F477967

General Info

Members Datasets Scaffolds Average Seq Length
731 369 693 225

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10010942|Ga0105237_100109421
Length 248
Sequence MLHIPGVLTNAQVAQCRDLLDAADWVDGNATSGSQSALAKRNRQLPEGSPVARAVGDAIQDALARHALFFSAALPLKVFPPLFNRYAGGETFGTHVDNAIRLLRGTDFRVRSDLSATLFLEEPDAYDGGELCVEDTYGVHRAKLPAGDLVLYPASSLHHVTPVTRGERVASFFWIQSMVRDDGDRTLLFQLDTQIQALSAEKGAKDPMVISLTGIYHNLLRKWRMRRLMRSRCRSYPARRLHHVPTPI

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
8 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
9 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
10 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
11 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
12 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
13 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
14 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
15 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
16 2818991452 Burkholderia cepacia 561 Isolate Unclassified
17 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
18 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
19 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
20 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
21 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
22 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
23 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
24 2904564687 Burkholderia sp. 571 Isolate Unclassified
25 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
26 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
27 2928163908 Burkholderia sp. 567 Isolate Unclassified
28 2928170801 Burkholderia sp. 572 Isolate Unclassified
29 2928536128 Burkholderia sola 565 Isolate Unclassified
30 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
31 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
34 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
40 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
41 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
42 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
43 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
47 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
48 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
49 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
52 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
53 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
54 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
55 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
59 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
60 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
61 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
62 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
75 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
104 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
105 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
106 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
112 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
113 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
114 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
123 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
124 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
125 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
128 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
129 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
