F477967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 369 | 693 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10010942|Ga0105237_100109421 |
| Length | 248 |
| Sequence | MLHIPGVLTNAQVAQCRDLLDAADWVDGNATSGSQSALAKRNRQLPEGSPVARAVGDAIQDALARHALFFSAALPLKVFPPLFNRYAGGETFGTHVDNAIRLLRGTDFRVRSDLSATLFLEEPDAYDGGELCVEDTYGVHRAKLPAGDLVLYPASSLHHVTPVTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQALSAEKGAKDPMVISLTGIYHNLLRKWRMRRLMRSRCRSYPARRLHHVPTPI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 5 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 6 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 7 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 8 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 9 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 10 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 11 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 12 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 13 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 14 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 15 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 16 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 17 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 18 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 19 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 20 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 21 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 22 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 23 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 24 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 25 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 26 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 27 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 28 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 29 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 30 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 31 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 34 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 35 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 36 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 39 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 40 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 41 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 42 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 43 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 47 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 48 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 49 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 50 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 52 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 54 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 59 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 60 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 61 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 62 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 104 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 105 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 106 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 112 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 225 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 228 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 230 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 231 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 232 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 233 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 234 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 245 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 246 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 309 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 314 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 315 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 316 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 317 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 320 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 325 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 353 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 354 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 355 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 359 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 360 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 363 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 364 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 365 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 366 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 367 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 368 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 369 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.8 |
| Metatranscriptomes | 0 |
| Isolates | 5.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.5 |
| Nodule | 0.55 |
| Rhizoplane | 1.78 |
| Rhizosphere | 73.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1019791 | 3300001904 | Bacteria | 1061 |
| 2 | JGI24740J21852_10015655 | 3300001979 | Bacteria | 2762 |
| 3 | JGI24740J21852_10055397 | 3300001979 | Bacteria | 1116 |
| 4 | JGI24739J22299_10009167 | 3300001989 | Bacteria | 3693 |
| 5 | JGI24739J22299_10011951 | 3300001989 | Bacteria | 3192 |
| 6 | JGI24739J22299_10017615 | 3300001989 | Bacteria | 2575 |
| 7 | JGI24739J22299_10028812 | 3300001989 | Bacteria | 1935 |
| 8 | JGI24739J22299_10034258 | 3300001989 | Bacteria | 1731 |
| 9 | JGI24739J22299_10056136 | 3300001989 | Bacteria | 1257 |
| 10 | JGI24737J22298_10001498 | 3300001990 | Bacteria | 8321 |
| 11 | JGI24737J22298_10007618 | 3300001990 | Bacteria | 3647 |
| 12 | JGI24737J22298_10033516 | 3300001990 | Bacteria | 1595 |
| 13 | JGI24737J22298_10062472 | 3300001990 | Bacteria | 1119 |
| 14 | JGI24735J21928_10000192 | 3300002067 | Bacteria | 21729 |
| 15 | JGI24735J21928_10002707 | 3300002067 | Bacteria | 6123 |
| 16 | JGI24735J21928_10019771 | 3300002067 | Bacteria | 2068 |
| 17 | JGI24735J21928_10024506 | 3300002067 | Bacteria | 1825 |
| 18 | JGI24735J21928_10047776 | 3300002067 | Bacteria | 1240 |
| 19 | JGI24735J21928_10050064 | 3300002067 | Bacteria | 1207 |
| 20 | JGI24750J21931_1000069 | 3300002070 | Bacteria | 15037 |
| 21 | JGI24748J21848_1000066 | 3300002074 | Bacteria | 39384 |
| 22 | JGI24738J21930_10003996 | 3300002075 | Bacteria | 3662 |
| 23 | JGI24738J21930_10047337 | 3300002075 | Bacteria | 875 |
| 24 | JGI24749J21850_1001470 | 3300002076 | Bacteria | 3330 |
| 25 | JGI24744J21845_10011969 | 3300002077 | Bacteria | 1766 |
| 26 | JGI24034J26672_10000015 | 3300002239 | Bacteria | 137655 |
| 27 | JGI24742J22300_10013507 | 3300002244 | Bacteria | 1366 |
| 28 | JGI24751J29686_10000081 | 3300002459 | Bacteria | 53804 |
| 29 | JGI24751J29686_10018967 | 3300002459 | Bacteria | 1423 |
| 30 | JGI25157J39369_1015763 | 3300002741 | Bacteria | 929 |
| 31 | JGI25151J46595_10000729 | 3300003187 | Bacteria | 27328 |
| 32 | JGI25165J46597_1000210 | 3300003214 | Bacteria | 83572 |
| 33 | rootH1_10011990 | 3300003316 | Bacteria | 2701 |
| 34 | rootH2_10096727 | 3300003320 | Bacteria | 1447 |
| 35 | rootH2_10244599 | 3300003320 | Bacteria | 1305 |
| 36 | rootH1_10034821 | 3300003323 | Bacteria | 2190 |
| 37 | rootH1_10106373 | 3300003323 | Bacteria | 4317 |
| 38 | Ga0055532_1000295 | 3300003758 | Bacteria | 30833 |
| 39 | Ga0055532_1000337 | 3300003758 | Bacteria | 25555 |
| 40 | Ga0055532_1000383 | 3300003758 | Bacteria | 22568 |
| 41 | Ga0055527_1000104 | 3300003760 | Bacteria | 60485 |
| 42 | Ga0055527_1000154 | 3300003760 | Bacteria | 48442 |
| 43 | Ga0055535_1000218 | 3300003761 | Bacteria | 60485 |
| 44 | Ga0055535_1000320 | 3300003761 | Bacteria | 48442 |
| 45 | Ga0055542_1000153 | 3300003762 | Bacteria | 87342 |
| 46 | Ga0055542_1017039 | 3300003762 | Bacteria | 1131 |
| 47 | Ga0055529_1000176 | 3300003763 | Bacteria | 87107 |
| 48 | Ga0055529_1005697 | 3300003763 | Bacteria | 1779 |
| 49 | Ga0055537_1000955 | 3300003773 | Bacteria | 13264 |
| 50 | Ga0055524_1003436 | 3300003775 | Bacteria | 7692 |
| 51 | Ga0055534_1005791 | 3300003784 | Bacteria | 3235 |
| 52 | Ga0055528_1001345 | 3300003790 | Bacteria | 15234 |
| 53 | Ga0055531_10004535 | 3300003794 | Bacteria | 8423 |
| 54 | Ga0058692_1015940 | 3300003856 | Bacteria | 1683 |
| 55 | Ga0065165_1000554 | 3300005262 | Bacteria | 56028 |
| 56 | Ga0065707_10119358 | 3300005295 | Bacteria | 2162 |
| 57 | Ga0065707_10141752 | 3300005295 | Bacteria | 1763 |
| 58 | Ga0065707_10291499 | 3300005295 | Bacteria | 1024 |
| 59 | Ga0070658_10000055 | 3300005327 | Bacteria | 114800 |
| 60 | Ga0070658_10002322 | 3300005327 | Bacteria | 15965 |
| 61 | Ga0070658_10062126 | 3300005327 | Bacteria | 3044 |
| 62 | Ga0070658_10063942 | 3300005327 | Bacteria | 3001 |
| 63 | Ga0070676_10008260 | 3300005328 | Bacteria | 5605 |
| 64 | Ga0070676_10145143 | 3300005328 | Bacteria | 1514 |
| 65 | Ga0070690_100000025 | 3300005330 | Bacteria | 69409 |
| 66 | Ga0070670_100000003 | 3300005331 | Bacteria | 529510 |
| 67 | Ga0070670_100641275 | 3300005331 | Bacteria | 952 |
| 68 | Ga0070677_10044357 | 3300005333 | Bacteria | 1769 |
| 69 | Ga0068869_100000341 | 3300005334 | Bacteria | 24968 |
| 70 | Ga0070666_10000015 | 3300005335 | Bacteria | 208372 |
| 71 | Ga0068868_100003972 | 3300005338 | Bacteria | 10324 |
| 72 | Ga0068868_100580509 | 3300005338 | Bacteria | 991 |
| 73 | Ga0070660_100000528 | 3300005339 | Bacteria | 25477 |
| 74 | Ga0070660_100000808 | 3300005339 | Bacteria | 20758 |
| 75 | Ga0070660_100002294 | 3300005339 | Bacteria | 13147 |
| 76 | Ga0070660_100014948 | 3300005339 | Bacteria | 5600 |
| 77 | Ga0070660_100383762 | 3300005339 | Bacteria | 1160 |
| 78 | Ga0070660_100482566 | 3300005339 | Bacteria | 1030 |
| 79 | Ga0070660_100493352 | 3300005339 | Bacteria | 1018 |
| 80 | Ga0070660_100563357 | 3300005339 | Bacteria | 951 |
| 81 | Ga0070689_100044006 | 3300005340 | Bacteria | 3434 |
| 82 | Ga0070661_100020324 | 3300005344 | Bacteria | 4734 |
| 83 | Ga0070661_100080760 | 3300005344 | Bacteria | 2400 |
| 84 | Ga0070661_100116020 | 3300005344 | Bacteria | 2003 |
| 85 | Ga0070668_100001896 | 3300005347 | Bacteria | 15291 |
| 86 | Ga0070668_100017496 | 3300005347 | Bacteria | 5374 |
| 87 | Ga0070668_100029444 | 3300005347 | Bacteria | 4171 |
| 88 | Ga0070668_100098141 | 3300005347 | Bacteria | 2318 |
| 89 | Ga0070669_100000044 | 3300005353 | Bacteria | 121087 |
| 90 | Ga0070669_100000059 | 3300005353 | Bacteria | 108504 |
| 91 | Ga0070669_100018483 | 3300005353 | Bacteria | 4981 |
| 92 | Ga0070671_100000769 | 3300005355 | Bacteria | 23061 |
| 93 | Ga0070671_100019548 | 3300005355 | Bacteria | 5515 |
| 94 | Ga0070671_100034287 | 3300005355 | Bacteria | 4202 |
| 95 | Ga0070674_100034464 | 3300005356 | Bacteria | 3382 |
| 96 | Ga0070674_100116594 | 3300005356 | Bacteria | 1970 |
| 97 | Ga0070673_100000014 | 3300005364 | Bacteria | 135250 |
| 98 | Ga0070688_100001673 | 3300005365 | Bacteria | 11096 |
| 99 | Ga0070659_100000012 | 3300005366 | Bacteria | 180004 |
| 100 | Ga0070659_100033494 | 3300005366 | Bacteria | 3990 |
| 101 | Ga0070659_100736610 | 3300005366 | Bacteria | 854 |
| 102 | Ga0070667_100000122 | 3300005367 | Bacteria | 99820 |
| 103 | Ga0070667_100021344 | 3300005367 | Bacteria | 5378 |
| 104 | Ga0070667_100113228 | 3300005367 | Bacteria | 2354 |
| 105 | Ga0070714_100007023 | 3300005435 | Bacteria | 8728 |
| 106 | Ga0070663_100002534 | 3300005455 | Bacteria | 10318 |
| 107 | Ga0070663_100007613 | 3300005455 | Bacteria | 6606 |
| 108 | Ga0070663_100083165 | 3300005455 | Bacteria | 2357 |
| 109 | Ga0070678_100025451 | 3300005456 | Bacteria | 3982 |
| 110 | Ga0070662_100011712 | 3300005457 | Bacteria | 5789 |
| 111 | Ga0070662_100057319 | 3300005457 | Bacteria | 2831 |
| 112 | Ga0070662_100078818 | 3300005457 | Bacteria | 2448 |
| 113 | Ga0070662_100340661 | 3300005457 | Bacteria | 1227 |
| 114 | Ga0070662_100661740 | 3300005457 | Bacteria | 881 |
| 115 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 116 | Ga0070685_10000297 | 3300005466 | Bacteria | 31390 |
| 117 | Ga0068853_100004394 | 3300005539 | Bacteria | 10918 |
| 118 | Ga0068853_100012544 | 3300005539 | Bacteria | 6894 |
| 119 | Ga0068853_100108371 | 3300005539 | Bacteria | 2464 |
| 120 | Ga0070672_100161678 | 3300005543 | Bacteria | 1858 |
| 121 | Ga0070686_100000006 | 3300005544 | Bacteria | 243316 |
| 122 | Ga0070693_100698981 | 3300005547 | Bacteria | 742 |
| 123 | Ga0070665_100000217 | 3300005548 | Bacteria | 97947 |
| 124 | Ga0070665_100577392 | 3300005548 | Bacteria | 1137 |
