994
1257 Ga0207677_10073922
1258 Ga0207677_10134807
1259 Ga0207703_10010722
1260 Ga0207703_10742481
1261 Ga0207639_10315543
1262 Ga0207678_10003519
1263 Ga0207708_10035995
1264 Ga0207702_10049500
1265 Ga0207702_10688734
1266 Ga0207641_10053770
1267 Ga0207641_11350701
1268 Ga0207676_10875821
1269 Ga0207674_10317701
1270 Ga0207675_100196031
1271 Ga0207675_101283159
1272 Ga0207683_10018512
1273 Ga0207683_10049221
1274 Ga0207683_10060516
1275 Ga0207683_10653063
1276 Ga0207698_10703820
1277 Ga0208943_100074
1278 Ga0268266_10012621
1279 Ga0268266_10032992
1280 Ga0268266_10045797
1281 Ga0268266_10224333
1282 Ga0268266_10320774
1283 Ga0268265_10358949
1284 Ga0268264_10014336
1285 Ga0265326_10008089
1286 Ga0265338_10003023
1287 Ga0265324_10047338
1288 Ga0265324_10167276
1289 Ga0265332_10036220
1290 Ga0265325_10361946
1291 Ga0265329_10010104
1292 Ga0265327_10010069
1293 Ga0265316_10245999
1294 Ga0307513_10016611
1295 Ga0265313_10119633
1296 Ga0265314_10004395
1297 Ga0373926_0060407
1298 Ga0373934_0077671
1299 Ga0373944_0034784
1300 Ga0373944_0270233
1301 Ga0373923_0085232
1302 Ga0373939_0119504
1303 Ga0373945_0092154
1304 Ga0373945_0098225
1305 Ga0373953_0333833
1306 Ga0373957_0167294
1307 Ga0373943_0062711
1308 Ga0373943_0113410
1309 Ga0373943_0297825
1310 Ga0373943_0463860
1311 Ga0373946_0058627
1312 Ga0373955_0082136
1313 Ga0373955_0397091
1314 Ga0373924_0044071
1315 Ga0373931_0347755
1316 Ga0373935_0033859
1317 Ga0373935_0077364
1318 Ga0373935_0092645
1319 Ga0373935_0424569
1320 Ga0373935_0503125
1321 Ga0373927_0110777
1322 Ga0373927_0263835
1323 Ga0373933_0307493
1324 Ga0373947_0026416
1325 Ga0373947_0040301
1326 Ga0373947_0053027
1327 Ga0373947_0118571
1328 Ga0373947_0139349
1329 Ga0373937_0122003
1330 Ga0373937_0628577
1331 Ga0373925_0130779
1332 Ga0373925_0623276
1333 Ga0373925_0862065
1334 Ga0395899_0056258
1335 Ga0395900_0027545
1336 Ga0395900_0483590
1337 Ga0395898_0627771
1338 Ga0395905_0217266
1339 Ga0436364_1329891
1340 Ga0395901_0204177
1341 Ga0436363_0655579
1342 Ga0436363_1274071
1343 Ga0436363_1670280
1344 Ga0436362_1160721
1345 Ga0451833_1293311
1346 Ga0451841_0540725
1347 Ga0451849_0375274
1348 Ga0451853_1277715
1349 Ga0451853_2292548
1350 Ga0439448_0025828
1351 Ga0439448_0029634
1352 Ga0439455_0009917
1353 Ga0439458_0017325
1354 Ga0439464_0029519
1355 Ga0451577_1601142
1356 Ga0466964_0287229
1357 Ga0466959_0420761
1358 Ga0466967_0166057
1359 Ga0466967_0939354
1360 Ga0495592_0003725
1361 Ga0495641_0049605
1362 Ga0495653_0274851
1363 Ga0495664_0135879
1364 Ga0495584_0153456
1365 Ga0495666_0190564
1366 Ga0495652_0054888
1367 Ga0495586_0075474
1368 Ga0495598_0020874
1369 Ga0495645_0004254
1370 Ga0495635_0351718
1371 Ga0495659_0013311
1372 Ga0495599_0003768
1373 Ga0495646_0252193
1374 Ga0495647_0236729
1375 Ga0495669_0012157
1376 Ga0495624_0144232
1377 Ga0495600_0566683
1378 Ga0495660_0427033
1379 Ga0495581_0027893
1380 Ga0495581_0842266
1381 Ga0495674_0063504
1382 Ga0495674_0881398
1383 Ga0495676_0356009
1384 Ga0495675_0051447
1385 Ga0495675_0621631
1386 Ga0495684_0018751
1387 Ga0496100_0006076
1388 Ga0496100_0490067
1389 Ga0496100_0703807
1390 Ga0496101_0047030
1391 Ga0496101_0175310
1392 Ga0496101_0525419
1393 Ga0496101_0622871
1394 Ga0496102_0002637
1395 Ga0496102_0179713
1396 Ga0496102_0380372
1397 Ga0496102_0418763
1398 Ga0496102_1174697
1399 Ga0496103_0074544
1400 Ga0496103_0481788
1401 Ga0496103_0708332
1402 Ga0496104_0118373
1403 Ga0496104_0119360
1404 Ga0496104_0182306
1405 Ga0496104_0302847
1406 Ga0496104_0311468
1407 Ga0496105_0047692
1408 Ga0496105_0062706
1409 Ga0496105_0193612
1410 Ga0496105_0272881
1411 Ga0496105_0306076
1412 Ga0496106_0061628
1413 Ga0496106_0273634
1414 Ga0496106_0559064
1415 Ga0496107_0053736
1416 Ga0496107_0268415
1417 Ga0496108_0015442
1418 Ga0496108_0025575
1419 Ga0496108_0098617
1420 Ga0496108_0161458
1421 Ga0496109_0073782
1422 Ga0496109_0284031
1423 Ga0496109_0316638
1424 Ga0496109_0350812
1425 Ga0496109_0351056
1426 Ga0496109_0479486
1427 Ga0496109_0969133
1428 Ga0496110_0019405
1429 Ga0496110_0157301
1430 Ga0496111_0068471
1431 Ga0496111_0173460
1432 Ga0496111_0232293
1433 Ga0496111_0637425
1434 Ga0496111_0693294
1435 Ga0496112_0016662
1436 Ga0496112_0028618
1437 Ga0496112_0060101
1438 Ga0496112_0187444
1439 Ga0496112_0665451
1440 Ga0496112_1314662
1441 Ga0496113_0002216
1442 Ga0496113_0048279
1443 Ga0496113_0150125
1444 Ga0496114_0010811
1445 Ga0496114_0255446
1446 Ga0496115_0002913
1447 Ga0496115_0006579
1448 Ga0496115_0098053
1449 Ga0496115_0146098
1450 Ga0496115_0226220
1451 Ga0496115_0761608
1452 nmdc:mga05p37_1214559_c1
1453 nmdc:mga05p37_128604_c1
1454 nmdc:mga05p37_8732_c1
1455 nmdc:mga0n895_164179_c1
1456 nmdc:mga0n895_432277_c1
1457 nmdc:mga0n895_833013_c1
1458 nmdc:mga0rr50_1483296_c1
1459 nmdc:mga0rr50_176224_c1
1460 nmdc:mga0rr50_629838_c1
1461 nmdc:mga0rr50_751166_c1
1462 nmdc:mga0rr50_951128_c1
1463 nmdc:mga08x19_15186_c1
1464 Ga0495612_0032931

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

8

136

0.92

Map