130 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
151 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
162 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
225 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
228 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
229 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
230 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
231 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
232 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
233 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
234 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
235 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
242 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
243 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
246 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
271 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
286 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
314 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
315 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
316 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
317 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
320 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
352 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
353 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
363 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
364 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
365 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
366 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
367 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
368 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
369 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.8
Metatranscriptomes 0
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.5
Nodule 0.55
Rhizoplane 1.78
Rhizosphere 73.6
Stem 0
Stem Tuber 0
Unclassified 9.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1019791 3300001904 Bacteria 1061
2 JGI24740J21852_10015655 3300001979 Bacteria 2762
3 JGI24740J21852_10055397 3300001979 Bacteria 1116
4 JGI24739J22299_10009167 3300001989 Bacteria 3693
5 JGI24739J22299_10011951 3300001989 Bacteria 3192
6 JGI24739J22299_10017615 3300001989 Bacteria 2575
7 JGI24739J22299_10028812 3300001989 Bacteria 1935
8 JGI24739J22299_10034258 3300001989 Bacteria 1731
9 JGI24739J22299_10056136 3300001989 Bacteria 1257
10 JGI24737J22298_10001498 3300001990 Bacteria 8321
11 JGI24737J22298_10007618 3300001990 Bacteria 3647
12 JGI24737J22298_10033516 3300001990 Bacteria 1595
13 JGI24737J22298_10062472 3300001990 Bacteria 1119
14 JGI24735J21928_10000192 3300002067 Bacteria 21729
15 JGI24735J21928_10002707 3300002067 Bacteria 6123
16 JGI24735J21928_10019771 3300002067 Bacteria 2068
17 JGI24735J21928_10024506 3300002067 Bacteria 1825
18 JGI24735J21928_10047776 3300002067 Bacteria 1240
19 JGI24735J21928_10050064 3300002067 Bacteria 1207
20 JGI24750J21931_1000069 3300002070 Bacteria 15037
21 JGI24748J21848_1000066 3300002074 Bacteria 39384
22 JGI24738J21930_10003996 3300002075 Bacteria 3662
23 JGI24738J21930_10047337 3300002075 Bacteria 875
24 JGI24749J21850_1001470 3300002076 Bacteria 3330
25 JGI24744J21845_10011969 3300002077 Bacteria 1766
26 JGI24034J26672_10000015 3300002239 Bacteria 137655
27 JGI24742J22300_10013507 3300002244 Bacteria 1366
28 JGI24751J29686_10000081 3300002459 Bacteria 53804