| 125 | Ga0068855_100000504 | 3300005563 | Bacteria | 48297 |
| 126 | Ga0068855_100023939 | 3300005563 | Bacteria | 7312 |
| 127 | Ga0068855_100141969 | 3300005563 | Bacteria | 2736 |
| 128 | Ga0068855_100150611 | 3300005563 | Bacteria | 2645 |
| 129 | Ga0068855_100611148 | 3300005563 | Bacteria | 1175 |
| 130 | Ga0070664_100118181 | 3300005564 | Bacteria | 2319 |
| 131 | Ga0068857_100056055 | 3300005577 | Bacteria | 3497 |
| 132 | Ga0068857_100106634 | 3300005577 | Bacteria | 2516 |
| 133 | Ga0068857_100682101 | 3300005577 | Bacteria | 975 |
| 134 | Ga0068857_100744091 | 3300005577 | Bacteria | 934 |
| 135 | Ga0068854_100000118 | 3300005578 | Bacteria | 54862 |
| 136 | Ga0068854_100003080 | 3300005578 | Bacteria | 10382 |
| 137 | Ga0068854_100213736 | 3300005578 | Bacteria | 1522 |
| 138 | Ga0068856_100006838 | 3300005614 | Bacteria | 11160 |
| 139 | Ga0068856_100014767 | 3300005614 | Bacteria | 7538 |
| 140 | Ga0068856_100068422 | 3300005614 | Bacteria | 3510 |
| 141 | Ga0068856_100078523 | 3300005614 | Bacteria | 3272 |
| 142 | Ga0068852_100000052 | 3300005616 | Bacteria | 80329 |
| 143 | Ga0068852_100040513 | 3300005616 | Bacteria | 3930 |
| 144 | Ga0068852_100484646 | 3300005616 | Bacteria | 1229 |
| 145 | Ga0068852_100532832 | 3300005616 | Bacteria | 1173 |
| 146 | Ga0068859_100017939 | 3300005617 | Bacteria | 7113 |
| 147 | Ga0068859_100086474 | 3300005617 | Bacteria | 3182 |
| 148 | Ga0068864_100000158 | 3300005618 | Bacteria | 62676 |
| 149 | Ga0068864_100010503 | 3300005618 | Bacteria | 7652 |
| 150 | Ga0068864_100012183 | 3300005618 | Bacteria | 7108 |
| 151 | Ga0068861_100012847 | 3300005719 | Bacteria | 5848 |
| 152 | Ga0068851_10281296 | 3300005834 | Bacteria | 951 |
| 153 | Ga0068863_100000108 | 3300005841 | Bacteria | 87921 |
| 154 | Ga0068863_100000822 | 3300005841 | Bacteria | 31110 |
| 155 | Ga0068858_100000582 | 3300005842 | Bacteria | 38264 |
| 156 | Ga0068858_100107169 | 3300005842 | Bacteria | 2608 |
| 157 | Ga0068860_100000027 | 3300005843 | Bacteria | 267207 |
| 158 | Ga0068860_100000050 | 3300005843 | Bacteria | 208372 |
| 159 | Ga0068860_100000152 | 3300005843 | Bacteria | 112187 |
| 160 | Ga0068860_100064295 | 3300005843 | Bacteria | 3485 |
| 161 | Ga0068862_100000001 | 3300005844 | Bacteria | 523031 |
| 162 | Ga0068862_100000062 | 3300005844 | Bacteria | 126792 |
| 163 | Ga0068862_100012059 | 3300005844 | Bacteria | 7144 |
| 164 | Ga0068862_100087844 | 3300005844 | Bacteria | 2704 |
| 165 | Ga0075365_10067723 | 3300006038 | Bacteria | 2397 |
| 166 | Ga0075368_10126319 | 3300006042 | Bacteria | 1061 |
| 167 | Ga0075368_10142748 | 3300006042 | Bacteria | 998 |
| 168 | Ga0075363_100104477 | 3300006048 | Bacteria | 1570 |
| 169 | Ga0075364_10030582 | 3300006051 | Bacteria | 3457 |
| 170 | Ga0075364_10034355 | 3300006051 | Bacteria | 3270 |
| 171 | Ga0075364_10065301 | 3300006051 | Bacteria | 2389 |
| 172 | Ga0075367_10041669 | 3300006178 | Bacteria | 2685 |
| 173 | Ga0075369_10016731 | 3300006186 | Bacteria | 2963 |
| 174 | Ga0075369_10048667 | 3300006186 | Bacteria | 1830 |
| 175 | Ga0075366_10012947 | 3300006195 | Bacteria | 4741 |
| 176 | Ga0075366_10098496 | 3300006195 | Bacteria | 1754 |
| 177 | Ga0075366_10182120 | 3300006195 | Bacteria | 1276 |
| 178 | Ga0097621_100079644 | 3300006237 | Bacteria | 2724 |
| 179 | Ga0075370_10016652 | 3300006353 | Bacteria | 3957 |
| 180 | Ga0068865_100001468 | 3300006881 | Bacteria | 13726 |
| 181 | Ga0097620_100017941 | 3300006931 | Bacteria | 7113 |
| 182 | Ga0097620_100086477 | 3300006931 | Bacteria | 3182 |
| 183 | Ga0105250_10021233 | 3300009092 | Bacteria | 2621 |
| 184 | Ga0105250_10037938 | 3300009092 | Bacteria | 1933 |
| 185 | Ga0105240_10001781 | 3300009093 | Bacteria | 36346 |
| 186 | Ga0105240_10026941 | 3300009093 | Bacteria | 7535 |
| 187 | Ga0105240_10029050 | 3300009093 | Bacteria | 7211 |
| 188 | Ga0105240_10037814 | 3300009093 | Bacteria | 6198 |
| 189 | Ga0105240_10100701 | 3300009093 | Bacteria | 3515 |
| 190 | Ga0105240_10108847 | 3300009093 | Bacteria | 3357 |
| 191 | Ga0105240_10491836 | 3300009093 | Bacteria | 1366 |
| 192 | Ga0105245_10021319 | 3300009098 | Bacteria | 5682 |
| 193 | Ga0105245_10738422 | 3300009098 | Bacteria | 1020 |
| 194 | Ga0105247_10004563 | 3300009101 | Bacteria | 8831 |
| 195 | Ga0105243_10004912 | 3300009148 | Bacteria | 10482 |
| 196 | Ga0105243_10069073 | 3300009148 | Bacteria | 2849 |
| 197 | Ga0105241_10100053 | 3300009174 | Bacteria | 2304 |
| 198 | Ga0105241_10537986 | 3300009174 | Bacteria | 1047 |
| 199 | Ga0105242_10032014 | 3300009176 | Bacteria | 4204 |
| 200 | Ga0105242_10246115 | 3300009176 | Bacteria | 1609 |
| 201 | Ga0105242_10263885 | 3300009176 | Bacteria | 1557 |
| 202 | Ga0105248_10000287 | 3300009177 | Bacteria | 59537 |
| 203 | Ga0105237_10010942 | 3300009545 | Bacteria | 9628 |
| 204 | Ga0105237_10014511 | 3300009545 | Bacteria | 8235 |
| 205 | Ga0105237_10251237 | 3300009545 | Bacteria | 1770 |
| 206 | Ga0105237_10764331 | 3300009545 | Bacteria | 973 |
| 207 | Ga0105238_10025625 | 3300009551 | Bacteria | 6011 |
| 208 | Ga0105238_10032172 | 3300009551 | Bacteria | 5337 |
| 209 | Ga0105238_10093566 | 3300009551 | Bacteria | 2993 |
| 210 | Ga0105238_10265730 | 3300009551 | Bacteria | 1696 |
| 211 | Ga0105249_10000034 | 3300009553 | Bacteria | 208378 |
| 212 | Ga0105249_10022159 | 3300009553 | Bacteria | 5689 |
| 213 | Ga0105249_10280644 | 3300009553 | Bacteria | 1663 |
| 214 | Ga0105239_10035096 | 3300010375 | Bacteria | 5508 |
| 215 | Ga0105239_10039763 | 3300010375 | Bacteria | 5153 |
| 216 | Ga0105239_10535060 | 3300010375 | Bacteria | 1334 |
| 217 | Ga0105246_10019158 | 3300011119 | Bacteria | 4368 |
| 218 | Ga0105246_10372685 | 3300011119 | Bacteria | 1177 |
| 219 | Ga0157373_10033893 | 3300013100 | Bacteria | 3669 |
| 220 | Ga0157370_10000417 | 3300013104 | Bacteria | 53666 |
| 221 | Ga0157370_10034274 | 3300013104 | Bacteria | 4945 |
| 222 | Ga0157370_10114459 | 3300013104 | Bacteria | 2520 |
| 223 | Ga0157369_10028725 | 3300013105 | Bacteria | 6151 |
| 224 | Ga0157369_10054005 | 3300013105 | Bacteria | 4339 |
| 225 | Ga0157369_10067052 | 3300013105 | Bacteria | 3860 |
| 226 | Ga0157369_10067333 | 3300013105 | Bacteria | 3850 |
| 227 | Ga0157374_10036569 | 3300013296 | Bacteria | 4499 |
| 228 | Ga0157374_10041240 | 3300013296 | Bacteria | 4253 |
| 229 | Ga0157378_10038203 | 3300013297 | Bacteria | 4254 |
| 230 | Ga0163162_10491301 | 3300013306 | Bacteria | 1358 |
| 231 | Ga0163162_10536804 | 3300013306 | Bacteria | 1298 |
| 232 | Ga0163162_11062791 | 3300013306 | Bacteria | 916 |
| 233 | Ga0157372_10017620 | 3300013307 | Bacteria | 7666 |
| 234 | Ga0157372_10047910 | 3300013307 | Bacteria | 4750 |
| 235 | Ga0157372_10056034 | 3300013307 | Bacteria | 4404 |
| 236 | Ga0157372_10565479 | 3300013307 | Bacteria | 1325 |
| 237 | Ga0157372_10631355 | 3300013307 | Bacteria | 1248 |
| 238 | Ga0157372_11168844 | 3300013307 | Bacteria | 889 |
| 239 | Ga0157375_10011625 | 3300013308 | Bacteria | 7779 |
| 240 | Ga0163163_10012276 | 3300014325 | Bacteria | 7801 |
| 241 | Ga0163163_10065573 | 3300014325 | Bacteria | 3605 |
| 242 | Ga0157380_10000755 | 3300014326 | Bacteria | 20159 |
| 243 | Ga0157380_10117710 | 3300014326 | Bacteria | 2245 |
| 244 | Ga0157377_10052178 | 3300014745 | Bacteria | 2308 |
| 245 | Ga0157379_10070753 | 3300014968 | Bacteria | 3121 |
| 246 | Ga0157376_10000337 | 3300014969 | Bacteria | 31344 |
| 247 | Ga0157376_10246174 | 3300014969 | Bacteria | 1668 |
| 248 | Ga0182007_10001530 | 3300015262 | Bacteria | 12363 |
| 249 | Ga0163161_10000051 | 3300017792 | Bacteria | 122360 |
| 250 | Ga0209566_100245 | 3300025225 | Bacteria | 52020 |
| 251 | Ga0209674_102389 | 3300025226 | Bacteria | 4062 |
| 252 | Ga0209672_100032 | 3300025228 | Bacteria | 324684 |
| 253 | Ga0209672_100042 | 3300025228 | Bacteria | 272005 |
| 254 | Ga0209147_100012 | 3300025229 | Bacteria | 681990 |
| 255 | Ga0209147_100046 | 3300025229 | Bacteria | 295158 |
| 256 | Ga0209147_100052 | 3300025229 | Bacteria | 272005 |
| 257 | Ga0207427_101415 | 3300025231 | Bacteria | 8762 |
| 258 | Ga0209258_100030 | 3300025242 | Bacteria | 470208 |
| 259 | Ga0209258_100073 | 3300025242 | Bacteria | 272005 |
| 260 | Ga0209026_1000525 | 3300025250 | Bacteria | 26985 |
| 261 | Ga0209026_1000593 | 3300025250 | Bacteria | 23624 |
| 262 | Ga0209026_1002460 | 3300025250 | Bacteria | 6938 |
| 263 | Ga0209148_1000022 | 3300025254 | Bacteria | 681990 |
| 264 | Ga0209148_1000146 | 3300025254 | Bacteria | 160734 |
| 265 | Ga0209148_1000807 | 3300025254 | Bacteria | 22828 |
| 266 | Ga0209148_1002629 | 3300025254 | Bacteria | 5847 |
| 267 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 268 | Ga0209565_1000156 | 3300025263 | Bacteria | 91427 |
| 269 | Ga0209565_1001983 | 3300025263 | Bacteria | 7986 |
| 270 | Ga0209565_1007365 | 3300025263 | Bacteria | 2977 |
| 271 | Ga0209455_1000024 | 3300025272 | Bacteria | 676133 |
| 272 | Ga0209455_1000324 | 3300025272 | Bacteria | 47295 |
| 273 | Ga0209455_1001136 | 3300025272 | Bacteria | 12914 |
| 274 | Ga0209673_1000021 | 3300025273 | Bacteria | 422978 |
| 275 | Ga0209675_1002385 | 3300025291 | Bacteria | 9688 |
| 276 | Ga0209675_1004411 | 3300025291 | Bacteria | 6264 |
| 277 | Ga0209025_1002038 | 3300025294 | Bacteria | 23035 |
| 278 | Ga0209025_1002325 | 3300025294 | Bacteria | 20542 |
| 279 | Ga0209564_1000779 | 3300025295 | Bacteria | 44233 |
| 280 | Ga0209564_1001967 | 3300025295 | Bacteria | 18091 |
| 281 | Ga0209758_1001451 | 3300025297 | Bacteria | 27861 |
| 282 | Ga0209050_1000245 | 3300025298 | Bacteria | 116929 |
| 283 | Ga0209256_1000486 | 3300025299 | Bacteria | 58822 |
| 284 | Ga0209256_1001034 | 3300025299 | Bacteria | 32637 |
| 285 | Ga0209051_1049422 | 3300025303 | Bacteria | 1417 |
| 286 | Ga0209257_1002240 | 3300025304 | Bacteria | 19852 |
| 287 | Ga0207697_10083898 | 3300025315 | Bacteria | 1344 |
| 288 | Ga0207656_10003640 | 3300025321 | Bacteria | 5323 |
| 289 | Ga0207656_10249528 | 3300025321 | Bacteria | 869 |
| 290 | Ga0207696_1044986 | 3300025711 | Bacteria | 1278 |
| 291 | Ga0207696_1059561 | 3300025711 | Bacteria | 1076 |
| 292 | Ga0207688_10144551 | 3300025901 | Bacteria | 1401 |
| 293 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 294 | Ga0207647_10001490 | 3300025904 | Bacteria | 17990 |
| 295 | Ga0207647_10002206 | 3300025904 | Bacteria | 14845 |
| 296 | Ga0207647_10008343 | 3300025904 | Bacteria | 7431 |
| 297 | Ga0207647_10012534 | 3300025904 | Bacteria | 5898 |
| 298 | Ga0207647_10016981 | 3300025904 | Bacteria | 4955 |
| 299 | Ga0207647_10123136 | 3300025904 | Bacteria | 1528 |
| 300 | Ga0207647_10126392 | 3300025904 | Bacteria | 1504 |
| 301 | Ga0207647_10136430 | 3300025904 | Bacteria | 1440 |
| 302 | Ga0207647_10356645 | 3300025904 | Bacteria | 828 |
| 303 | Ga0207645_10014651 | 3300025907 | Bacteria | 5236 |
| 304 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 305 | Ga0207705_10001077 | 3300025909 | Bacteria | 22145 |
| 306 | Ga0207705_10003820 | 3300025909 | Bacteria | 11458 |
| 307 | Ga0207705_10151565 | 3300025909 | Bacteria | 1737 |
| 308 | Ga0207654_10004007 | 3300025911 | Bacteria | 7414 |
| 309 | Ga0207654_10021492 | 3300025911 | Bacteria | 3432 |
| 310 | Ga0207654_10215808 | 3300025911 | Bacteria | 1270 |
| 311 | Ga0207654_10272466 | 3300025911 | Bacteria | 1142 |
| 312 | Ga0207695_10001076 | 3300025913 | Bacteria | 47744 |
| 313 | Ga0207695_10006157 | 3300025913 | Bacteria | 15640 |
| 314 | Ga0207695_10029082 | 3300025913 | Bacteria | 6115 |
| 315 | Ga0207695_10037531 | 3300025913 | Bacteria | 5227 |
| 316 | Ga0207695_10081454 | 3300025913 | Bacteria | 3275 |
| 317 | Ga0207695_10150044 | 3300025913 | Bacteria | 2271 |
| 318 | Ga0207695_10360639 | 3300025913 | Bacteria | 1340 |
| 319 | Ga0207671_10000658 | 3300025914 | Bacteria | 45037 |
| 320 | Ga0207671_10001304 | 3300025914 | Bacteria | 29270 |
| 321 | Ga0207671_10067494 | 3300025914 | Bacteria | 2663 |
| 322 | Ga0207671_10114499 | 3300025914 | Bacteria | 2055 |
| 323 | Ga0207671_10271865 | 3300025914 | Bacteria | 1335 |
| 324 | Ga0207657_10000013 | 3300025919 | Bacteria | 180080 |
| 325 | Ga0207657_10001160 | 3300025919 | Bacteria | 28040 |
| 326 | Ga0207657_10001846 | 3300025919 | Bacteria | 22883 |
| 327 | Ga0207657_10018891 | 3300025919 | Bacteria | 6562 |
| 328 | Ga0207657_10023265 | 3300025919 | Bacteria | 5773 |
| 329 | Ga0207657_10201668 | 3300025919 | Bacteria | 1600 |
| 330 | Ga0207649_10051407 | 3300025920 | Bacteria | 2552 |
| 331 | Ga0207649_10133213 | 3300025920 | Bacteria | 1691 |
| 332 | Ga0207649_10163182 | 3300025920 | Unclassified | 1545 |
| 333 | Ga0207681_10000041 | 3300025923 | Bacteria | 140201 |
| 334 | Ga0207681_10000089 | 3300025923 | Bacteria | 79526 |
| 335 | Ga0207681_10035754 | 3300025923 | Bacteria | 3275 |
| 336 | Ga0207694_10001347 | 3300025924 | Bacteria | 21148 |
| 337 | Ga0207694_10014825 | 3300025924 | Bacteria | 5877 |
| 338 | Ga0207650_10000004 | 3300025925 | Bacteria | 743372 |
| 339 | Ga0207650_10613215 | 3300025925 | Bacteria | 916 |
| 340 | Ga0207659_10082336 | 3300025926 | Bacteria | 2382 |
| 341 | Ga0207664_10000966 | 3300025929 | Bacteria | 19382 |
| 342 | Ga0207644_10033388 | 3300025931 | Bacteria | 3595 |
| 343 | Ga0207644_10117783 | 3300025931 | Bacteria | 2017 |
| 344 | Ga0207644_10167615 | 3300025931 | Bacteria | 1712 |
| 345 | Ga0207690_10000107 | 3300025932 | Bacteria | 67606 |
| 346 | Ga0207690_10134778 | 3300025932 | Bacteria | 1812 |
| 347 | Ga0207690_10352367 | 3300025932 | Bacteria | 1164 |
| 348 | Ga0207690_10795736 | 3300025932 | Bacteria | 781 |
| 349 | Ga0207706_10007212 | 3300025933 | Bacteria | 10277 |
| 350 | Ga0207706_10024340 | 3300025933 | Bacteria | 5428 |
| 351 | Ga0207706_10027727 | 3300025933 | Bacteria | 5063 |
| 352 | Ga0207706_10070121 | 3300025933 | Bacteria | 3083 |
| 353 | Ga0207706_10158944 | 3300025933 | Bacteria | 1987 |
| 354 | Ga0207706_10352695 | 3300025933 | Bacteria | 1279 |
| 355 | Ga0207686_10015986 | 3300025934 | Bacteria | 4205 |
| 356 | Ga0207686_10068267 | 3300025934 | Bacteria | 2277 |
| 357 | Ga0207686_10289287 | 3300025934 | Bacteria | 1213 |
| 358 | Ga0207709_10000221 | 3300025935 | Bacteria | 72262 |
| 359 | Ga0207709_10499181 | 3300025935 | Bacteria | 949 |
| 360 | Ga0207670_10106950 | 3300025936 | Bacteria | 2008 |
| 361 | Ga0207669_10017310 | 3300025937 | Bacteria | 3693 |
| 362 | Ga0207669_10019730 | 3300025937 | Bacteria | 3518 |
| 363 | Ga0207669_10058530 | 3300025937 | Bacteria | 2351 |
| 364 | Ga0207704_10000072 | 3300025938 | Bacteria | 63809 |
| 365 | Ga0207704_10586284 | 3300025938 | Bacteria | 911 |
| 366 | Ga0207711_10000658 | 3300025941 | Bacteria | 34432 |
| 367 | Ga0207711_10019349 | 3300025941 | Bacteria | 5669 |
| 368 | Ga0207711_10038559 | 3300025941 | Bacteria | 4064 |
| 369 | Ga0207711_10053973 | 3300025941 | Bacteria | 3447 |
| 370 | Ga0207689_10000890 | 3300025942 | Bacteria | 28729 |
| 371 | Ga0207679_10577545 | 3300025945 | Bacteria | 1011 |
| 372 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 373 | Ga0207667_10004684 | 3300025949 | Bacteria | 16743 |
| 374 | Ga0207667_10007685 | 3300025949 | Bacteria | 12904 |
| 375 | Ga0207667_10026817 | 3300025949 | Bacteria | 6287 |
| 376 | Ga0207667_10064882 | 3300025949 | Bacteria | 3810 |
| 377 | Ga0207667_10073584 | 3300025949 | Bacteria | 3550 |
| 378 | Ga0207667_10078998 | 3300025949 | Bacteria | 3410 |
| 379 | Ga0207667_10325035 | 3300025949 | Bacteria | 1571 |
| 380 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 381 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 382 | Ga0207712_10014752 | 3300025961 | Bacteria | 5031 |
| 383 | Ga0207668_10005056 | 3300025972 | Bacteria | 7764 |
| 384 | Ga0207668_10011837 | 3300025972 | Bacteria | 5318 |
| 385 | Ga0207668_10020402 | 3300025972 | Bacteria | 4210 |
| 386 | Ga0207668_10034517 | 3300025972 | Bacteria | 3360 |
| 387 | Ga0207668_10163054 | 3300025972 | Bacteria | 1739 |
| 388 | Ga0207640_10000085 | 3300025981 | Bacteria | 73838 |
| 389 | Ga0207640_10150829 | 3300025981 | Bacteria | 1708 |
| 390 | Ga0207640_10562878 | 3300025981 | Bacteria | 960 |
| 391 | Ga0207658_10000092 | 3300025986 | Bacteria | 99965 |
| 392 | Ga0207658_10000921 | 3300025986 | Bacteria | 24296 |
| 393 | Ga0207658_10010969 | 3300025986 | Bacteria | 6170 |
| 394 | Ga0207677_10000138 | 3300026023 | Bacteria | 59552 |
| 395 | Ga0207703_10001141 | 3300026035 | Bacteria | 25115 |
| 396 | Ga0207703_10979829 | 3300026035 | Bacteria | 811 |
| 397 | Ga0207639_10008807 | 3300026041 | Bacteria | 6936 |
| 398 | Ga0207639_10075564 | 3300026041 | Bacteria | 2650 |
| 399 | Ga0207639_10089269 | 3300026041 | Bacteria | 2462 |
| 400 | Ga0207639_10583051 | 3300026041 | Bacteria | 1030 |
| 401 | Ga0207639_10881638 | 3300026041 | Bacteria | 836 |
| 402 | Ga0207678_10006932 | 3300026067 | Bacteria | 10058 |
| 403 | Ga0207678_10024856 | 3300026067 | Bacteria | 5230 |
| 404 | Ga0207678_10056282 | 3300026067 | Bacteria | 3386 |
| 405 | Ga0207678_10079999 | 3300026067 | Bacteria | 2798 |
| 406 | Ga0207702_10007061 | 3300026078 | Bacteria | 9605 |
| 407 | Ga0207702_10007774 | 3300026078 | Bacteria | 9103 |
| 408 | Ga0207702_10038800 | 3300026078 | Bacteria | 3989 |
| 409 | Ga0207702_10120006 | 3300026078 | Bacteria | 2352 |
| 410 | Ga0207702_10292270 | 3300026078 | Bacteria | 1544 |
| 411 | Ga0207641_10000428 | 3300026088 | Bacteria | 48639 |
| 412 | Ga0207641_10000580 | 3300026088 | Bacteria | 40301 |
| 413 | Ga0207641_10009974 | 3300026088 | Bacteria | 7815 |
| 414 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 415 | Ga0207648_10020229 | 3300026089 | Bacteria | 5998 |
| 416 | Ga0207676_10000006 | 3300026095 | Bacteria | 681936 |
| 417 | Ga0207676_10007870 | 3300026095 | Bacteria | 7579 |
| 418 | Ga0207676_10008879 | 3300026095 | Bacteria | 7149 |
| 419 | Ga0207674_10028673 | 3300026116 | Bacteria | 5872 |
| 420 | Ga0207674_10038526 | 3300026116 | Bacteria | 4959 |
| 421 | Ga0207675_100000309 | 3300026118 | Bacteria | 46765 |
| 422 | Ga0207675_100000449 | 3300026118 | Bacteria | 39979 |
| 423 | Ga0207675_100425178 | 3300026118 | Bacteria | 1312 |
| 424 | Ga0207683_10036983 | 3300026121 | Bacteria | 4251 |
| 425 | Ga0207683_10063880 | 3300026121 | Bacteria | 3243 |
| 426 | Ga0207698_10000198 | 3300026142 | Bacteria | 37741 |
| 427 | Ga0207698_10082607 | 3300026142 | Bacteria | 2598 |
| 428 | Ga0207698_10873425 | 3300026142 | Bacteria | 905 |
| 429 | Ga0209371_1000850 | 3300027312 | Bacteria | 24775 |
| 430 | Ga0209813_10000078 | 3300027866 | Bacteria | 36150 |
| 431 | Ga0268266_10000225 | 3300028379 | Bacteria | 98082 |
| 432 | Ga0268266_10116000 | 3300028379 | Bacteria | 2378 |
| 433 | Ga0268266_10493023 | 3300028379 | Bacteria | 1169 |
| 434 | Ga0268265_10000001 | 3300028380 | Bacteria | 1230727 |
| 435 | Ga0268265_10000086 | 3300028380 | Bacteria | 119049 |
| 436 | Ga0268265_10053268 | 3300028380 | Bacteria | 3065 |
| 437 | Ga0268265_10068436 | 3300028380 | Bacteria | 2753 |
| 438 | Ga0268265_10459001 | 3300028380 | Bacteria | 1192 |
| 439 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 440 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 441 | Ga0268264_10000111 | 3300028381 | Bacteria | 204718 |
| 442 | Ga0268256_1000711 | 3300030500 | Bacteria | 24775 |
| 443 | Ga0265328_10000259 | 3300031239 | Bacteria | 24437 |
| 444 | Ga0265328_10003790 | 3300031239 | Bacteria | 6646 |
| 445 | Ga0265328_10004540 | 3300031239 | Bacteria | 6019 |
| 446 | Ga0265331_10000026 | 3300031250 | Bacteria | 223760 |
| 447 | Ga0265327_10016714 | 3300031251 | Bacteria | 4642 |
| 448 | Ga0307513_10049167 | 3300031456 | Bacteria | 4570 |
| 449 | Ga0307513_10070975 | 3300031456 | Bacteria | 3637 |
| 450 | Ga0307405_10155226 | 3300031731 | Bacteria | 1614 |
| 451 | Ga0307410_10149311 | 3300031852 | Bacteria | 1738 |
| 452 | Ga0307412_10001980 | 3300031911 | Bacteria | 11350 |
| 453 | Ga0307412_10081410 | 3300031911 | Bacteria | 2239 |
| 454 | Ga0307411_10051058 | 3300032005 | Bacteria | 2697 |
| 455 | Ga0307510_10099793 | 3300033180 | Bacteria | 2699 |
| 456 | Ga0373932_0006287 | 3300035112 | Bacteria | 2808 |
| 457 | Ga0316574_0516480 | 3300035398 | Bacteria | 744 |
| 458 | Ga0395899_0002611 | 3300037312 | Bacteria | 14528 |
| 459 | Ga0395900_0010043 | 3300037418 | Bacteria | 9685 |
| 460 | Ga0395900_0032290 | 3300037418 | Bacteria | 5383 |
| 461 | Ga0395900_0418911 | 3300037418 | Bacteria | 1300 |
| 462 | Ga0395898_0083168 | 3300037466 | Bacteria | 3085 |
| 463 | Ga0395898_0402221 | 3300037466 | Bacteria | 1306 |
| 464 | Ga0395905_0091569 | 3300037471 | Bacteria | 2851 |
| 465 | Ga0395905_0113453 | 3300037471 | Bacteria | 2546 |
| 466 | Ga0395905_0192495 | 3300037471 | Bacteria | 1913 |
| 467 | Ga0451800_1536917 | 3300041459 | Bacteria | 811 |
| 468 | Ga0451802_0647442 | 3300041460 | Bacteria | 1727 |
| 469 | Ga0451853_1688911 | 3300041512 | Bacteria | 1820 |
| 470 | Ga0439448_0000682 | 3300042005 | Bacteria | 8111 |
| 471 | Ga0439448_0006111 | 3300042005 | Bacteria | 3454 |
| 472 | Ga0439448_0007335 | 3300042005 | Bacteria | 3193 |
| 473 | Ga0439455_0006286 | 3300042012 | Bacteria | 2458 |
| 474 | Ga0439458_0000401 | 3300042157 | Bacteria | 10908 |
| 475 | Ga0439458_0001321 | 3300042157 | Bacteria | 6261 |
| 476 | Ga0439458_0005411 | 3300042157 | Bacteria | 2871 |
| 477 | Ga0466972_0001033 | 3300044658 | Bacteria | 13353 |
| 478 | Ga0466965_0004366 | 3300044683 | Bacteria | 6286 |
| 479 | Ga0466965_0329440 | 3300044683 | Bacteria | 833 |
| 480 | Ga0466966_0015458 | 3300044684 | Bacteria | 5045 |
| 481 | Ga0466961_0003630 | 3300044693 | Bacteria | 9609 |
| 482 | Ga0466961_0151671 | 3300044693 | Bacteria | 1447 |
| 483 | Ga0466963_0001012 | 3300044694 | Bacteria | 14536 |
| 484 | Ga0466964_0034760 | 3300044706 | Bacteria | 2012 |
| 485 | Ga0466971_0017725 | 3300044719 | Bacteria | 3153 |
| 486 | Ga0466968_0240721 | 3300044735 | Bacteria | 857 |
| 487 | Ga0466970_0006546 | 3300044765 | Bacteria | 5821 |
| 488 | Ga0466957_0044461 | 3300044842 | Bacteria | 2691 |
| 489 | Ga0466957_0487446 | 3300044842 | Bacteria | 853 |
| 490 | Ga0466960_0019912 | 3300044901 | Bacteria | 2964 |
| 491 | Ga0466959_0003970 | 3300045049 | Bacteria | 9831 |
| 492 | Ga0466967_0045808 | 3300045976 | Bacteria | 3803 |
| 493 | Ga0466967_0545258 | 3300045976 | Bacteria | 1141 |
| 494 | Ga0495603_0003196 | 3300046455 | Bacteria | 9751 |
| 495 | Ga0495591_004493 | 3300046458 | Bacteria | 6810 |
| 496 | Ga0495629_0005720 | 3300046459 | Bacteria | 9276 |
| 497 | Ga0495629_0008470 | 3300046459 | Bacteria | 7572 |
| 498 | Ga0495629_0263078 | 3300046459 | Bacteria | 1185 |
| 499 | Ga0495651_0004351 | 3300046462 | Bacteria | 10840 |
| 500 | Ga0495653_0051319 | 3300046463 | Bacteria | 3167 |
| 501 | Ga0495653_0099301 | 3300046463 | Bacteria | 2112 |
| 502 | Ga0495653_0313275 | 3300046463 | Bacteria | 1019 |
| 503 | Ga0495650_0001337 | 3300046471 | Bacteria | 24602 |
| 504 | Ga0495580_0000090 | 3300046472 | Bacteria | 59451 |
| 505 | Ga0495580_0000879 | 3300046472 | Bacteria | 26043 |
| 506 | Ga0495580_0030106 | 3300046472 | Bacteria | 3933 |
| 507 | Ga0495580_0131769 | 3300046472 | Bacteria | 1734 |
| 508 | Ga0495662_0004557 | 3300046476 | Bacteria | 6952 |
| 509 | Ga0495664_0004969 | 3300046477 | Bacteria | 7278 |
| 510 | Ga0495664_0014885 | 3300046477 | Bacteria | 4415 |
| 511 | Ga0495596_0004191 | 3300046500 | Bacteria | 7082 |
| 512 | Ga0495583_0106244 | 3300046506 | Bacteria | 1193 |
| 513 | Ga0495606_0000406 | 3300046507 | Bacteria | 72668 |
| 514 | Ga0495606_0162930 | 3300046507 | Bacteria | 1299 |
| 515 | Ga0495606_0187583 | 3300046507 | Bacteria | 1188 |
| 516 | Ga0495608_0005489 | 3300046511 | Bacteria | 9063 |
| 517 | Ga0495618_0003258 | 3300046514 | Bacteria | 10164 |
| 518 | Ga0495628_0000937 | 3300046516 | Bacteria | 26727 |
| 519 | Ga0495628_0081023 | 3300046516 | Bacteria | 2521 |
| 520 | Ga0495630_0010828 | 3300046517 | Bacteria | 6586 |
| 521 | Ga0495648_0001922 | 3300046524 | Bacteria | 19797 |
| 522 | Ga0495648_0038725 | 3300046524 | Bacteria | 3044 |
| 523 | Ga0495648_0047499 | 3300046524 | Bacteria | 2652 |
| 524 | Ga0495648_0049019 | 3300046524 | Bacteria | 2593 |
| 525 | Ga0495666_0003365 | 3300046526 | Bacteria | 8067 |
| 526 | Ga0495666_0013705 | 3300046526 | Bacteria | 4041 |
| 527 | Ga0495652_0028340 | 3300046529 | Bacteria | 4927 |
| 528 | Ga0495652_0029548 | 3300046529 | Unclassified | 4815 |
| 529 | Ga0495652_0291941 | 3300046529 | Bacteria | 1189 |
| 530 | Ga0495665_0003549 | 3300046531 | Bacteria | 8475 |
| 531 | Ga0495640_0007079 | 3300046533 | Bacteria | 8830 |
| 532 | Ga0495640_0029402 | 3300046533 | Bacteria | 3946 |
| 533 | Ga0495587_0005019 | 3300046536 | Bacteria | 8666 |
| 534 | Ga0495587_0017094 | 3300046536 | Unclassified | 4510 |
| 535 | Ga0495645_0009889 | 3300046543 | Bacteria | 6673 |
| 536 | Ga0495645_0090929 | 3300046543 | Unclassified | 2180 |
| 537 | Ga0495622_0000183 | 3300046557 | Bacteria | 50803 |
| 538 | Ga0495633_0000305 | 3300046558 | Bacteria | 55923 |
| 539 | Ga0495633_0119991 | 3300046558 | Bacteria | 1218 |
| 540 | Ga0495667_0037149 | 3300046559 | Bacteria | 3247 |
| 541 | Ga0495656_0137699 | 3300046615 | Bacteria | 1168 |
| 542 | Ga0495668_0134634 | 3300046616 | Bacteria | 1352 |
| 543 | Ga0495634_0000984 | 3300046642 | Bacteria | 26848 |
| 544 | Ga0495634_0014129 | 3300046642 | Bacteria | 5764 |
| 545 | Ga0495611_0032419 | 3300046648 | Bacteria | 2302 |
| 546 | Ga0495625_0000158 | 3300046660 | Bacteria | 104399 |