29 JGI24751J29686_10018967 3300002459 Bacteria 1423
30 JGI25157J39369_1015763 3300002741 Bacteria 929
31 JGI25151J46595_10000729 3300003187 Bacteria 27328
32 JGI25165J46597_1000210 3300003214 Bacteria 83572
33 rootH1_10011990 3300003316 Bacteria 2701
34 rootH2_10096727 3300003320 Bacteria 1447
35 rootH2_10244599 3300003320 Bacteria 1305
36 rootH1_10034821 3300003323 Bacteria 2190
37 rootH1_10106373 3300003323 Bacteria 4317
38 Ga0055532_1000295 3300003758 Bacteria 30833
39 Ga0055532_1000337 3300003758 Bacteria 25555
40 Ga0055532_1000383 3300003758 Bacteria 22568
41 Ga0055527_1000104 3300003760 Bacteria 60485
42 Ga0055527_1000154 3300003760 Bacteria 48442
43 Ga0055535_1000218 3300003761 Bacteria 60485
44 Ga0055535_1000320 3300003761 Bacteria 48442
45 Ga0055542_1000153 3300003762 Bacteria 87342
46 Ga0055542_1017039 3300003762 Bacteria 1131
47 Ga0055529_1000176 3300003763 Bacteria 87107
48 Ga0055529_1005697 3300003763 Bacteria 1779
49 Ga0055537_1000955 3300003773 Bacteria 13264
50 Ga0055524_1003436 3300003775 Bacteria 7692
51 Ga0055534_1005791 3300003784 Bacteria 3235
52 Ga0055528_1001345 3300003790 Bacteria 15234
53 Ga0055531_10004535 3300003794 Bacteria 8423
54 Ga0058692_1015940 3300003856 Bacteria 1683
55 Ga0065165_1000554 3300005262 Bacteria 56028
56 Ga0065707_10119358 3300005295 Bacteria 2162
57 Ga0065707_10141752 3300005295 Bacteria 1763
58 Ga0065707_10291499 3300005295 Bacteria 1024
59 Ga0070658_10000055 3300005327 Bacteria 114800
60 Ga0070658_10002322 3300005327 Bacteria 15965
61 Ga0070658_10062126 3300005327 Bacteria 3044
62 Ga0070658_10063942 3300005327 Bacteria 3001
63 Ga0070676_10008260 3300005328 Bacteria 5605
64 Ga0070676_10145143 3300005328 Bacteria 1514
65 Ga0070690_100000025 3300005330 Bacteria 69409
66 Ga0070670_100000003 3300005331 Bacteria 529510
67 Ga0070670_100641275 3300005331 Bacteria 952
68 Ga0070677_10044357 3300005333 Bacteria 1769
69 Ga0068869_100000341 3300005334 Bacteria 24968
70 Ga0070666_10000015 3300005335 Bacteria 208372
71 Ga0068868_100003972 3300005338 Bacteria 10324
72 Ga0068868_100580509 3300005338 Bacteria 991
73 Ga0070660_100000528 3300005339 Bacteria 25477
74 Ga0070660_100000808 3300005339 Bacteria 20758
75 Ga0070660_100002294 3300005339 Bacteria 13147
76 Ga0070660_100014948 3300005339 Bacteria 5600
77 Ga0070660_100383762 3300005339 Bacteria 1160
78 Ga0070660_100482566 3300005339 Bacteria 1030
79 Ga0070660_100493352 3300005339 Bacteria 1018
80 Ga0070660_100563357 3300005339 Bacteria 951
81 Ga0070689_100044006 3300005340 Bacteria 3434
82 Ga0070661_100020324 3300005344 Bacteria 4734
83 Ga0070661_100080760 3300005344 Bacteria 2400
84 Ga0070661_100116020 3300005344 Bacteria 2003
85 Ga0070668_100001896 3300005347 Bacteria 15291
86 Ga0070668_100017496 3300005347 Bacteria 5374
87 Ga0070668_100029444 3300005347 Bacteria 4171
88 Ga0070668_100098141 3300005347 Bacteria 2318
89 Ga0070669_100000044 3300005353 Bacteria 121087
90 Ga0070669_100000059 3300005353 Bacteria 108504
91 Ga0070669_100018483 3300005353 Bacteria 4981
92 Ga0070671_100000769 3300005355 Bacteria 23061
93 Ga0070671_100019548 3300005355 Bacteria 5515
94 Ga0070671_100034287 3300005355 Bacteria 4202
95 Ga0070674_100034464 3300005356 Bacteria 3382
96 Ga0070674_100116594 3300005356 Bacteria 1970
97 Ga0070673_100000014 3300005364 Bacteria 135250
98 Ga0070688_100001673 3300005365 Bacteria 11096
99 Ga0070659_100000012 3300005366 Bacteria 180004
100 Ga0070659_100033494 3300005366 Bacteria 3990