| 547 | Ga0495625_0097274 | 3300046660 | Bacteria | 2026 |
| 548 | Ga0495625_0140417 | 3300046660 | Bacteria | 1630 |
| 549 | Ga0495625_0291575 | 3300046660 | Bacteria | 1047 |
| 550 | Ga0495635_0000661 | 3300046663 | Bacteria | 22131 |
| 551 | Ga0495635_0037463 | 3300046663 | Bacteria | 3357 |
| 552 | Ga0495661_0015416 | 3300046665 | Bacteria | 5101 |
| 553 | Ga0495661_0050749 | 3300046665 | Bacteria | 2509 |
| 554 | Ga0495661_0124485 | 3300046665 | Bacteria | 1420 |
| 555 | Ga0495588_0029525 | 3300046674 | Bacteria | 2751 |
| 556 | Ga0495599_0004051 | 3300046678 | Bacteria | 8631 |
| 557 | Ga0495599_0013448 | 3300046678 | Bacteria | 5056 |
| 558 | Ga0495623_0003736 | 3300046679 | Bacteria | 10041 |
| 559 | Ga0495623_0030723 | 3300046679 | Bacteria | 3455 |
| 560 | Ga0495646_0004327 | 3300046680 | Bacteria | 8949 |
| 561 | Ga0495646_0007191 | 3300046680 | Bacteria | 7070 |
| 562 | Ga0495646_0132342 | 3300046680 | Bacteria | 1403 |
| 563 | Ga0495613_0000802 | 3300046689 | Bacteria | 24365 |
| 564 | Ga0495613_0007363 | 3300046689 | Bacteria | 8202 |
| 565 | Ga0495613_0019898 | 3300046689 | Bacteria | 5003 |
| 566 | Ga0495624_0007757 | 3300046690 | Bacteria | 7530 |
| 567 | Ga0495624_0046068 | 3300046690 | Bacteria | 2773 |
| 568 | Ga0495671_0030331 | 3300046692 | Bacteria | 2770 |
| 569 | Ga0495649_0058788 | 3300046694 | Bacteria | 2071 |
| 570 | Ga0495589_0019545 | 3300046794 | Bacteria | 3470 |
| 571 | Ga0495581_0003351 | 3300047315 | Bacteria | 9196 |
| 572 | Ga0495604_0023345 | 3300047317 | Bacteria | 4933 |
| 573 | Ga0495674_0033874 | 3300047319 | Bacteria | 4622 |
| 574 | Ga0495676_0038823 | 3300047321 | Bacteria | 3951 |
| 575 | Ga0495680_0003534 | 3300047322 | Bacteria | 15320 |
| 576 | Ga0495680_0150011 | 3300047322 | Bacteria | 1700 |
| 577 | Ga0495683_0003122 | 3300047323 | Bacteria | 9705 |
| 578 | Ga0495683_0061089 | 3300047323 | Bacteria | 1866 |
| 579 | Ga0495687_036902 | 3300047443 | Bacteria | 2182 |
| 580 | Ga0495679_000287 | 3300047446 | Bacteria | 41484 |
| 581 | Ga0495679_000344 | 3300047446 | Bacteria | 36397 |
| 582 | Ga0495673_0027977 | 3300047469 | Bacteria | 2675 |
| 583 | Ga0495684_0067812 | 3300047471 | Bacteria | 2713 |
| 584 | Ga0495684_0097931 | 3300047471 | Bacteria | 2218 |
| 585 | Ga0495684_0137726 | 3300047471 | Bacteria | 1831 |
| 586 | Ga0495686_0000861 | 3300047472 | Bacteria | 38948 |
| 587 | Ga0495686_0006026 | 3300047472 | Bacteria | 9419 |
| 588 | Ga0495593_0002076 | 3300047673 | Bacteria | 11967 |
| 589 | Ga0495593_0006339 | 3300047673 | Bacteria | 6941 |
| 590 | Ga0495602_0011519 | 3300048088 | Bacteria | 9137 |
| 591 | Ga0495602_0080542 | 3300048088 | Bacteria | 2742 |
| 592 | Ga0496102_0000100 | 3300048905 | Bacteria | 123531 |
| 593 | Ga0496102_0017559 | 3300048905 | Bacteria | 6267 |
| 594 | Ga0496103_0000070 | 3300048906 | Bacteria | 121077 |
| 595 | Ga0496103_0001574 | 3300048906 | Bacteria | 15064 |
| 596 | Ga0496106_0096133 | 3300048909 | Bacteria | 2292 |
| 597 | Ga0496107_0044858 | 3300048910 | Bacteria | 3179 |
| 598 | Ga0496110_0003673 | 3300048913 | Bacteria | 11805 |
| 599 | Ga0496116_0002579 | 3300048919 | Bacteria | 18871 |
| 600 | Ga0496116_0056365 | 3300048919 | Bacteria | 2576 |
| 601 | Ga0496116_0123878 | 3300048919 | Bacteria | 1489 |
| 602 | Ga0496117_0000194 | 3300048920 | Bacteria | 123531 |
| 603 | Ga0496117_0005305 | 3300048920 | Bacteria | 13633 |
| 604 | Ga0496117_0011492 | 3300048920 | Bacteria | 7926 |
| 605 | Ga0496117_0034784 | 3300048920 | Bacteria | 3791 |
| 606 | Ga0496117_0068079 | 3300048920 | Bacteria | 2405 |
| 607 | Ga0496117_0369424 | 3300048920 | Bacteria | 734 |
| 608 | Ga0496118_0000146 | 3300048921 | Bacteria | 123531 |
| 609 | Ga0496118_0001200 | 3300048921 | Bacteria | 39881 |
| 610 | Ga0496118_0003430 | 3300048921 | Bacteria | 19994 |
| 611 | Ga0496118_0004003 | 3300048921 | Bacteria | 17936 |
| 612 | Ga0496118_0012474 | 3300048921 | Bacteria | 8151 |
| 613 | Ga0496118_0100272 | 3300048921 | Bacteria | 1959 |
| 614 | Ga0496119_0009849 | 3300048922 | Bacteria | 8122 |
| 615 | Ga0496119_0012504 | 3300048922 | Bacteria | 6887 |
| 616 | Ga0496120_0053791 | 3300048923 | Bacteria | 2285 |
| 617 | Ga0496121_0000822 | 3300048924 | Bacteria | 56626 |
| 618 | Ga0496121_0003499 | 3300048924 | Bacteria | 22330 |
| 619 | Ga0496121_0081007 | 3300048924 | Bacteria | 2571 |
| 620 | Ga0496121_0082218 | 3300048924 | Bacteria | 2547 |
| 621 | Ga0496121_0262135 | 3300048924 | Bacteria | 1193 |
| 622 | Ga0496122_0003016 | 3300048925 | Bacteria | 22836 |
| 623 | Ga0496122_0016579 | 3300048925 | Bacteria | 6957 |
| 624 | Ga0496123_0004726 | 3300048926 | Bacteria | 14097 |
| 625 | Ga0496123_0016846 | 3300048926 | Bacteria | 5908 |
| 626 | Ga0496124_0000185 | 3300048927 | Bacteria | 123531 |
| 627 | Ga0496124_0015091 | 3300048927 | Bacteria | 7427 |
| 628 | Ga0496124_0076810 | 3300048927 | Bacteria | 2756 |
| 629 | Ga0496125_0008495 | 3300048928 | Bacteria | 10743 |
| 630 | Ga0496125_0302192 | 3300048928 | Bacteria | 980 |
| 631 | Ga0496126_0001126 | 3300048929 | Bacteria | 44695 |
| 632 | Ga0496126_0004413 | 3300048929 | Bacteria | 16849 |
| 633 | Ga0466983_0040851 | 3300048986 | Bacteria | 3874 |
| 634 | Ga0495682_0035383 | 3300049460 | Bacteria | 1840 |
| 635 | Ga0501032_0037427 | 3300049569 | Bacteria | 3309 |
| 636 | Ga0501034_0149154 | 3300049571 | Bacteria | 2315 |
| 637 | Ga0501043_0018243 | 3300049579 | Bacteria | 5501 |
| 638 | Ga0501046_0180685 | 3300049580 | Bacteria | 1578 |
| 639 | Ga0501047_0000713 | 3300049581 | Bacteria | 34681 |
| 640 | Ga0501047_0000876 | 3300049581 | Bacteria | 30712 |
| 641 | Ga0501047_0213720 | 3300049581 | Bacteria | 1786 |
| 642 | Ga0501070_0073604 | 3300049586 | Bacteria | 2827 |
| 643 | Ga0501072_0208637 | 3300049588 | Bacteria | 1557 |
| 644 | Ga0501249_000464 | 3300049679 | Bacteria | 10123 |
| 645 | Ga0501080_0002920 | 3300049742 | Bacteria | 15017 |
| 646 | Ga0501080_0548584 | 3300049742 | Bacteria | 1030 |
| 647 | Ga0501083_0002714 | 3300049744 | Bacteria | 12220 |
| 648 | Ga0501044_0161031 | 3300049823 | Bacteria | 2221 |
| 649 | Ga0501044_0492331 | 3300049823 | Bacteria | 1128 |
| 650 | Ga0501284_03672 | 3300050005 | Bacteria | 861 |
| 651 | nmdc:mga03683_728_c1 | 3300050489 | Bacteria | 9423 |
| 652 | nmdc:mga03683_906_c1 | 3300050489 | Bacteria | 8520 |
| 653 | nmdc:mga03n38_124304_c1 | 3300050490 | Bacteria | 1272 |
| 654 | nmdc:mga00v17_186191_c1 | 3300050491 | Bacteria | 1340 |
| 655 | nmdc:mga00v17_23619_c1 | 3300050491 | Bacteria | 3557 |
| 656 | nmdc:mga00v17_30823_c1 | 3300050491 | Bacteria | 3158 |
| 657 | nmdc:mga00v17_68152_c1 | 3300050491 | Bacteria | 2199 |
| 658 | nmdc:mga0yw44_13471_c1 | 3300050492 | Bacteria | 4309 |
| 659 | nmdc:mga0k408_11042_c1 | 3300050493 | Bacteria | 4905 |
| 660 | nmdc:mga0k408_201933_c1 | 3300050493 | Bacteria | 1187 |
| 661 | nmdc:mga0k408_89986_c1 | 3300050493 | Bacteria | 1802 |
| 662 | nmdc:mga0k408_98477_c1 | 3300050493 | Bacteria | 1723 |
| 663 | nmdc:mga06z11_9095_c1 | 3300050494 | Bacteria | 4174 |
| 664 | nmdc:mga04h51_127956_c1 | 3300050495 | Bacteria | 952 |
| 665 | nmdc:mga07m45_232748_c1 | 3300050496 | Bacteria | 1072 |
| 666 | nmdc:mga07m45_4_c1 | 3300050496 | Bacteria | 409607 |
| 667 | nmdc:mga07m45_58127_c1 | 3300050496 | Bacteria | 2188 |
| 668 | nmdc:mga0sz30_12029_c1 | 3300050516 | Bacteria | 2830 |
| 669 | nmdc:mga0sz30_337_c2 | 3300050516 | Bacteria | 17733 |
| 670 | Ga0495601_0060041 | 3300053077 | Unclassified | 2412 |
| 671 | Ga0495595_0183207 | 3300053084 | Bacteria | 1039 |
| 672 | Ga0495619_0033882 | 3300053085 | Bacteria | 3318 |
| 673 | Ga0500643_000363 | 3300053087 | Bacteria | 35844 |
| 674 | Ga0500643_004836 | 3300053087 | Bacteria | 5951 |
| 675 | Ga0500643_008874 | 3300053087 | Bacteria | 3901 |
| 676 | Ga0500643_014441 | 3300053087 | Bacteria | 2745 |
| 677 | Ga0500643_046444 | 3300053087 | Bacteria | 1254 |
| 678 | Ga0500643_069067 | 3300053087 | Bacteria | 982 |
| 679 | Ga0500641_0000125 | 3300053096 | Bacteria | 28797 |
| 680 | Ga0500594_0125797 | 3300053118 | Bacteria | 808 |
| 681 | Ga0500607_000055 | 3300053121 | Bacteria | 78780 |
| 682 | Ga0500642_0001182 | 3300053130 | Bacteria | 7472 |
| 683 | Ga0500642_0016748 | 3300053130 | Bacteria | 2792 |
| 684 | Ga0500559_0321164 | 3300053136 | Bacteria | 726 |
| 685 | Ga0500573_0000030 | 3300053140 | Bacteria | 135037 |
| 686 | Ga0500616_0045054 | 3300053153 | Bacteria | 2352 |
| 687 | Ga0500622_0025249 | 3300053156 | Bacteria | 3140 |
| 688 | Ga0500634_0069018 | 3300053161 | Bacteria | 1855 |
| 689 | Ga0500645_002352 | 3300053730 | Bacteria | 8517 |
| 690 | Ga0500645_009526 | 3300053730 | Bacteria | 3259 |
| 691 | Ga0500645_047436 | 3300053730 | Bacteria | 1259 |
| 692 | Ga0466962_0003412 | 3300061719 | Bacteria | 7568 |
| 693 | Ga0466962_0065913 | 3300061719 | Bacteria | 1729 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035398 | Ga0316574_0516480 | Ga0316574_0516480_10_687 | 200 |
| 2 | 3300048920 | Ga0496117_0369424 | Ga0496117_0369424_53_667 | 204 |
| 3 | 3300031852 | Ga0307410_10149311 | Ga0307410_101493111 | 215 |
| 4 | 3300025923 | Ga0207681_10035754 | Ga0207681_100357542 | 220 |
| 5 | iso_pu_bacteria | 2501025501 | 2501072470 | 220 |
| 6 | iso_pu_bacteria | 2501025504 | 2501409103 | 220 |
| 7 | iso_pu_bacteria | 2510917014 | 2511101151 | 220 |
| 8 | iso_pu_bacteria | 2510917015 | 2511107132 | 220 |
| 9 | iso_pu_bacteria | 2515154122 | 2515680305 | 220 |
| 10 | iso_pu_bacteria | 2599185239 | 2599734363 | 220 |
| 11 | iso_pu_bacteria | 2599185240 | 2599747456 | 220 |
| 12 | iso_pu_bacteria | 2599185355 | 2600209340 | 220 |
| 13 | iso_pu_bacteria | 2643221541 | 2643730021 | 220 |
| 14 | iso_pu_bacteria | 2643221605 | 2644039797 | 220 |
| 15 | iso_pu_bacteria | 2643221606 | 2644045507 | 220 |
| 16 | iso_pu_bacteria | 2643221671 | 2644392867 | 220 |
| 17 | iso_pu_bacteria | 2675903129 | 2676746112 | 220 |
| 18 | iso_pu_bacteria | 2744054900 | 2746089896 | 220 |
| 19 | iso_pu_bacteria | 2744054901 | 2746098137 | 220 |
| 20 | iso_pu_bacteria | 2818991452 | 2819636498 | 220 |
| 21 | iso_pu_bacteria | 2842324504 | 2842332775 | 220 |
| 22 | iso_pu_bacteria | 2842348783 | 2842356981 | 220 |
| 23 | iso_pu_bacteria | 2842454564 | 2842460759 | 220 |
| 24 | iso_pu_bacteria | 2863421361 | 2863424106 | 220 |
| 25 | iso_pu_bacteria | 2870068957 | 2870073219 | 220 |
| 26 | iso_pu_bacteria | 2885270888 | 2885278073 | 220 |
| 27 | iso_pu_bacteria | 2902682994 | 2902687949 | 220 |
| 28 | iso_pu_bacteria | 2904564687 | 2904567259 | 220 |
| 29 | iso_pu_bacteria | 2904571731 | 2904574304 | 220 |
| 30 | iso_pu_bacteria | 2928157003 | 2928158678 | 220 |
| 31 | iso_pu_bacteria | 2928163908 | 2928167641 | 220 |
| 32 | iso_pu_bacteria | 2928170801 | 2928174559 | 220 |
| 33 | iso_pu_bacteria | 2928536128 | 2928540574 | 220 |
| 34 | iso_pu_bacteria | 2981990288 | 2981992164 | 220 |
| 35 | iso_pu_bacteria | 641736154 | 642417704 | 220 |
| 36 | iso_pu_bacteria | 8002060224 | 8002062185 | 220 |
| 37 | iso_pu_bacteria | 8018845410 | 8018852558 | 220 |
| 38 | iso_pu_bacteria | 8020938398 | 8020942744 | 220 |
| 39 | iso_pu_bacteria | 8020945358 | 8020951742 | 220 |
| 40 | iso_pu_bacteria | 8020953355 | 8020959063 | 220 |
| 41 | iso_pu_bacteria | 8021120328 | 8021121428 | 220 |
| 42 | iso_pu_bacteria | 8039098773 | 8039100117 | 220 |
| 43 | 3300005338 | Ga0068868_100580509 | Ga0068868_1005805092 | 221 |
| 44 | 3300005339 | Ga0070660_100563357 | Ga0070660_1005633572 | 221 |
| 45 | 3300005344 | Ga0070661_100080760 | Ga0070661_1000807602 | 221 |
| 46 | 3300005539 | Ga0068853_100004394 | Ga0068853_1000043947 | 221 |
| 47 | 3300005563 | Ga0068855_100611148 | Ga0068855_1006111482 | 221 |
| 48 | 3300005614 | Ga0068856_100014767 | Ga0068856_1000147673 | 221 |
| 49 | 3300009093 | Ga0105240_10026941 | Ga0105240_100269414 | 221 |
| 50 | 3300009174 | Ga0105241_10537986 | Ga0105241_105379862 | 221 |
| 51 | 3300025911 | Ga0207654_10272466 | Ga0207654_102724662 | 221 |
| 52 | 3300025913 | Ga0207695_10029082 | Ga0207695_100290822 | 221 |
| 53 | 3300025919 | Ga0207657_10201668 | Ga0207657_102016682 | 221 |
| 54 | 3300025920 | Ga0207649_10051407 | Ga0207649_100514072 | 221 |
| 55 | 3300025949 | Ga0207667_10078998 | Ga0207667_100789983 | 221 |
| 56 | 3300026041 | Ga0207639_10583051 | Ga0207639_105830511 | 221 |
| 57 | 3300026078 | Ga0207702_10292270 | Ga0207702_102922702 | 221 |
| 58 | 3300005327 | Ga0070658_10000055 | Ga0070658_1000005591 | 222 |
| 59 | 3300005339 | Ga0070660_100000528 | Ga0070660_1000005285 | 222 |
| 60 | 3300005435 | Ga0070714_100007023 | Ga0070714_1000070233 | 222 |
| 61 | 3300006051 | Ga0075364_10065301 | Ga0075364_100653012 | 222 |
| 62 | 3300009176 | Ga0105242_10263885 | Ga0105242_102638852 | 222 |