101 Ga0070659_100736610 3300005366 Bacteria 854
102 Ga0070667_100000122 3300005367 Bacteria 99820
103 Ga0070667_100021344 3300005367 Bacteria 5378
104 Ga0070667_100113228 3300005367 Bacteria 2354
105 Ga0070714_100007023 3300005435 Bacteria 8728
106 Ga0070663_100002534 3300005455 Bacteria 10318
107 Ga0070663_100007613 3300005455 Bacteria 6606
108 Ga0070663_100083165 3300005455 Bacteria 2357
109 Ga0070678_100025451 3300005456 Bacteria 3982
110 Ga0070662_100011712 3300005457 Bacteria 5789
111 Ga0070662_100057319 3300005457 Bacteria 2831
112 Ga0070662_100078818 3300005457 Bacteria 2448
113 Ga0070662_100340661 3300005457 Bacteria 1227
114 Ga0070662_100661740 3300005457 Bacteria 881
115 Ga0068867_100000002 3300005459 Bacteria 247206
116 Ga0070685_10000297 3300005466 Bacteria 31390
117 Ga0068853_100004394 3300005539 Bacteria 10918
118 Ga0068853_100012544 3300005539 Bacteria 6894
119 Ga0068853_100108371 3300005539 Bacteria 2464
120 Ga0070672_100161678 3300005543 Bacteria 1858
121 Ga0070686_100000006 3300005544 Bacteria 243316
122 Ga0070693_100698981 3300005547 Bacteria 742
123 Ga0070665_100000217 3300005548 Bacteria 97947
124 Ga0070665_100577392 3300005548 Bacteria 1137
125 Ga0068855_100000504 3300005563 Bacteria 48297
126 Ga0068855_100023939 3300005563 Bacteria 7312
127 Ga0068855_100141969 3300005563 Bacteria 2736
128 Ga0068855_100150611 3300005563 Bacteria 2645
129 Ga0068855_100611148 3300005563 Bacteria 1175
130 Ga0070664_100118181 3300005564 Bacteria 2319
131 Ga0068857_100056055 3300005577 Bacteria 3497
132 Ga0068857_100106634 3300005577 Bacteria 2516
133 Ga0068857_100682101 3300005577 Bacteria 975
134 Ga0068857_100744091 3300005577 Bacteria 934
135 Ga0068854_100000118 3300005578 Bacteria 54862
136 Ga0068854_100003080 3300005578 Bacteria 10382
137 Ga0068854_100213736 3300005578 Bacteria 1522
138 Ga0068856_100006838 3300005614 Bacteria 11160
139 Ga0068856_100014767 3300005614 Bacteria 7538
140 Ga0068856_100068422 3300005614 Bacteria 3510
141 Ga0068856_100078523 3300005614 Bacteria 3272
142 Ga0068852_100000052 3300005616 Bacteria 80329
143 Ga0068852_100040513 3300005616 Bacteria 3930
144 Ga0068852_100484646 3300005616 Bacteria 1229
145 Ga0068852_100532832 3300005616 Bacteria 1173
146 Ga0068859_100017939 3300005617 Bacteria 7113
147 Ga0068859_100086474 3300005617 Bacteria 3182
148 Ga0068864_100000158 3300005618 Bacteria 62676
149 Ga0068864_100010503 3300005618 Bacteria 7652
150 Ga0068864_100012183 3300005618 Bacteria 7108
151 Ga0068861_100012847 3300005719 Bacteria 5848
152 Ga0068851_10281296 3300005834 Bacteria 951
153 Ga0068863_100000108 3300005841 Bacteria 87921
154 Ga0068863_100000822 3300005841 Bacteria 31110
155 Ga0068858_100000582 3300005842 Bacteria 38264
156 Ga0068858_100107169 3300005842 Bacteria 2608
157 Ga0068860_100000027 3300005843 Bacteria 267207
158 Ga0068860_100000050 3300005843 Bacteria 208372
159 Ga0068860_100000152 3300005843 Bacteria 112187
160 Ga0068860_100064295 3300005843 Bacteria 3485
161 Ga0068862_100000001 3300005844 Bacteria 523031
162 Ga0068862_100000062 3300005844 Bacteria 126792
163 Ga0068862_100012059 3300005844 Bacteria 7144
164 Ga0068862_100087844 3300005844 Bacteria 2704
165 Ga0075365_10067723 3300006038 Bacteria 2397
166 Ga0075368_10126319 3300006042 Bacteria 1061
167 Ga0075368_10142748 3300006042 Bacteria 998
168 Ga0075363_100104477 3300006048 Bacteria 1570
169 Ga0075364_10030582 3300006051 Bacteria 3457
170 Ga0075364_10034355 3300006051 Bacteria 3270
171 Ga0075364_10065301 3300006051 Bacteria 2389
172 Ga0075367_10041669 3300006178 Bacteria 2685
173 Ga0075369_10016731 3300006186 Bacteria 2963
174 Ga0075369_10048667 3300006186 Bacteria 1830
175 Ga0075366_10012947 3300006195 Bacteria 4741
176 Ga0075366_10098496 3300006195 Bacteria 1754
177 Ga0075366_10182120 3300006195 Bacteria 1276
178 Ga0097621_100079644 3300006237 Bacteria 2724
179 Ga0075370_10016652 3300006353 Bacteria 3957
180 Ga0068865_100001468 3300006881 Bacteria 13726
181 Ga0097620_100017941 3300006931 Bacteria 7113
182 Ga0097620_100086477 3300006931 Bacteria 3182
183 Ga0105250_10021233 3300009092 Bacteria 2621
184 Ga0105250_10037938 3300009092 Bacteria 1933
185 Ga0105240_10001781 3300009093 Bacteria 36346
186 Ga0105240_10026941 3300009093 Bacteria 7535
187 Ga0105240_10029050 3300009093 Bacteria 7211
188 Ga0105240_10037814 3300009093 Bacteria 6198
189 Ga0105240_10100701 3300009093 Bacteria 3515
190 Ga0105240_10108847 3300009093 Bacteria 3357
191 Ga0105240_10491836 3300009093 Bacteria 1366
192 Ga0105245_10021319 3300009098 Bacteria 5682
193 Ga0105245_10738422 3300009098 Bacteria 1020
194 Ga0105247_10004563 3300009101 Bacteria 8831
195 Ga0105243_10004912 3300009148 Bacteria 10482
196 Ga0105243_10069073 3300009148 Bacteria 2849
197 Ga0105241_10100053 3300009174 Bacteria 2304
198 Ga0105241_10537986 3300009174 Bacteria 1047
199 Ga0105242_10032014 3300009176 Bacteria 4204
200 Ga0105242_10246115 3300009176 Bacteria 1609
201 Ga0105242_10263885 3300009176 Bacteria 1557
202 Ga0105248_10000287 3300009177 Bacteria 59537
203 Ga0105237_10010942 3300009545 Bacteria 9628
204 Ga0105237_10014511 3300009545 Bacteria 8235
205 Ga0105237_10251237 3300009545 Bacteria 1770
206 Ga0105237_10764331 3300009545 Bacteria 973
207 Ga0105238_10025625 3300009551 Bacteria 6011
208 Ga0105238_10032172 3300009551 Bacteria 5337
209 Ga0105238_10093566 3300009551 Bacteria 2993
210 Ga0105238_10265730 3300009551 Bacteria 1696
211 Ga0105249_10000034 3300009553 Bacteria 208378
212 Ga0105249_10022159 3300009553 Bacteria 5689
213 Ga0105249_10280644 3300009553 Bacteria 1663
214 Ga0105239_10035096 3300010375 Bacteria 5508
215 Ga0105239_10039763 3300010375 Bacteria 5153
216 Ga0105239_10535060 3300010375 Bacteria 1334
217 Ga0105246_10019158 3300011119 Bacteria 4368
218 Ga0105246_10372685 3300011119 Bacteria 1177
219 Ga0157373_10033893 3300013100 Bacteria 3669
220 Ga0157370_10000417 3300013104 Bacteria 53666
221 Ga0157370_10034274 3300013104 Bacteria 4945
222 Ga0157370_10114459 3300013104 Bacteria 2520
223 Ga0157369_10028725 3300013105 Bacteria 6151
224 Ga0157369_10054005 3300013105 Bacteria 4339
225 Ga0157369_10067052 3300013105 Bacteria 3860
226 Ga0157369_10067333 3300013105 Bacteria 3850
227 Ga0157374_10036569 3300013296 Bacteria 4499
228 Ga0157374_10041240 3300013296 Bacteria 4253
229 Ga0157378_10038203 3300013297 Bacteria 4254
230 Ga0163162_10491301 3300013306 Bacteria 1358
231 Ga0163162_10536804 3300013306 Bacteria 1298
232 Ga0163162_11062791 3300013306 Bacteria 916
233 Ga0157372_10017620 3300013307 Bacteria 7666
234 Ga0157372_10047910 3300013307 Bacteria 4750
235 Ga0157372_10056034 3300013307 Bacteria 4404
236 Ga0157372_10565479 3300013307 Bacteria 1325
237 Ga0157372_10631355 3300013307 Bacteria 1248
238 Ga0157372_11168844 3300013307 Bacteria 889
239 Ga0157375_10011625 3300013308 Bacteria 7779
240 Ga0163163_10012276 3300014325 Bacteria 7801
241 Ga0163163_10065573 3300014325 Bacteria 3605
242 Ga0157380_10000755 3300014326 Bacteria 20159