| 63 | 3300014969 | Ga0157376_10246174 | Ga0157376_102461742 | 222 |
| 64 | 3300025909 | Ga0207705_10001077 | Ga0207705_1000107711 | 222 |
| 65 | 3300025911 | Ga0207654_10215808 | Ga0207654_102158082 | 222 |
| 66 | 3300025919 | Ga0207657_10001160 | Ga0207657_100011609 | 222 |
| 67 | 3300025929 | Ga0207664_10000966 | Ga0207664_1000096615 | 222 |
| 68 | 3300025934 | Ga0207686_10068267 | Ga0207686_100682672 | 222 |
| 69 | 3300026035 | Ga0207703_10979829 | Ga0207703_109798291 | 222 |
| 70 | 3300026089 | Ga0207648_10020229 | Ga0207648_100202292 | 222 |
| 71 | 3300026118 | Ga0207675_100425178 | Ga0207675_1004251782 | 222 |
| 72 | 3300026121 | Ga0207683_10063880 | Ga0207683_100638801 | 222 |
| 73 | 3300028380 | Ga0268265_10459001 | Ga0268265_104590012 | 222 |
| 74 | 3300037418 | Ga0395900_0010043 | Ga0395900_0010043_3235_3966 | 222 |
| 75 | 3300037466 | Ga0395898_0083168 | Ga0395898_0083168_2001_2732 | 222 |
| 76 | 3300044683 | Ga0466965_0329440 | Ga0466965_0329440_19_699 | 222 |
| 77 | 3300046459 | Ga0495629_0008470 | Ga0495629_0008470_5086_5766 | 222 |
| 78 | 3300046472 | Ga0495580_0131769 | Ga0495580_0131769_949_1629 | 222 |
| 79 | 3300046529 | Ga0495652_0029548 | Ga0495652_0029548_824_1504 | 222 |
| 80 | 3300046536 | Ga0495587_0017094 | Ga0495587_0017094_2095_2775 | 222 |
| 81 | 3300046543 | Ga0495645_0090929 | Ga0495645_0090929_229_909 | 222 |
| 82 | 3300046558 | Ga0495633_0000305 | Ga0495633_0000305_36687_37367 | 222 |
| 83 | 3300046615 | Ga0495656_0137699 | Ga0495656_0137699_428_1108 | 222 |
| 84 | 3300046689 | Ga0495613_0019898 | Ga0495613_0019898_1947_2627 | 222 |
| 85 | 3300047471 | Ga0495684_0097931 | Ga0495684_0097931_1432_2112 | 222 |
| 86 | 3300047472 | Ga0495686_0000861 | Ga0495686_0000861_23229_23909 | 222 |
| 87 | 3300048913 | Ga0496110_0003673 | Ga0496110_0003673_4850_5533 | 222 |
| 88 | 3300048929 | Ga0496126_0004413 | Ga0496126_0004413_13928_14608 | 222 |
| 89 | 3300049823 | Ga0501044_0492331 | Ga0501044_0492331_50_730 | 222 |
| 90 | 3300050005 | Ga0501284_03672 | Ga0501284_03672_167_847 | 222 |
| 91 | 3300050491 | nmdc:mga00v17_68152_c1 | nmdc:mga00v17_68152_c1_253_933 | 222 |
| 92 | 3300053077 | Ga0495601_0060041 | Ga0495601_0060041_1121_1801 | 222 |
| 93 | 3300053084 | Ga0495595_0183207 | Ga0495595_0183207_81_761 | 222 |
| 94 | 3300053085 | Ga0495619_0033882 | Ga0495619_0033882_643_1323 | 222 |
| 95 | 3300053087 | Ga0500643_008874 | Ga0500643_008874_551_1231 | 222 |
| 96 | 3300053096 | Ga0500641_0000125 | Ga0500641_0000125_6527_7207 | 222 |
| 97 | 3300053156 | Ga0500622_0025249 | Ga0500622_0025249_56_736 | 222 |
| 98 | 3300001904 | JGI24736J21556_1019791 | JGI24736J21556_10197912 | 223 |
| 99 | 3300001979 | JGI24740J21852_10015655 | JGI24740J21852_100156553 | 223 |
| 100 | 3300001979 | JGI24740J21852_10055397 | JGI24740J21852_100553971 | 223 |
| 101 | 3300001989 | JGI24739J22299_10009167 | JGI24739J22299_100091674 | 223 |
| 102 | 3300001989 | JGI24739J22299_10011951 | JGI24739J22299_100119513 | 223 |
| 103 | 3300001989 | JGI24739J22299_10017615 | JGI24739J22299_100176152 | 223 |
| 104 | 3300001989 | JGI24739J22299_10028812 | JGI24739J22299_100288123 | 223 |
| 105 | 3300001989 | JGI24739J22299_10034258 | JGI24739J22299_100342582 | 223 |
| 106 | 3300001989 | JGI24739J22299_10056136 | JGI24739J22299_100561362 | 223 |
| 107 | 3300001990 | JGI24737J22298_10001498 | JGI24737J22298_100014986 | 223 |
| 108 | 3300001990 | JGI24737J22298_10007618 | JGI24737J22298_100076183 | 223 |
| 109 | 3300001990 | JGI24737J22298_10033516 | JGI24737J22298_100335163 | 223 |
| 110 | 3300001990 | JGI24737J22298_10062472 | JGI24737J22298_100624722 | 223 |
| 111 | 3300002067 | JGI24735J21928_10000192 | JGI24735J21928_1000019223 | 223 |
| 112 | 3300002067 | JGI24735J21928_10002707 | JGI24735J21928_100027074 | 223 |
| 113 | 3300002067 | JGI24735J21928_10019771 | JGI24735J21928_100197713 | 223 |
| 114 | 3300002067 | JGI24735J21928_10024506 | JGI24735J21928_100245062 | 223 |
| 115 | 3300002067 | JGI24735J21928_10047776 | JGI24735J21928_100477762 | 223 |
| 116 | 3300002067 | JGI24735J21928_10050064 | JGI24735J21928_100500642 | 223 |
| 117 | 3300002070 | JGI24750J21931_1000069 | JGI24750J21931_100006912 | 223 |
| 118 | 3300002074 | JGI24748J21848_1000066 | JGI24748J21848_100006623 | 223 |
| 119 | 3300002075 | JGI24738J21930_10003996 | JGI24738J21930_100039964 | 223 |
| 120 | 3300002075 | JGI24738J21930_10047337 | JGI24738J21930_100473372 | 223 |
| 121 | 3300002076 | JGI24749J21850_1001470 | JGI24749J21850_10014702 | 223 |
| 122 | 3300002077 | JGI24744J21845_10011969 | JGI24744J21845_100119691 | 223 |
| 123 | 3300002239 | JGI24034J26672_10000015 | JGI24034J26672_1000001523 | 223 |
| 124 | 3300002244 | JGI24742J22300_10013507 | JGI24742J22300_100135072 | 223 |
| 125 | 3300002459 | JGI24751J29686_10000081 | JGI24751J29686_1000008170 | 223 |
| 126 | 3300002459 | JGI24751J29686_10018967 | JGI24751J29686_100189671 | 223 |
| 127 | 3300002741 | JGI25157J39369_1015763 | JGI25157J39369_10157631 | 223 |
| 128 | 3300003187 | JGI25151J46595_10000729 | JGI25151J46595_1000072925 | 223 |
| 129 | 3300003214 | JGI25165J46597_1000210 | JGI25165J46597_100021010 | 223 |
| 130 | 3300003316 | rootH1_10011990 | rootH1_100119902 | 223 |
| 131 | 3300003320 | rootH2_10096727 | rootH2_100967272 | 223 |
| 132 | 3300003320 | rootH2_10244599 | rootH2_102445991 | 223 |
| 133 | 3300003323 | rootH1_10034821 | rootH1_100348211 | 223 |
| 134 | 3300003323 | rootH1_10106373 | rootH1_101063735 | 223 |
| 135 | 3300003758 | Ga0055532_1000295 | Ga0055532_100029510 | 223 |
| 136 | 3300003758 | Ga0055532_1000337 | Ga0055532_10003379 | 223 |
| 137 | 3300003758 | Ga0055532_1000383 | Ga0055532_10003839 | 223 |
| 138 | 3300003760 | Ga0055527_1000104 | Ga0055527_100010432 | 223 |
| 139 | 3300003760 | Ga0055527_1000154 | Ga0055527_100015426 | 223 |
| 140 | 3300003761 | Ga0055535_1000218 | Ga0055535_100021832 | 223 |
| 141 | 3300003761 | Ga0055535_1000320 | Ga0055535_100032026 | 223 |
| 142 | 3300003762 | Ga0055542_1000153 | Ga0055542_100015344 | 223 |
| 143 | 3300003762 | Ga0055542_1017039 | Ga0055542_10170392 | 223 |
| 144 | 3300003763 | Ga0055529_1000176 | Ga0055529_100017657 | 223 |
| 145 | 3300003763 | Ga0055529_1005697 | Ga0055529_10056972 | 223 |
| 146 | 3300003773 | Ga0055537_1000955 | Ga0055537_100095513 | 223 |
| 147 | 3300003775 | Ga0055524_1003436 | Ga0055524_10034367 | 223 |
| 148 | 3300003784 | Ga0055534_1005791 | Ga0055534_10057911 | 223 |
| 149 | 3300003790 | Ga0055528_1001345 | Ga0055528_100134511 | 223 |
| 150 | 3300003794 | Ga0055531_10004535 | Ga0055531_100045358 | 223 |
| 151 | 3300003856 | Ga0058692_1015940 | Ga0058692_10159402 | 223 |
| 152 | 3300005262 | Ga0065165_1000554 | Ga0065165_100055428 | 223 |
| 153 | 3300005295 | Ga0065707_10119358 | Ga0065707_101193582 | 223 |
| 154 | 3300005295 | Ga0065707_10141752 | Ga0065707_101417523 | 223 |
| 155 | 3300005295 | Ga0065707_10291499 | Ga0065707_102914991 | 223 |
| 156 | 3300005327 | Ga0070658_10002322 | Ga0070658_1000232213 | 223 |
| 157 | 3300005327 | Ga0070658_10062126 | Ga0070658_100621263 | 223 |
| 158 | 3300005327 | Ga0070658_10063942 | Ga0070658_100639423 | 223 |
| 159 | 3300005328 | Ga0070676_10008260 | Ga0070676_100082603 | 223 |
| 160 | 3300005328 | Ga0070676_10145143 | Ga0070676_101451432 | 223 |
| 161 | 3300005330 | Ga0070690_100000025 | Ga0070690_10000002522 | 223 |
| 162 | 3300005331 | Ga0070670_100000003 | Ga0070670_100000003128 | 223 |
| 163 | 3300005331 | Ga0070670_100641275 | Ga0070670_1006412752 | 223 |
| 164 | 3300005333 | Ga0070677_10044357 | Ga0070677_100443572 | 223 |
| 165 | 3300005334 | Ga0068869_100000341 | Ga0068869_10000034125 | 223 |
| 166 | 3300005335 | Ga0070666_10000015 | Ga0070666_10000015205 | 223 |
| 167 | 3300005338 | Ga0068868_100003972 | Ga0068868_1000039729 | 223 |
| 168 | 3300005339 | Ga0070660_100000808 | Ga0070660_1000008085 | 223 |
| 169 | 3300005339 | Ga0070660_100002294 | Ga0070660_1000022949 | 223 |
| 170 | 3300005339 | Ga0070660_100014948 | Ga0070660_1000149486 | 223 |
| 171 | 3300005339 | Ga0070660_100383762 | Ga0070660_1003837621 | 223 |
| 172 | 3300005339 | Ga0070660_100482566 | Ga0070660_1004825662 | 223 |
| 173 | 3300005339 | Ga0070660_100493352 | Ga0070660_1004933522 | 223 |
| 174 | 3300005340 | Ga0070689_100044006 | Ga0070689_1000440064 | 223 |
| 175 | 3300005344 | Ga0070661_100020324 | Ga0070661_1000203244 | 223 |
| 176 | 3300005344 | Ga0070661_100116020 | Ga0070661_1001160204 | 223 |
| 177 | 3300005347 | Ga0070668_100001896 | Ga0070668_1000018969 | 223 |
| 178 | 3300005347 | Ga0070668_100017496 | Ga0070668_1000174961 | 223 |
| 179 | 3300005347 | Ga0070668_100029444 | Ga0070668_1000294444 | 223 |
| 180 | 3300005347 | Ga0070668_100098141 | Ga0070668_1000981412 | 223 |
| 181 | 3300005353 | Ga0070669_100000044 | Ga0070669_10000004452 | 223 |
| 182 | 3300005353 | Ga0070669_100000059 | Ga0070669_100000059105 | 223 |
| 183 | 3300005353 | Ga0070669_100018483 | Ga0070669_1000184835 | 223 |
| 184 | 3300005355 | Ga0070671_100000769 | Ga0070671_10000076916 | 223 |
| 185 | 3300005355 | Ga0070671_100019548 | Ga0070671_1000195484 | 223 |
| 186 | 3300005355 | Ga0070671_100034287 | Ga0070671_1000342874 | 223 |
| 187 | 3300005356 | Ga0070674_100034464 | Ga0070674_1000344643 | 223 |
| 188 | 3300005356 | Ga0070674_100116594 | Ga0070674_1001165942 | 223 |
| 189 | 3300005364 | Ga0070673_100000014 | Ga0070673_100000014126 | 223 |
| 190 | 3300005365 | Ga0070688_100001673 | Ga0070688_10000167310 | 223 |
| 191 | 3300005366 | Ga0070659_100000012 | Ga0070659_100000012104 | 223 |
| 192 | 3300005366 | Ga0070659_100033494 | Ga0070659_1000334943 | 223 |
| 193 | 3300005366 | Ga0070659_100736610 | Ga0070659_1007366102 | 223 |
| 194 | 3300005367 | Ga0070667_100000122 | Ga0070667_10000012232 | 223 |
| 195 | 3300005367 | Ga0070667_100021344 | Ga0070667_1000213442 | 223 |
| 196 | 3300005367 | Ga0070667_100113228 | Ga0070667_1001132283 | 223 |
| 197 | 3300005455 | Ga0070663_100002534 | Ga0070663_1000025343 | 223 |
| 198 | 3300005455 | Ga0070663_100007613 | Ga0070663_1000076135 | 223 |
| 199 | 3300005455 | Ga0070663_100083165 | Ga0070663_1000831652 | 223 |
| 200 | 3300005456 | Ga0070678_100025451 | Ga0070678_1000254513 | 223 |
| 201 | 3300005457 | Ga0070662_100011712 | Ga0070662_1000117123 | 223 |
| 202 | 3300005457 | Ga0070662_100057319 | Ga0070662_1000573194 | 223 |
| 203 | 3300005457 | Ga0070662_100078818 | Ga0070662_1000788182 | 223 |
| 204 | 3300005457 | Ga0070662_100340661 | Ga0070662_1003406612 | 223 |
| 205 | 3300005457 | Ga0070662_100661740 | Ga0070662_1006617401 | 223 |
| 206 | 3300005459 | Ga0068867_100000002 | Ga0068867_10000000210 | 223 |
| 207 | 3300005466 | Ga0070685_10000297 | Ga0070685_1000029722 | 223 |
| 208 | 3300005539 | Ga0068853_100012544 | Ga0068853_1000125443 | 223 |
| 209 | 3300005539 | Ga0068853_100108371 | Ga0068853_1001083712 | 223 |
| 210 | 3300005543 | Ga0070672_100161678 | Ga0070672_1001616782 | 223 |
| 211 | 3300005544 | Ga0070686_100000006 | Ga0070686_10000000648 | 223 |
| 212 | 3300005547 | Ga0070693_100698981 | Ga0070693_1006989811 | 223 |
| 213 | 3300005548 | Ga0070665_100000217 | Ga0070665_10000021791 | 223 |
| 214 | 3300005548 | Ga0070665_100577392 | Ga0070665_1005773922 | 223 |
| 215 | 3300005563 | Ga0068855_100000504 | Ga0068855_10000050445 | 223 |
| 216 | 3300005563 | Ga0068855_100023939 | Ga0068855_1000239393 | 223 |
| 217 | 3300005563 | Ga0068855_100141969 | Ga0068855_1001419692 | 223 |
| 218 | 3300005563 | Ga0068855_100150611 | Ga0068855_1001506113 | 223 |
| 219 | 3300005564 | Ga0070664_100118181 | Ga0070664_1001181812 | 223 |
| 220 | 3300005577 | Ga0068857_100056055 | Ga0068857_1000560552 | 223 |
| 221 | 3300005577 | Ga0068857_100106634 | Ga0068857_1001066343 | 223 |
| 222 | 3300005577 | Ga0068857_100682101 | Ga0068857_1006821012 | 223 |
| 223 | 3300005577 | Ga0068857_100744091 | Ga0068857_1007440911 | 223 |
| 224 | 3300005578 | Ga0068854_100000118 | Ga0068854_10000011818 | 223 |
| 225 | 3300005578 | Ga0068854_100003080 | Ga0068854_1000030807 | 223 |
| 226 | 3300005578 | Ga0068854_100213736 | Ga0068854_1002137362 | 223 |
| 227 | 3300005614 | Ga0068856_100006838 | Ga0068856_10000683810 | 223 |
| 228 | 3300005614 | Ga0068856_100068422 | Ga0068856_1000684222 | 223 |
| 229 | 3300005614 | Ga0068856_100078523 | Ga0068856_1000785232 | 223 |
| 230 | 3300005616 | Ga0068852_100000052 | Ga0068852_10000005254 | 223 |
| 231 | 3300005616 | Ga0068852_100040513 | Ga0068852_1000405134 | 223 |
| 232 | 3300005616 | Ga0068852_100484646 | Ga0068852_1004846462 | 223 |
| 233 | 3300005616 | Ga0068852_100532832 | Ga0068852_1005328322 | 223 |
| 234 | 3300005617 | Ga0068859_100017939 | Ga0068859_1000179395 | 223 |
| 235 | 3300005617 | Ga0068859_100086474 | Ga0068859_1000864744 | 223 |
| 236 | 3300005618 | Ga0068864_100000158 | Ga0068864_10000015872 | 223 |