243 Ga0157380_10117710 3300014326 Bacteria 2245
244 Ga0157377_10052178 3300014745 Bacteria 2308
245 Ga0157379_10070753 3300014968 Bacteria 3121
246 Ga0157376_10000337 3300014969 Bacteria 31344
247 Ga0157376_10246174 3300014969 Bacteria 1668
248 Ga0182007_10001530 3300015262 Bacteria 12363
249 Ga0163161_10000051 3300017792 Bacteria 122360
250 Ga0209566_100245 3300025225 Bacteria 52020
251 Ga0209674_102389 3300025226 Bacteria 4062
252 Ga0209672_100032 3300025228 Bacteria 324684
253 Ga0209672_100042 3300025228 Bacteria 272005
254 Ga0209147_100012 3300025229 Bacteria 681990
255 Ga0209147_100046 3300025229 Bacteria 295158
256 Ga0209147_100052 3300025229 Bacteria 272005
257 Ga0207427_101415 3300025231 Bacteria 8762
258 Ga0209258_100030 3300025242 Bacteria 470208
259 Ga0209258_100073 3300025242 Bacteria 272005
260 Ga0209026_1000525 3300025250 Bacteria 26985
261 Ga0209026_1000593 3300025250 Bacteria 23624
262 Ga0209026_1002460 3300025250 Bacteria 6938
263 Ga0209148_1000022 3300025254 Bacteria 681990
264 Ga0209148_1000146 3300025254 Bacteria 160734
265 Ga0209148_1000807 3300025254 Bacteria 22828
266 Ga0209148_1002629 3300025254 Bacteria 5847
267 Ga0209233_1000003 3300025261 Bacteria 1607366
268 Ga0209565_1000156 3300025263 Bacteria 91427
269 Ga0209565_1001983 3300025263 Bacteria 7986
270 Ga0209565_1007365 3300025263 Bacteria 2977
271 Ga0209455_1000024 3300025272 Bacteria 676133
272 Ga0209455_1000324 3300025272 Bacteria 47295
273 Ga0209455_1001136 3300025272 Bacteria 12914
274 Ga0209673_1000021 3300025273 Bacteria 422978
275 Ga0209675_1002385 3300025291 Bacteria 9688
276 Ga0209675_1004411 3300025291 Bacteria 6264
277 Ga0209025_1002038 3300025294 Bacteria 23035
278 Ga0209025_1002325 3300025294 Bacteria 20542
279 Ga0209564_1000779 3300025295 Bacteria 44233
280 Ga0209564_1001967 3300025295 Bacteria 18091
281 Ga0209758_1001451 3300025297 Bacteria 27861
282 Ga0209050_1000245 3300025298 Bacteria 116929
283 Ga0209256_1000486 3300025299 Bacteria 58822
284 Ga0209256_1001034 3300025299 Bacteria 32637
285 Ga0209051_1049422 3300025303 Bacteria 1417
286 Ga0209257_1002240 3300025304 Bacteria 19852
287 Ga0207697_10083898 3300025315 Bacteria 1344
288 Ga0207656_10003640 3300025321 Bacteria 5323
289 Ga0207656_10249528 3300025321 Bacteria 869
290 Ga0207696_1044986 3300025711 Bacteria 1278
291 Ga0207696_1059561 3300025711 Bacteria 1076
292 Ga0207688_10144551 3300025901 Bacteria 1401
293 Ga0207680_10000007 3300025903 Bacteria 623574
294 Ga0207647_10001490 3300025904 Bacteria 17990
295 Ga0207647_10002206 3300025904 Bacteria 14845
296 Ga0207647_10008343 3300025904 Bacteria 7431
297 Ga0207647_10012534 3300025904 Bacteria 5898
298 Ga0207647_10016981 3300025904 Bacteria 4955
299 Ga0207647_10123136 3300025904 Bacteria 1528
300 Ga0207647_10126392 3300025904 Bacteria 1504
301 Ga0207647_10136430 3300025904 Bacteria 1440
302 Ga0207647_10356645 3300025904 Bacteria 828
303 Ga0207645_10014651 3300025907 Bacteria 5236
304 Ga0207705_10000025 3300025909 Bacteria 259826
305 Ga0207705_10001077 3300025909 Bacteria 22145
306 Ga0207705_10003820 3300025909 Bacteria 11458
307 Ga0207705_10151565 3300025909 Bacteria 1737
308 Ga0207654_10004007 3300025911 Bacteria 7414
309 Ga0207654_10021492 3300025911 Bacteria 3432
310 Ga0207654_10215808 3300025911 Bacteria 1270
311 Ga0207654_10272466 3300025911 Bacteria 1142
312 Ga0207695_10001076 3300025913 Bacteria 47744
313 Ga0207695_10006157 3300025913 Bacteria 15640