| 237 | 3300005618 | Ga0068864_100010503 | Ga0068864_1000105035 | 223 |
| 238 | 3300005618 | Ga0068864_100012183 | Ga0068864_1000121838 | 223 |
| 239 | 3300005719 | Ga0068861_100012847 | Ga0068861_1000128474 | 223 |
| 240 | 3300005834 | Ga0068851_10281296 | Ga0068851_102812962 | 223 |
| 241 | 3300005841 | Ga0068863_100000108 | Ga0068863_10000010878 | 223 |
| 242 | 3300005841 | Ga0068863_100000822 | Ga0068863_1000008223 | 223 |
| 243 | 3300005842 | Ga0068858_100000582 | Ga0068858_10000058218 | 223 |
| 244 | 3300005842 | Ga0068858_100107169 | Ga0068858_1001071692 | 223 |
| 245 | 3300005843 | Ga0068860_100000027 | Ga0068860_100000027150 | 223 |
| 246 | 3300005843 | Ga0068860_100000050 | Ga0068860_100000050206 | 223 |
| 247 | 3300005843 | Ga0068860_100000152 | Ga0068860_10000015282 | 223 |
| 248 | 3300005843 | Ga0068860_100064295 | Ga0068860_1000642952 | 223 |
| 249 | 3300005844 | Ga0068862_100000001 | Ga0068862_100000001476 | 223 |
| 250 | 3300005844 | Ga0068862_100000062 | Ga0068862_10000006223 | 223 |
| 251 | 3300005844 | Ga0068862_100012059 | Ga0068862_1000120595 | 223 |
| 252 | 3300005844 | Ga0068862_100087844 | Ga0068862_1000878442 | 223 |
| 253 | 3300006038 | Ga0075365_10067723 | Ga0075365_100677232 | 223 |
| 254 | 3300006042 | Ga0075368_10126319 | Ga0075368_101263191 | 223 |
| 255 | 3300006042 | Ga0075368_10142748 | Ga0075368_101427481 | 223 |
| 256 | 3300006048 | Ga0075363_100104477 | Ga0075363_1001044772 | 223 |
| 257 | 3300006051 | Ga0075364_10030582 | Ga0075364_100305822 | 223 |
| 258 | 3300006051 | Ga0075364_10034355 | Ga0075364_100343552 | 223 |
| 259 | 3300006178 | Ga0075367_10041669 | Ga0075367_100416692 | 223 |
| 260 | 3300006186 | Ga0075369_10016731 | Ga0075369_100167312 | 223 |
| 261 | 3300006186 | Ga0075369_10048667 | Ga0075369_100486673 | 223 |
| 262 | 3300006195 | Ga0075366_10012947 | Ga0075366_100129473 | 223 |
| 263 | 3300006195 | Ga0075366_10098496 | Ga0075366_100984962 | 223 |
| 264 | 3300006195 | Ga0075366_10182120 | Ga0075366_101821202 | 223 |
| 265 | 3300006237 | Ga0097621_100079644 | Ga0097621_1000796442 | 223 |
| 266 | 3300006353 | Ga0075370_10016652 | Ga0075370_100166523 | 223 |
| 267 | 3300006881 | Ga0068865_100001468 | Ga0068865_10000146810 | 223 |
| 268 | 3300006931 | Ga0097620_100017941 | Ga0097620_1000179415 | 223 |
| 269 | 3300006931 | Ga0097620_100086477 | Ga0097620_1000864772 | 223 |
| 270 | 3300009092 | Ga0105250_10021233 | Ga0105250_100212332 | 223 |
| 271 | 3300009092 | Ga0105250_10037938 | Ga0105250_100379382 | 223 |
| 272 | 3300009093 | Ga0105240_10001781 | Ga0105240_1000178132 | 223 |
| 273 | 3300009093 | Ga0105240_10029050 | Ga0105240_100290501 | 223 |
| 274 | 3300009093 | Ga0105240_10037814 | Ga0105240_100378146 | 223 |
| 275 | 3300009093 | Ga0105240_10100701 | Ga0105240_101007013 | 223 |
| 276 | 3300009093 | Ga0105240_10108847 | Ga0105240_101088472 | 223 |
| 277 | 3300009093 | Ga0105240_10491836 | Ga0105240_104918362 | 223 |
| 278 | 3300009098 | Ga0105245_10021319 | Ga0105245_100213193 | 223 |
| 279 | 3300009098 | Ga0105245_10738422 | Ga0105245_107384221 | 223 |
| 280 | 3300009101 | Ga0105247_10004563 | Ga0105247_100045635 | 223 |
| 281 | 3300009148 | Ga0105243_10004912 | Ga0105243_100049123 | 223 |
| 282 | 3300009148 | Ga0105243_10069073 | Ga0105243_100690732 | 223 |
| 283 | 3300009174 | Ga0105241_10100053 | Ga0105241_101000533 | 223 |
| 284 | 3300009176 | Ga0105242_10032014 | Ga0105242_100320143 | 223 |
| 285 | 3300009176 | Ga0105242_10246115 | Ga0105242_102461152 | 223 |
| 286 | 3300009177 | Ga0105248_10000287 | Ga0105248_1000028713 | 223 |
| 287 | 3300009545 | Ga0105237_10010942 | Ga0105237_100109421 | 223 |
| 288 | 3300009545 | Ga0105237_10014511 | Ga0105237_100145114 | 223 |
| 289 | 3300009545 | Ga0105237_10251237 | Ga0105237_102512372 | 223 |
| 290 | 3300009545 | Ga0105237_10764331 | Ga0105237_107643311 | 223 |
| 291 | 3300009551 | Ga0105238_10025625 | Ga0105238_100256256 | 223 |
| 292 | 3300009551 | Ga0105238_10032172 | Ga0105238_100321726 | 223 |
| 293 | 3300009551 | Ga0105238_10093566 | Ga0105238_100935663 | 223 |
| 294 | 3300009551 | Ga0105238_10265730 | Ga0105238_102657302 | 223 |
| 295 | 3300009553 | Ga0105249_10000034 | Ga0105249_1000003421 | 223 |
| 296 | 3300009553 | Ga0105249_10022159 | Ga0105249_100221595 | 223 |
| 297 | 3300009553 | Ga0105249_10280644 | Ga0105249_102806442 | 223 |
| 298 | 3300010375 | Ga0105239_10035096 | Ga0105239_100350963 | 223 |
| 299 | 3300010375 | Ga0105239_10039763 | Ga0105239_100397635 | 223 |
| 300 | 3300010375 | Ga0105239_10535060 | Ga0105239_105350602 | 223 |
| 301 | 3300011119 | Ga0105246_10019158 | Ga0105246_100191582 | 223 |
| 302 | 3300011119 | Ga0105246_10372685 | Ga0105246_103726852 | 223 |
| 303 | 3300013100 | Ga0157373_10033893 | Ga0157373_100338933 | 223 |
| 304 | 3300013104 | Ga0157370_10000417 | Ga0157370_1000041752 | 223 |
| 305 | 3300013104 | Ga0157370_10034274 | Ga0157370_100342742 | 223 |
| 306 | 3300013104 | Ga0157370_10114459 | Ga0157370_101144592 | 223 |
| 307 | 3300013105 | Ga0157369_10028725 | Ga0157369_100287255 | 223 |
| 308 | 3300013105 | Ga0157369_10054005 | Ga0157369_100540052 | 223 |
| 309 | 3300013105 | Ga0157369_10067052 | Ga0157369_100670523 | 223 |
| 310 | 3300013105 | Ga0157369_10067333 | Ga0157369_100673334 | 223 |
| 311 | 3300013296 | Ga0157374_10036569 | Ga0157374_100365693 | 223 |
| 312 | 3300013296 | Ga0157374_10041240 | Ga0157374_100412403 | 223 |
| 313 | 3300013297 | Ga0157378_10038203 | Ga0157378_100382032 | 223 |
| 314 | 3300013306 | Ga0163162_10491301 | Ga0163162_104913012 | 223 |
| 315 | 3300013306 | Ga0163162_10536804 | Ga0163162_105368042 | 223 |
| 316 | 3300013306 | Ga0163162_11062791 | Ga0163162_110627911 | 223 |
| 317 | 3300013307 | Ga0157372_10017620 | Ga0157372_100176206 | 223 |
| 318 | 3300013307 | Ga0157372_10047910 | Ga0157372_100479103 | 223 |
| 319 | 3300013307 | Ga0157372_10056034 | Ga0157372_100560343 | 223 |
| 320 | 3300013307 | Ga0157372_10565479 | Ga0157372_105654792 | 223 |
| 321 | 3300013307 | Ga0157372_10631355 | Ga0157372_106313552 | 223 |
| 322 | 3300013307 | Ga0157372_11168844 | Ga0157372_111688442 | 223 |
| 323 | 3300013308 | Ga0157375_10011625 | Ga0157375_100116256 | 223 |
| 324 | 3300014325 | Ga0163163_10012276 | Ga0163163_100122769 | 223 |
| 325 | 3300014325 | Ga0163163_10065573 | Ga0163163_100655733 | 223 |
| 326 | 3300014326 | Ga0157380_10000755 | Ga0157380_100007554 | 223 |
| 327 | 3300014326 | Ga0157380_10117710 | Ga0157380_101177102 | 223 |
| 328 | 3300014745 | Ga0157377_10052178 | Ga0157377_100521782 | 223 |
| 329 | 3300014968 | Ga0157379_10070753 | Ga0157379_100707534 | 223 |
| 330 | 3300014969 | Ga0157376_10000337 | Ga0157376_1000033710 | 223 |
| 331 | 3300015262 | Ga0182007_10001530 | Ga0182007_100015309 | 223 |
| 332 | 3300017792 | Ga0163161_10000051 | Ga0163161_10000051131 | 223 |
| 333 | 3300025225 | Ga0209566_100245 | Ga0209566_10024544 | 223 |
| 334 | 3300025226 | Ga0209674_102389 | Ga0209674_1023891 | 223 |
| 335 | 3300025228 | Ga0209672_100032 | Ga0209672_10003282 | 223 |
| 336 | 3300025228 | Ga0209672_100042 | Ga0209672_100042138 | 223 |
| 337 | 3300025229 | Ga0209147_100012 | Ga0209147_100012212 | 223 |
| 338 | 3300025229 | Ga0209147_100046 | Ga0209147_100046192 | 223 |
| 339 | 3300025229 | Ga0209147_100052 | Ga0209147_100052138 | 223 |
| 340 | 3300025231 | Ga0207427_101415 | Ga0207427_1014157 | 223 |
| 341 | 3300025242 | Ga0209258_100030 | Ga0209258_100030209 | 223 |
| 342 | 3300025242 | Ga0209258_100073 | Ga0209258_100073138 | 223 |
| 343 | 3300025250 | Ga0209026_1000525 | Ga0209026_10005253 | 223 |
| 344 | 3300025250 | Ga0209026_1000593 | Ga0209026_100059324 | 223 |
| 345 | 3300025250 | Ga0209026_1002460 | Ga0209026_10024607 | 223 |
| 346 | 3300025254 | Ga0209148_1000022 | Ga0209148_1000022415 | 223 |
| 347 | 3300025254 | Ga0209148_1000146 | Ga0209148_100014636 | 223 |
| 348 | 3300025254 | Ga0209148_1000807 | Ga0209148_10008072 | 223 |
| 349 | 3300025254 | Ga0209148_1002629 | Ga0209148_10026295 | 223 |
| 350 | 3300025261 | Ga0209233_1000003 | Ga0209233_1000003100 | 223 |
| 351 | 3300025263 | Ga0209565_1000156 | Ga0209565_100015628 | 223 |
| 352 | 3300025263 | Ga0209565_1001983 | Ga0209565_10019832 | 223 |
| 353 | 3300025263 | Ga0209565_1007365 | Ga0209565_10073653 | 223 |
| 354 | 3300025272 | Ga0209455_1000024 | Ga0209455_1000024208 | 223 |
| 355 | 3300025272 | Ga0209455_1000324 | Ga0209455_100032425 | 223 |
| 356 | 3300025272 | Ga0209455_1001136 | Ga0209455_10011364 | 223 |
| 357 | 3300025273 | Ga0209673_1000021 | Ga0209673_1000021386 | 223 |
| 358 | 3300025291 | Ga0209675_1002385 | Ga0209675_10023855 | 223 |
| 359 | 3300025291 | Ga0209675_1004411 | Ga0209675_10044112 | 223 |
| 360 | 3300025294 | Ga0209025_1002038 | Ga0209025_10020386 | 223 |
| 361 | 3300025294 | Ga0209025_1002325 | Ga0209025_100232523 | 223 |
| 362 | 3300025295 | Ga0209564_1000779 | Ga0209564_100077921 | 223 |
| 363 | 3300025295 | Ga0209564_1001967 | Ga0209564_10019678 | 223 |
| 364 | 3300025297 | Ga0209758_1001451 | Ga0209758_10014516 | 223 |
| 365 | 3300025298 | Ga0209050_1000245 | Ga0209050_100024555 | 223 |
| 366 | 3300025299 | Ga0209256_1000486 | Ga0209256_100048657 | 223 |
| 367 | 3300025299 | Ga0209256_1001034 | Ga0209256_10010349 | 223 |
| 368 | 3300025303 | Ga0209051_1049422 | Ga0209051_10494222 | 223 |
| 369 | 3300025304 | Ga0209257_1002240 | Ga0209257_100224011 | 223 |
| 370 | 3300025315 | Ga0207697_10083898 | Ga0207697_100838982 | 223 |
| 371 | 3300025321 | Ga0207656_10003640 | Ga0207656_100036405 | 223 |
| 372 | 3300025321 | Ga0207656_10249528 | Ga0207656_102495281 | 223 |
| 373 | 3300025711 | Ga0207696_1044986 | Ga0207696_10449862 | 223 |
| 374 | 3300025711 | Ga0207696_1059561 | Ga0207696_10595612 | 223 |
| 375 | 3300025901 | Ga0207688_10144551 | Ga0207688_101445512 | 223 |
| 376 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007425 | 223 |
| 377 | 3300025904 | Ga0207647_10001490 | Ga0207647_1000149013 | 223 |
| 378 | 3300025904 | Ga0207647_10002206 | Ga0207647_1000220612 | 223 |
| 379 | 3300025904 | Ga0207647_10008343 | Ga0207647_100083434 | 223 |
| 380 | 3300025904 | Ga0207647_10012534 | Ga0207647_100125343 | 223 |
| 381 | 3300025904 | Ga0207647_10016981 | Ga0207647_100169814 | 223 |
| 382 | 3300025904 | Ga0207647_10123136 | Ga0207647_101231362 | 223 |
| 383 | 3300025904 | Ga0207647_10126392 | Ga0207647_101263922 | 223 |
| 384 | 3300025904 | Ga0207647_10136430 | Ga0207647_101364302 | 223 |
| 385 | 3300025904 | Ga0207647_10356645 | Ga0207647_103566451 | 223 |
| 386 | 3300025907 | Ga0207645_10014651 | Ga0207645_100146516 | 223 |
| 387 | 3300025909 | Ga0207705_10000025 | Ga0207705_10000025134 | 223 |
| 388 | 3300025909 | Ga0207705_10003820 | Ga0207705_100038203 | 223 |
| 389 | 3300025909 | Ga0207705_10151565 | Ga0207705_101515651 | 223 |
| 390 | 3300025911 | Ga0207654_10004007 | Ga0207654_100040074 | 223 |
| 391 | 3300025911 | Ga0207654_10021492 | Ga0207654_100214924 | 223 |
| 392 | 3300025913 | Ga0207695_10001076 | Ga0207695_1000107641 | 223 |
| 393 | 3300025913 | Ga0207695_10006157 | Ga0207695_100061575 | 223 |
| 394 | 3300025913 | Ga0207695_10037531 | Ga0207695_100375313 | 223 |
| 395 | 3300025913 | Ga0207695_10081454 | Ga0207695_100814542 | 223 |
| 396 | 3300025913 | Ga0207695_10150044 | Ga0207695_101500442 | 223 |
| 397 | 3300025913 | Ga0207695_10360639 | Ga0207695_103606391 | 223 |
| 398 | 3300025914 | Ga0207671_10000658 | Ga0207671_1000065847 | 223 |
| 399 | 3300025914 | Ga0207671_10001304 | Ga0207671_1000130411 | 223 |
| 400 | 3300025914 | Ga0207671_10067494 | Ga0207671_100674943 | 223 |
| 401 | 3300025914 | Ga0207671_10114499 | Ga0207671_101144992 | 223 |
| 402 | 3300025914 | Ga0207671_10271865 | Ga0207671_102718652 | 223 |
| 403 | 3300025919 | Ga0207657_10000013 | Ga0207657_1000001348 | 223 |
| 404 | 3300025919 | Ga0207657_10001846 | Ga0207657_100018464 | 223 |
| 405 | 3300025919 | Ga0207657_10018891 | Ga0207657_100188914 | 223 |
| 406 | 3300025919 | Ga0207657_10023265 | Ga0207657_100232653 | 223 |
| 407 | 3300025920 | Ga0207649_10133213 | Ga0207649_101332132 | 223 |
| 408 | 3300025920 | Ga0207649_10163182 | Ga0207649_101631821 | 223 |
| 409 | 3300025923 | Ga0207681_10000041 | Ga0207681_1000004179 | 223 |
| 410 | 3300025923 | Ga0207681_10000089 | Ga0207681_1000008933 | 223 |
| 411 | 3300025924 | Ga0207694_10001347 | Ga0207694_1000134718 | 223 |
| 412 | 3300025924 | Ga0207694_10014825 | Ga0207694_100148253 | 223 |
| 413 | 3300025925 | Ga0207650_10000004 | Ga0207650_10000004125 | 223 |
| 414 | 3300025925 | Ga0207650_10613215 | Ga0207650_106132152 | 223 |
| 415 | 3300025926 | Ga0207659_10082336 | Ga0207659_100823362 | 223 |
| 416 | 3300025931 | Ga0207644_10033388 | Ga0207644_100333882 | 223 |
| 417 | 3300025931 | Ga0207644_10117783 | Ga0207644_101177832 | 223 |
| 418 | 3300025931 | Ga0207644_10167615 | Ga0207644_101676152 | 223 |
| 419 | 3300025932 | Ga0207690_10000107 | Ga0207690_1000010749 | 223 |
| 420 | 3300025932 | Ga0207690_10134778 | Ga0207690_101347782 | 223 |
| 421 | 3300025932 | Ga0207690_10352367 | Ga0207690_103523672 | 223 |
| 422 | 3300025932 | Ga0207690_10795736 | Ga0207690_107957361 | 223 |
| 423 | 3300025933 | Ga0207706_10007212 | Ga0207706_1000721213 | 223 |
| 424 | 3300025933 | Ga0207706_10024340 | Ga0207706_100243403 | 223 |
| 425 | 3300025933 | Ga0207706_10027727 | Ga0207706_100277274 | 223 |
| 426 | 3300025933 | Ga0207706_10070121 | Ga0207706_100701212 | 223 |
| 427 | 3300025933 | Ga0207706_10158944 | Ga0207706_101589443 | 223 |
| 428 | 3300025933 | Ga0207706_10352695 | Ga0207706_103526952 | 223 |
| 429 | 3300025934 | Ga0207686_10015986 | Ga0207686_100159863 | 223 |
| 430 | 3300025934 | Ga0207686_10289287 | Ga0207686_102892872 | 223 |
| 431 | 3300025935 | Ga0207709_10000221 | Ga0207709_1000022168 | 223 |
| 432 | 3300025935 | Ga0207709_10499181 | Ga0207709_104991812 | 223 |
| 433 | 3300025936 | Ga0207670_10106950 | Ga0207670_101069502 | 223 |
| 434 | 3300025937 | Ga0207669_10017310 | Ga0207669_100173104 | 223 |
| 435 | 3300025937 | Ga0207669_10019730 | Ga0207669_100197303 | 223 |
| 436 | 3300025937 | Ga0207669_10058530 | Ga0207669_100585302 | 223 |
| 437 | 3300025938 | Ga0207704_10000072 | Ga0207704_1000007210 | 223 |
| 438 | 3300025938 | Ga0207704_10586284 | Ga0207704_105862842 | 223 |
| 439 | 3300025941 | Ga0207711_10000658 | Ga0207711_1000065830 | 223 |
| 440 | 3300025941 | Ga0207711_10019349 | Ga0207711_100193497 | 223 |
| 441 | 3300025941 | Ga0207711_10038559 | Ga0207711_100385592 | 223 |
| 442 | 3300025941 | Ga0207711_10053973 | Ga0207711_100539732 | 223 |
| 443 | 3300025942 | Ga0207689_10000890 | Ga0207689_1000089025 | 223 |
| 444 | 3300025945 | Ga0207679_10577545 | Ga0207679_105775452 | 223 |
| 445 | 3300025949 | Ga0207667_10000017 | Ga0207667_100000179 | 223 |
| 446 | 3300025949 | Ga0207667_10004684 | Ga0207667_1000468415 | 223 |
| 447 | 3300025949 | Ga0207667_10007685 | Ga0207667_1000768512 | 223 |
| 448 | 3300025949 | Ga0207667_10026817 | Ga0207667_100268173 | 223 |
| 449 | 3300025949 | Ga0207667_10064882 | Ga0207667_100648825 | 223 |
| 450 | 3300025949 | Ga0207667_10073584 | Ga0207667_100735844 | 223 |
| 451 | 3300025949 | Ga0207667_10325035 | Ga0207667_103250353 | 223 |
| 452 | 3300025960 | Ga0207651_10000004 | Ga0207651_1000000410 | 223 |
| 453 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004413 | 223 |
| 454 | 3300025961 | Ga0207712_10014752 | Ga0207712_100147525 | 223 |
| 455 | 3300025972 | Ga0207668_10005056 | Ga0207668_100050565 | 223 |
| 456 | 3300025972 | Ga0207668_10011837 | Ga0207668_100118373 | 223 |
| 457 | 3300025972 | Ga0207668_10020402 | Ga0207668_100204022 | 223 |
| 458 | 3300025972 | Ga0207668_10034517 | Ga0207668_100345172 | 223 |
| 459 | 3300025972 | Ga0207668_10163054 | Ga0207668_101630542 | 223 |
| 460 | 3300025981 | Ga0207640_10000085 | Ga0207640_1000008527 | 223 |
| 461 | 3300025981 | Ga0207640_10150829 | Ga0207640_101508293 | 223 |
| 462 | 3300025981 | Ga0207640_10562878 | Ga0207640_105628782 | 223 |
| 463 | 3300025986 | Ga0207658_10000092 | Ga0207658_1000009271 | 223 |
| 464 | 3300025986 | Ga0207658_10000921 | Ga0207658_100009218 | 223 |
| 465 | 3300025986 | Ga0207658_10010969 | Ga0207658_100109696 | 223 |
| 466 | 3300026023 | Ga0207677_10000138 | Ga0207677_1000013859 | 223 |
| 467 | 3300026035 | Ga0207703_10001141 | Ga0207703_1000114121 | 223 |
| 468 | 3300026041 | Ga0207639_10008807 | Ga0207639_100088076 | 223 |
| 469 | 3300026041 | Ga0207639_10075564 | Ga0207639_100755642 | 223 |
| 470 | 3300026041 | Ga0207639_10089269 | Ga0207639_100892692 | 223 |
| 471 | 3300026041 | Ga0207639_10881638 | Ga0207639_108816381 | 223 |
| 472 | 3300026067 | Ga0207678_10006932 | Ga0207678_100069324 | 223 |
| 473 | 3300026067 | Ga0207678_10024856 | Ga0207678_100248563 | 223 |
| 474 | 3300026067 | Ga0207678_10056282 | Ga0207678_100562823 | 223 |
| 475 | 3300026067 | Ga0207678_10079999 | Ga0207678_100799993 | 223 |
| 476 | 3300026078 | Ga0207702_10007061 | Ga0207702_100070618 | 223 |
| 477 | 3300026078 | Ga0207702_10007774 | Ga0207702_100077744 | 223 |
| 478 | 3300026078 | Ga0207702_10038800 | Ga0207702_100388003 | 223 |
| 479 | 3300026078 | Ga0207702_10120006 | Ga0207702_101200062 | 223 |
| 480 | 3300026088 | Ga0207641_10000428 | Ga0207641_1000042831 | 223 |
| 481 | 3300026088 | Ga0207641_10000580 | Ga0207641_1000058028 | 223 |
| 482 | 3300026088 | Ga0207641_10009974 | Ga0207641_100099747 | 223 |
| 483 | 3300026089 | Ga0207648_10000003 | Ga0207648_10000003279 | 223 |
| 484 | 3300026095 | Ga0207676_10000006 | Ga0207676_10000006585 | 223 |
| 485 | 3300026095 | Ga0207676_10007870 | Ga0207676_100078705 | 223 |
| 486 | 3300026095 | Ga0207676_10008879 | Ga0207676_100088793 | 223 |
| 487 | 3300026116 | Ga0207674_10028673 | Ga0207674_100286733 | 223 |
| 488 | 3300026116 | Ga0207674_10038526 | Ga0207674_100385262 | 223 |
| 489 | 3300026118 | Ga0207675_100000309 | Ga0207675_10000030949 | 223 |
| 490 | 3300026118 | Ga0207675_100000449 | Ga0207675_10000044940 | 223 |
| 491 | 3300026121 | Ga0207683_10036983 | Ga0207683_100369832 | 223 |
| 492 | 3300026142 | Ga0207698_10000198 | Ga0207698_1000019829 | 223 |
| 493 | 3300026142 | Ga0207698_10082607 | Ga0207698_100826073 | 223 |
| 494 | 3300026142 | Ga0207698_10873425 | Ga0207698_108734252 | 223 |
| 495 | 3300027312 | Ga0209371_1000850 | Ga0209371_100085022 | 223 |
| 496 | 3300027866 | Ga0209813_10000078 | Ga0209813_1000007837 | 223 |
| 497 | 3300028379 | Ga0268266_10000225 | Ga0268266_1000022522 | 223 |
| 498 | 3300028379 | Ga0268266_10116000 | Ga0268266_101160003 | 223 |
| 499 | 3300028379 | Ga0268266_10493023 | Ga0268266_104930232 | 223 |
| 500 | 3300028380 | Ga0268265_10000001 | Ga0268265_10000001560 | 223 |
| 501 | 3300028380 | Ga0268265_10000086 | Ga0268265_10000086121 | 223 |
| 502 | 3300028380 | Ga0268265_10053268 | Ga0268265_100532682 | 223 |
| 503 | 3300028380 | Ga0268265_10068436 | Ga0268265_100684362 | 223 |
| 504 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003427 | 223 |
| 505 | 3300028381 | Ga0268264_10000014 | Ga0268264_10000014438 | 223 |
| 506 | 3300028381 | Ga0268264_10000111 | Ga0268264_1000011167 | 223 |
| 507 | 3300030500 | Ga0268256_1000711 | Ga0268256_100071122 | 223 |
| 508 | 3300031239 | Ga0265328_10000259 | Ga0265328_100002594 | 223 |
| 509 | 3300031239 | Ga0265328_10003790 | Ga0265328_100037903 | 223 |
| 510 | 3300031239 | Ga0265328_10004540 | Ga0265328_100045405 | 223 |
| 511 | 3300031250 | Ga0265331_10000026 | Ga0265331_1000002675 | 223 |
| 512 | 3300031251 | Ga0265327_10016714 | Ga0265327_100167143 | 223 |
| 513 | 3300031456 | Ga0307513_10049167 | Ga0307513_100491672 | 223 |
| 514 | 3300031456 | Ga0307513_10070975 | Ga0307513_100709752 | 223 |
| 515 | 3300031731 | Ga0307405_10155226 | Ga0307405_101552262 | 223 |
| 516 | 3300031911 | Ga0307412_10001980 | Ga0307412_100019808 | 223 |
| 517 | 3300031911 | Ga0307412_10081410 | Ga0307412_100814103 | 223 |
| 518 | 3300032005 | Ga0307411_10051058 | Ga0307411_100510582 | 223 |
| 519 | 3300033180 | Ga0307510_10099793 | Ga0307510_100997932 | 223 |
| 520 | 3300035112 | Ga0373932_0006287 | Ga0373932_0006287_304_975 | 223 |
| 521 | 3300037312 | Ga0395899_0002611 | Ga0395899_0002611_4305_4976 | 223 |
| 522 | 3300037418 | Ga0395900_0032290 | Ga0395900_0032290_3976_4650 | 223 |
| 523 | 3300037418 | Ga0395900_0418911 | Ga0395900_0418911_403_1074 | 223 |
| 524 | 3300037466 | Ga0395898_0402221 | Ga0395898_0402221_215_898 | 223 |
| 525 | 3300037471 | Ga0395905_0091569 | Ga0395905_0091569_2148_2819 | 223 |
| 526 | 3300037471 | Ga0395905_0113453 | Ga0395905_0113453_1268_1939 | 223 |
| 527 | 3300037471 | Ga0395905_0192495 | Ga0395905_0192495_407_1081 | 223 |
| 528 | 3300041459 | Ga0451800_1536917 | Ga0451800_1536917_23_694 | 223 |
| 529 | 3300041460 | Ga0451802_0647442 | Ga0451802_0647442_493_1164 | 223 |
| 530 | 3300041512 | Ga0451853_1688911 | Ga0451853_1688911_44_727 | 223 |
| 531 | 3300042005 | Ga0439448_0000682 | Ga0439448_0000682_1849_2520 | 223 |
| 532 | 3300042005 | Ga0439448_0006111 | Ga0439448_0006111_1590_2261 | 223 |
| 533 | 3300042005 | Ga0439448_0007335 | Ga0439448_0007335_1301_1972 | 223 |
| 534 | 3300042012 | Ga0439455_0006286 | Ga0439455_0006286_521_1192 | 223 |
| 535 | 3300042157 | Ga0439458_0000401 | Ga0439458_0000401_2632_3303 | 223 |
| 536 | 3300042157 | Ga0439458_0001321 | Ga0439458_0001321_5502_6173 | 223 |
| 537 | 3300042157 | Ga0439458_0005411 | Ga0439458_0005411_1115_1801 | 223 |
| 538 | 3300044658 | Ga0466972_0001033 | Ga0466972_0001033_2340_3011 | 223 |
| 539 | 3300044683 | Ga0466965_0004366 | Ga0466965_0004366_313_984 | 223 |
| 540 | 3300044684 | Ga0466966_0015458 | Ga0466966_0015458_4135_4818 | 223 |
| 541 | 3300044693 | Ga0466961_0003630 | Ga0466961_0003630_5585_6256 | 223 |
| 542 | 3300044693 | Ga0466961_0151671 | Ga0466961_0151671_16_687 | 223 |
| 543 | 3300044694 | Ga0466963_0001012 | Ga0466963_0001012_3807_4478 | 223 |
| 544 | 3300044706 | Ga0466964_0034760 | Ga0466964_0034760_322_993 | 223 |
| 545 | 3300044719 | Ga0466971_0017725 | Ga0466971_0017725_16_687 | 223 |
| 546 | 3300044735 | Ga0466968_0240721 | Ga0466968_0240721_47_730 | 223 |
| 547 | 3300044765 | Ga0466970_0006546 | Ga0466970_0006546_5004_5675 | 223 |
| 548 | 3300044842 | Ga0466957_0044461 | Ga0466957_0044461_1993_2664 | 223 |
| 549 | 3300044842 | Ga0466957_0487446 | Ga0466957_0487446_127_798 | 223 |
| 550 | 3300044901 | Ga0466960_0019912 | Ga0466960_0019912_74_745 | 223 |
| 551 | 3300045049 | Ga0466959_0003970 | Ga0466959_0003970_2482_3153 | 223 |
| 552 | 3300045976 | Ga0466967_0045808 | Ga0466967_0045808_2127_2798 | 223 |
| 553 | 3300045976 | Ga0466967_0545258 | Ga0466967_0545258_366_1037 | 223 |
| 554 | 3300046455 | Ga0495603_0003196 | Ga0495603_0003196_1119_1802 | 223 |
| 555 | 3300046458 | Ga0495591_004493 | Ga0495591_004493_4164_4844 | 223 |
| 556 | 3300046459 | Ga0495629_0005720 | Ga0495629_0005720_2020_2703 | 223 |
| 557 | 3300046459 | Ga0495629_0263078 | Ga0495629_0263078_444_1127 | 223 |
| 558 | 3300046462 | Ga0495651_0004351 | Ga0495651_0004351_7497_8177 | 223 |
| 559 | 3300046463 | Ga0495653_0051319 | Ga0495653_0051319_1020_1703 | 223 |
| 560 | 3300046463 | Ga0495653_0099301 | Ga0495653_0099301_479_1162 | 223 |
| 561 | 3300046463 | Ga0495653_0313275 | Ga0495653_0313275_240_923 | 223 |
| 562 | 3300046471 | Ga0495650_0001337 | Ga0495650_0001337_17625_18308 | 223 |
| 563 | 3300046472 | Ga0495580_0000090 | Ga0495580_0000090_35221_35904 | 223 |
| 564 | 3300046472 | Ga0495580_0000879 | Ga0495580_0000879_7627_8310 | 223 |
| 565 | 3300046472 | Ga0495580_0030106 | Ga0495580_0030106_2912_3595 | 223 |
| 566 | 3300046476 | Ga0495662_0004557 | Ga0495662_0004557_4625_5308 | 223 |
| 567 | 3300046477 | Ga0495664_0004969 | Ga0495664_0004969_1109_1792 | 223 |
| 568 | 3300046477 | Ga0495664_0014885 | Ga0495664_0014885_2239_2919 | 223 |
| 569 | 3300046500 | Ga0495596_0004191 | Ga0495596_0004191_3855_4538 | 223 |
| 570 | 3300046506 | Ga0495583_0106244 | Ga0495583_0106244_406_1089 | 223 |
| 571 | 3300046507 | Ga0495606_0000406 | Ga0495606_0000406_53864_54538 | 223 |
| 572 | 3300046507 | Ga0495606_0162930 | Ga0495606_0162930_303_974 | 223 |
| 573 | 3300046507 | Ga0495606_0187583 | Ga0495606_0187583_457_1140 | 223 |
| 574 | 3300046511 | Ga0495608_0005489 | Ga0495608_0005489_7489_8172 | 223 |
| 575 | 3300046514 | Ga0495618_0003258 | Ga0495618_0003258_3539_4222 | 223 |
| 576 | 3300046516 | Ga0495628_0000937 | Ga0495628_0000937_24645_25328 | 223 |
| 577 | 3300046516 | Ga0495628_0081023 | Ga0495628_0081023_1292_1972 | 223 |
| 578 | 3300046517 | Ga0495630_0010828 | Ga0495630_0010828_5565_6248 | 223 |
| 579 | 3300046524 | Ga0495648_0001922 | Ga0495648_0001922_13823_14506 | 223 |
| 580 | 3300046524 | Ga0495648_0038725 | Ga0495648_0038725_94_777 | 223 |
| 581 | 3300046524 | Ga0495648_0047499 | Ga0495648_0047499_1145_1828 | 223 |
| 582 | 3300046524 | Ga0495648_0049019 | Ga0495648_0049019_814_1494 | 223 |
| 583 | 3300046526 | Ga0495666_0003365 | Ga0495666_0003365_404_1087 | 223 |
| 584 | 3300046526 | Ga0495666_0013705 | Ga0495666_0013705_3334_4014 | 223 |
| 585 | 3300046529 | Ga0495652_0028340 | Ga0495652_0028340_4123_4806 | 223 |
| 586 | 3300046529 | Ga0495652_0291941 | Ga0495652_0291941_257_940 | 223 |
| 587 | 3300046531 | Ga0495665_0003549 | Ga0495665_0003549_812_1495 | 223 |
| 588 | 3300046533 | Ga0495640_0007079 | Ga0495640_0007079_5692_6372 | 223 |
| 589 | 3300046533 | Ga0495640_0029402 | Ga0495640_0029402_2558_3241 | 223 |
| 590 | 3300046536 | Ga0495587_0005019 | Ga0495587_0005019_2186_2866 | 223 |
| 591 | 3300046543 | Ga0495645_0009889 | Ga0495645_0009889_5676_6359 | 223 |