314 Ga0207695_10029082 3300025913 Bacteria 6115
315 Ga0207695_10037531 3300025913 Bacteria 5227
316 Ga0207695_10081454 3300025913 Bacteria 3275
317 Ga0207695_10150044 3300025913 Bacteria 2271
318 Ga0207695_10360639 3300025913 Bacteria 1340
319 Ga0207671_10000658 3300025914 Bacteria 45037
320 Ga0207671_10001304 3300025914 Bacteria 29270
321 Ga0207671_10067494 3300025914 Bacteria 2663
322 Ga0207671_10114499 3300025914 Bacteria 2055
323 Ga0207671_10271865 3300025914 Bacteria 1335
324 Ga0207657_10000013 3300025919 Bacteria 180080
325 Ga0207657_10001160 3300025919 Bacteria 28040
326 Ga0207657_10001846 3300025919 Bacteria 22883
327 Ga0207657_10018891 3300025919 Bacteria 6562
328 Ga0207657_10023265 3300025919 Bacteria 5773
329 Ga0207657_10201668 3300025919 Bacteria 1600
330 Ga0207649_10051407 3300025920 Bacteria 2552
331 Ga0207649_10133213 3300025920 Bacteria 1691
332 Ga0207649_10163182 3300025920 Unclassified 1545
333 Ga0207681_10000041 3300025923 Bacteria 140201
334 Ga0207681_10000089 3300025923 Bacteria 79526
335 Ga0207681_10035754 3300025923 Bacteria 3275
336 Ga0207694_10001347 3300025924 Bacteria 21148
337 Ga0207694_10014825 3300025924 Bacteria 5877
338 Ga0207650_10000004 3300025925 Bacteria 743372
339 Ga0207650_10613215 3300025925 Bacteria 916
340 Ga0207659_10082336 3300025926 Bacteria 2382
341 Ga0207664_10000966 3300025929 Bacteria 19382
342 Ga0207644_10033388 3300025931 Bacteria 3595
343 Ga0207644_10117783 3300025931 Bacteria 2017
344 Ga0207644_10167615 3300025931 Bacteria 1712
345 Ga0207690_10000107 3300025932 Bacteria 67606
346 Ga0207690_10134778 3300025932 Bacteria 1812
347 Ga0207690_10352367 3300025932 Bacteria 1164
348 Ga0207690_10795736 3300025932 Bacteria 781
349 Ga0207706_10007212 3300025933 Bacteria 10277
350 Ga0207706_10024340 3300025933 Bacteria 5428
351 Ga0207706_10027727 3300025933 Bacteria 5063
352 Ga0207706_10070121 3300025933 Bacteria 3083
353 Ga0207706_10158944 3300025933 Bacteria 1987
354 Ga0207706_10352695 3300025933 Bacteria 1279
355 Ga0207686_10015986 3300025934 Bacteria 4205
356 Ga0207686_10068267 3300025934 Bacteria 2277
357 Ga0207686_10289287 3300025934 Bacteria 1213
358 Ga0207709_10000221 3300025935 Bacteria 72262
359 Ga0207709_10499181 3300025935 Bacteria 949
360 Ga0207670_10106950 3300025936 Bacteria 2008
361 Ga0207669_10017310 3300025937 Bacteria 3693
362 Ga0207669_10019730 3300025937 Bacteria 3518
363 Ga0207669_10058530 3300025937 Bacteria 2351
364 Ga0207704_10000072 3300025938 Bacteria 63809
365 Ga0207704_10586284 3300025938 Bacteria 911
366 Ga0207711_10000658 3300025941 Bacteria 34432
367 Ga0207711_10019349 3300025941 Bacteria 5669
368 Ga0207711_10038559 3300025941 Bacteria 4064
369 Ga0207711_10053973 3300025941 Bacteria 3447
370 Ga0207689_10000890 3300025942 Bacteria 28729
371 Ga0207679_10577545 3300025945 Bacteria 1011
372 Ga0207667_10000017 3300025949 Bacteria 390654
373 Ga0207667_10004684 3300025949 Bacteria 16743
374 Ga0207667_10007685 3300025949 Bacteria 12904
375 Ga0207667_10026817 3300025949 Bacteria 6287
376 Ga0207667_10064882 3300025949 Bacteria 3810
377 Ga0207667_10073584 3300025949 Bacteria 3550
378 Ga0207667_10078998 3300025949 Bacteria 3410
379 Ga0207667_10325035 3300025949 Bacteria 1571
380 Ga0207651_10000004 3300025960 Bacteria 290191
381 Ga0207712_10000004 3300025961 Bacteria 614655
382 Ga0207712_10014752 3300025961 Bacteria 5031
383 Ga0207668_10005056 3300025972 Bacteria 7764
384 Ga0207668_10011837 3300025972 Bacteria 5318
385 Ga0207668_10020402 3300025972 Bacteria 4210
386 Ga0207668_10034517 3300025972 Bacteria 3360
387 Ga0207668_10163054 3300025972 Bacteria 1739
388 Ga0207640_10000085 3300025981 Bacteria 73838
389 Ga0207640_10150829 3300025981 Bacteria 1708
390 Ga0207640_10562878 3300025981 Bacteria 960
391 Ga0207658_10000092 3300025986 Bacteria 99965
392 Ga0207658_10000921 3300025986 Bacteria 24296
393 Ga0207658_10010969 3300025986 Bacteria 6170
394 Ga0207677_10000138 3300026023 Bacteria 59552
395 Ga0207703_10001141 3300026035 Bacteria 25115
396 Ga0207703_10979829 3300026035 Bacteria 811
397 Ga0207639_10008807 3300026041 Bacteria 6936
398 Ga0207639_10075564 3300026041 Bacteria 2650
399 Ga0207639_10089269 3300026041 Bacteria 2462
400 Ga0207639_10583051 3300026041 Bacteria 1030
401 Ga0207639_10881638 3300026041 Bacteria 836
402 Ga0207678_10006932 3300026067 Bacteria 10058
403 Ga0207678_10024856 3300026067 Bacteria 5230
404 Ga0207678_10056282 3300026067 Bacteria 3386
405 Ga0207678_10079999 3300026067 Bacteria 2798
406 Ga0207702_10007061 3300026078 Bacteria 9605
407 Ga0207702_10007774 3300026078 Bacteria 9103
408 Ga0207702_10038800 3300026078 Bacteria 3989
409 Ga0207702_10120006 3300026078 Bacteria 2352
410 Ga0207702_10292270 3300026078 Bacteria 1544
411 Ga0207641_10000428 3300026088 Bacteria 48639
412 Ga0207641_10000580 3300026088 Bacteria 40301
413 Ga0207641_10009974 3300026088 Bacteria 7815
414 Ga0207648_10000003 3300026089 Bacteria 289983
415 Ga0207648_10020229 3300026089 Bacteria 5998
416 Ga0207676_10000006 3300026095 Bacteria 681936
417 Ga0207676_10007870 3300026095 Bacteria 7579
418 Ga0207676_10008879 3300026095 Bacteria 7149
419 Ga0207674_10028673 3300026116 Bacteria 5872
420 Ga0207674_10038526 3300026116 Bacteria 4959
421 Ga0207675_100000309 3300026118 Bacteria 46765
422 Ga0207675_100000449 3300026118 Bacteria 39979
423 Ga0207675_100425178 3300026118 Bacteria 1312
424 Ga0207683_10036983 3300026121 Bacteria 4251
425 Ga0207683_10063880 3300026121 Bacteria 3243
426 Ga0207698_10000198 3300026142 Bacteria 37741
427 Ga0207698_10082607 3300026142 Bacteria 2598
428 Ga0207698_10873425 3300026142 Bacteria 905
429 Ga0209371_1000850 3300027312 Bacteria 24775
430 Ga0209813_10000078 3300027866 Bacteria 36150
431 Ga0268266_10000225 3300028379 Bacteria 98082
432 Ga0268266_10116000 3300028379 Bacteria 2378
433 Ga0268266_10493023 3300028379 Bacteria 1169
434 Ga0268265_10000001 3300028380 Bacteria 1230727
435 Ga0268265_10000086 3300028380 Bacteria 119049
436 Ga0268265_10053268 3300028380 Bacteria 3065
437 Ga0268265_10068436 3300028380 Bacteria 2753
438 Ga0268265_10459001 3300028380 Bacteria 1192
439 Ga0268264_10000003 3300028381 Bacteria 1141976
440 Ga0268264_10000014 3300028381 Bacteria 509962
441 Ga0268264_10000111 3300028381 Bacteria 204718
442 Ga0268256_1000711 3300030500 Bacteria 24775
443 Ga0265328_10000259 3300031239 Bacteria 24437
444 Ga0265328_10003790 3300031239 Bacteria 6646
445 Ga0265328_10004540 3300031239 Bacteria 6019
446 Ga0265331_10000026 3300031250 Bacteria 223760
447 Ga0265327_10016714 3300031251 Bacteria 4642
448 Ga0307513_10049167 3300031456 Bacteria 4570
449 Ga0307513_10070975 3300031456 Bacteria 3637
450 Ga0307405_10155226 3300031731 Bacteria 1614
451 Ga0307410_10149311 3300031852 Bacteria 1738
452 Ga0307412_10001980 3300031911 Bacteria 11350
453 Ga0307412_10081410 3300031911 Bacteria 2239
454 Ga0307411_10051058 3300032005 Bacteria 2697
455 Ga0307510_10099793 3300033180 Bacteria 2699
456 Ga0373932_0006287 3300035