| 592 | 3300046557 | Ga0495622_0000183 | Ga0495622_0000183_22671_23354 | 223 |
| 593 | 3300046558 | Ga0495633_0119991 | Ga0495633_0119991_340_1023 | 223 |
| 594 | 3300046559 | Ga0495667_0037149 | Ga0495667_0037149_2322_3002 | 223 |
| 595 | 3300046616 | Ga0495668_0134634 | Ga0495668_0134634_574_1254 | 223 |
| 596 | 3300046642 | Ga0495634_0000984 | Ga0495634_0000984_1637_2320 | 223 |
| 597 | 3300046642 | Ga0495634_0014129 | Ga0495634_0014129_2518_3201 | 223 |
| 598 | 3300046648 | Ga0495611_0032419 | Ga0495611_0032419_73_756 | 223 |
| 599 | 3300046660 | Ga0495625_0000158 | Ga0495625_0000158_41636_42319 | 223 |
| 600 | 3300046660 | Ga0495625_0097274 | Ga0495625_0097274_157_840 | 223 |
| 601 | 3300046660 | Ga0495625_0140417 | Ga0495625_0140417_539_1219 | 223 |
| 602 | 3300046660 | Ga0495625_0291575 | Ga0495625_0291575_105_788 | 223 |
| 603 | 3300046663 | Ga0495635_0000661 | Ga0495635_0000661_16170_16853 | 223 |
| 604 | 3300046663 | Ga0495635_0037463 | Ga0495635_0037463_2459_3142 | 223 |
| 605 | 3300046665 | Ga0495661_0015416 | Ga0495661_0015416_1674_2357 | 223 |
| 606 | 3300046665 | Ga0495661_0050749 | Ga0495661_0050749_1659_2342 | 223 |
| 607 | 3300046665 | Ga0495661_0124485 | Ga0495661_0124485_636_1319 | 223 |
| 608 | 3300046674 | Ga0495588_0029525 | Ga0495588_0029525_2056_2739 | 223 |
| 609 | 3300046678 | Ga0495599_0004051 | Ga0495599_0004051_1491_2174 | 223 |
| 610 | 3300046678 | Ga0495599_0013448 | Ga0495599_0013448_2208_2891 | 223 |
| 611 | 3300046679 | Ga0495623_0003736 | Ga0495623_0003736_5286_5969 | 223 |
| 612 | 3300046679 | Ga0495623_0030723 | Ga0495623_0030723_393_1076 | 223 |
| 613 | 3300046680 | Ga0495646_0004327 | Ga0495646_0004327_2811_3491 | 223 |
| 614 | 3300046680 | Ga0495646_0007191 | Ga0495646_0007191_6198_6881 | 223 |
| 615 | 3300046680 | Ga0495646_0132342 | Ga0495646_0132342_13_696 | 223 |
| 616 | 3300046689 | Ga0495613_0000802 | Ga0495613_0000802_23494_24177 | 223 |
| 617 | 3300046689 | Ga0495613_0007363 | Ga0495613_0007363_3617_4300 | 223 |
| 618 | 3300046690 | Ga0495624_0007757 | Ga0495624_0007757_871_1554 | 223 |
| 619 | 3300046690 | Ga0495624_0046068 | Ga0495624_0046068_1459_2142 | 223 |
| 620 | 3300046692 | Ga0495671_0030331 | Ga0495671_0030331_1532_2212 | 223 |
| 621 | 3300046694 | Ga0495649_0058788 | Ga0495649_0058788_1334_2005 | 223 |
| 622 | 3300046794 | Ga0495589_0019545 | Ga0495589_0019545_696_1376 | 223 |
| 623 | 3300047315 | Ga0495581_0003351 | Ga0495581_0003351_564_1247 | 223 |
| 624 | 3300047317 | Ga0495604_0023345 | Ga0495604_0023345_482_1162 | 223 |
| 625 | 3300047319 | Ga0495674_0033874 | Ga0495674_0033874_323_1006 | 223 |
| 626 | 3300047321 | Ga0495676_0038823 | Ga0495676_0038823_3097_3780 | 223 |
| 627 | 3300047322 | Ga0495680_0003534 | Ga0495680_0003534_14398_15081 | 223 |
| 628 | 3300047322 | Ga0495680_0150011 | Ga0495680_0150011_823_1506 | 223 |
| 629 | 3300047323 | Ga0495683_0003122 | Ga0495683_0003122_2942_3622 | 223 |
| 630 | 3300047323 | Ga0495683_0061089 | Ga0495683_0061089_816_1487 | 223 |
| 631 | 3300047443 | Ga0495687_036902 | Ga0495687_036902_987_1658 | 223 |
| 632 | 3300047446 | Ga0495679_000287 | Ga0495679_000287_17218_17901 | 223 |
| 633 | 3300047446 | Ga0495679_000344 | Ga0495679_000344_27806_28486 | 223 |
| 634 | 3300047469 | Ga0495673_0027977 | Ga0495673_0027977_637_1320 | 223 |
| 635 | 3300047471 | Ga0495684_0067812 | Ga0495684_0067812_1881_2564 | 223 |
| 636 | 3300047471 | Ga0495684_0137726 | Ga0495684_0137726_1105_1788 | 223 |
| 637 | 3300047472 | Ga0495686_0006026 | Ga0495686_0006026_1733_2416 | 223 |
| 638 | 3300047673 | Ga0495593_0002076 | Ga0495593_0002076_5839_6522 | 223 |
| 639 | 3300047673 | Ga0495593_0006339 | Ga0495593_0006339_3542_4222 | 223 |
| 640 | 3300048088 | Ga0495602_0011519 | Ga0495602_0011519_814_1497 | 223 |
| 641 | 3300048088 | Ga0495602_0080542 | Ga0495602_0080542_1181_1864 | 223 |
| 642 | 3300048905 | Ga0496102_0000100 | Ga0496102_0000100_107580_108260 | 223 |
| 643 | 3300048905 | Ga0496102_0017559 | Ga0496102_0017559_658_1338 | 223 |
| 644 | 3300048906 | Ga0496103_0000070 | Ga0496103_0000070_107561_108241 | 223 |
| 645 | 3300048906 | Ga0496103_0001574 | Ga0496103_0001574_4599_5279 | 223 |
| 646 | 3300048909 | Ga0496106_0096133 | Ga0496106_0096133_1408_2088 | 223 |
| 647 | 3300048910 | Ga0496107_0044858 | Ga0496107_0044858_1815_2495 | 223 |
| 648 | 3300048919 | Ga0496116_0002579 | Ga0496116_0002579_5443_6123 | 223 |
| 649 | 3300048919 | Ga0496116_0056365 | Ga0496116_0056365_1570_2253 | 223 |
| 650 | 3300048919 | Ga0496116_0123878 | Ga0496116_0123878_473_1153 | 223 |
| 651 | 3300048920 | Ga0496117_0000194 | Ga0496117_0000194_107580_108260 | 223 |
| 652 | 3300048920 | Ga0496117_0005305 | Ga0496117_0005305_8661_9344 | 223 |
| 653 | 3300048920 | Ga0496117_0011492 | Ga0496117_0011492_760_1443 | 223 |
| 654 | 3300048920 | Ga0496117_0034784 | Ga0496117_0034784_972_1652 | 223 |
| 655 | 3300048920 | Ga0496117_0068079 | Ga0496117_0068079_1027_1698 | 223 |
| 656 | 3300048921 | Ga0496118_0000146 | Ga0496118_0000146_107580_108260 | 223 |
| 657 | 3300048921 | Ga0496118_0001200 | Ga0496118_0001200_25285_25968 | 223 |
| 658 | 3300048921 | Ga0496118_0003430 | Ga0496118_0003430_7723_8406 | 223 |
| 659 | 3300048921 | Ga0496118_0004003 | Ga0496118_0004003_3682_4353 | 223 |
| 660 | 3300048921 | Ga0496118_0012474 | Ga0496118_0012474_3624_4295 | 223 |
| 661 | 3300048921 | Ga0496118_0100272 | Ga0496118_0100272_979_1659 | 223 |
| 662 | 3300048922 | Ga0496119_0009849 | Ga0496119_0009849_2227_2898 | 223 |
| 663 | 3300048922 | Ga0496119_0012504 | Ga0496119_0012504_5513_6193 | 223 |
| 664 | 3300048923 | Ga0496120_0053791 | Ga0496120_0053791_1249_1920 | 223 |
| 665 | 3300048924 | Ga0496121_0000822 | Ga0496121_0000822_33431_34114 | 223 |
| 666 | 3300048924 | Ga0496121_0003499 | Ga0496121_0003499_10719_11402 | 223 |
| 667 | 3300048924 | Ga0496121_0081007 | Ga0496121_0081007_887_1567 | 223 |
| 668 | 3300048924 | Ga0496121_0082218 | Ga0496121_0082218_936_1607 | 223 |
| 669 | 3300048924 | Ga0496121_0262135 | Ga0496121_0262135_318_1001 | 223 |
| 670 | 3300048925 | Ga0496122_0003016 | Ga0496122_0003016_15620_16294 | 223 |
| 671 | 3300048925 | Ga0496122_0016579 | Ga0496122_0016579_607_1278 | 223 |
| 672 | 3300048926 | Ga0496123_0004726 | Ga0496123_0004726_9514_10188 | 223 |
| 673 | 3300048926 | Ga0496123_0016846 | Ga0496123_0016846_1106_1777 | 223 |
| 674 | 3300048927 | Ga0496124_0000185 | Ga0496124_0000185_15272_15952 | 223 |
| 675 | 3300048927 | Ga0496124_0015091 | Ga0496124_0015091_2442_3116 | 223 |
| 676 | 3300048927 | Ga0496124_0076810 | Ga0496124_0076810_760_1440 | 223 |
| 677 | 3300048928 | Ga0496125_0008495 | Ga0496125_0008495_4517_5188 | 223 |
| 678 | 3300048928 | Ga0496125_0302192 | Ga0496125_0302192_223_903 | 223 |
| 679 | 3300048929 | Ga0496126_0001126 | Ga0496126_0001126_33513_34196 | 223 |
| 680 | 3300048986 | Ga0466983_0040851 | Ga0466983_0040851_238_921 | 223 |
| 681 | 3300049460 | Ga0495682_0035383 | Ga0495682_0035383_961_1641 | 223 |
| 682 | 3300049569 | Ga0501032_0037427 | Ga0501032_0037427_286_969 | 223 |
| 683 | 3300049571 | Ga0501034_0149154 | Ga0501034_0149154_1353_2036 | 223 |
| 684 | 3300049579 | Ga0501043_0018243 | Ga0501043_0018243_1316_1999 | 223 |
| 685 | 3300049580 | Ga0501046_0180685 | Ga0501046_0180685_772_1455 | 223 |
| 686 | 3300049581 | Ga0501047_0000713 | Ga0501047_0000713_17927_18610 | 223 |
| 687 | 3300049581 | Ga0501047_0000876 | Ga0501047_0000876_15025_15708 | 223 |
| 688 | 3300049581 | Ga0501047_0213720 | Ga0501047_0213720_66_749 | 223 |
| 689 | 3300049586 | Ga0501070_0073604 | Ga0501070_0073604_56_739 | 223 |
| 690 | 3300049588 | Ga0501072_0208637 | Ga0501072_0208637_851_1534 | 223 |
| 691 | 3300049679 | Ga0501249_000464 | Ga0501249_000464_4829_5512 | 223 |
| 692 | 3300049742 | Ga0501080_0002920 | Ga0501080_0002920_867_1550 | 223 |
| 693 | 3300049742 | Ga0501080_0548584 | Ga0501080_0548584_133_816 | 223 |
| 694 | 3300049744 | Ga0501083_0002714 | Ga0501083_0002714_145_828 | 223 |
| 695 | 3300049823 | Ga0501044_0161031 | Ga0501044_0161031_1073_1756 | 223 |
| 696 | 3300050489 | nmdc:mga03683_728_c1 | nmdc:mga03683_728_c1_854_1537 | 223 |
| 697 | 3300050489 | nmdc:mga03683_906_c1 | nmdc:mga03683_906_c1_5676_6356 | 223 |
| 698 | 3300050490 | nmdc:mga03n38_124304_c1 | nmdc:mga03n38_124304_c1_280_963 | 223 |
| 699 | 3300050491 | nmdc:mga00v17_186191_c1 | nmdc:mga00v17_186191_c1_239_919 | 223 |
| 700 | 3300050491 | nmdc:mga00v17_23619_c1 | nmdc:mga00v17_23619_c1_659_1339 | 223 |
| 701 | 3300050491 | nmdc:mga00v17_30823_c1 | nmdc:mga00v17_30823_c1_578_1261 | 223 |
| 702 | 3300050492 | nmdc:mga0yw44_13471_c1 | nmdc:mga0yw44_13471_c1_352_1035 | 223 |
| 703 | 3300050493 | nmdc:mga0k408_11042_c1 | nmdc:mga0k408_11042_c1_285_956 | 223 |
| 704 | 3300050493 | nmdc:mga0k408_201933_c1 | nmdc:mga0k408_201933_c1_378_1061 | 223 |
| 705 | 3300050493 | nmdc:mga0k408_89986_c1 | nmdc:mga0k408_89986_c1_778_1461 | 223 |
| 706 | 3300050493 | nmdc:mga0k408_98477_c1 | nmdc:mga0k408_98477_c1_808_1488 | 223 |
| 707 | 3300050494 | nmdc:mga06z11_9095_c1 | nmdc:mga06z11_9095_c1_324_1007 | 223 |
| 708 | 3300050495 | nmdc:mga04h51_127956_c1 | nmdc:mga04h51_127956_c1_161_844 | 223 |
| 709 | 3300050496 | nmdc:mga07m45_232748_c1 | nmdc:mga07m45_232748_c1_68_748 | 223 |
| 710 | 3300050496 | nmdc:mga07m45_4_c1 | nmdc:mga07m45_4_c1_59354_60037 | 223 |
| 711 | 3300050496 | nmdc:mga07m45_58127_c1 | nmdc:mga07m45_58127_c1_432_1103 | 223 |
| 712 | 3300050516 | nmdc:mga0sz30_12029_c1 | nmdc:mga0sz30_12029_c1_249_929 | 223 |
| 713 | 3300050516 | nmdc:mga0sz30_337_c2 | nmdc:mga0sz30_337_c2_14331_15014 | 223 |
| 714 | 3300053087 | Ga0500643_000363 | Ga0500643_000363_5560_6243 | 223 |
| 715 | 3300053087 | Ga0500643_004836 | Ga0500643_004836_4130_4813 | 223 |
| 716 | 3300053087 | Ga0500643_014441 | Ga0500643_014441_1501_2184 | 223 |
| 717 | 3300053087 | Ga0500643_046444 | Ga0500643_046444_19_702 | 223 |
| 718 | 3300053087 | Ga0500643_069067 | Ga0500643_069067_275_955 | 223 |
| 719 | 3300053118 | Ga0500594_0125797 | Ga0500594_0125797_109_789 | 223 |
| 720 | 3300053121 | Ga0500607_000055 | Ga0500607_000055_15745_16428 | 223 |
| 721 | 3300053130 | Ga0500642_0001182 | Ga0500642_0001182_964_1647 | 223 |
| 722 | 3300053130 | Ga0500642_0016748 | Ga0500642_0016748_1143_1823 | 223 |
| 723 | 3300053136 | Ga0500559_0321164 | Ga0500559_0321164_13_696 | 223 |
| 724 | 3300053140 | Ga0500573_0000030 | Ga0500573_0000030_6084_6767 | 223 |
| 725 | 3300053153 | Ga0500616_0045054 | Ga0500616_0045054_540_1211 | 223 |
| 726 | 3300053161 | Ga0500634_0069018 | Ga0500634_0069018_152_877 | 223 |
| 727 | 3300053730 | Ga0500645_002352 | Ga0500645_002352_2473_3153 | 223 |
| 728 | 3300053730 | Ga0500645_009526 | Ga0500645_009526_316_999 | 223 |
| 729 | 3300053730 | Ga0500645_047436 | Ga0500645_047436_354_1037 | 223 |
| 730 | 3300061719 | Ga0466962_0003412 | Ga0466962_0003412_5256_5927 | 223 |
| 731 | 3300061719 | Ga0466962_0065913 | Ga0466962_0065913_1007_1690 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c0s-assembly1.cif.gz_A | nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis | 0.9725 | 180 | 219 |
| 3dkq-assembly1.cif.gz_C-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9567 | 2 | 223 |
| 3dkq-assembly1.cif.gz_B-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.953 | 2 | 223 |
| 5nfd-assembly2.cif.gz_B | antiparallel monomeric coiled coil of kif21a | 0.9319 | 180 | 219 |
| 3dkq-assembly1.cif.gz_A-2 | crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution | 0.9298 | 2 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c0sA00 | Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain | 0.9725 | 180 | 219 | 4.10.280.10 |
| af_Q8N4C7_48_170_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9596 | 185 | 220 | 1.20.58.70 |
| af_Q8R1Q0_41_164_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9533 | 185 | 220 | 1.20.58.70 |
| af_A5PMK2_44_240_1.20.58.70 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.9488 | 185 | 220 | 1.20.58.70 |
| 3dkqC01 | Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain | 0.9335 | 1 | 174 | 2.60.120.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J7J7R1-F1-model_v4 | deleted | 0.9865 | 2 | 223 |
|
| AF-A0A4Q3SUN3-F1-model_v4 | PKHD-type hydroxylase | 0.9849 | 1 | 97 |
GO:0006879
GO:0006974 GO:0016706 |
| AF-A0A2P0B596-F1-model_v4 | PKHD-type hydroxylase | 0.9825 | 2 | 223 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-F6IKS0-F1-model_v4 | Putative hydroxylase | 0.9811 | 77 | 223 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
| AF-A0A537MUA1-F1-model_v4 | Fe2+-dependent dioxygenase | 0.9806 | 40 | 223 |
GO:0005506
GO:0006879 GO:0006974 GO:0016706 GO:0031418 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar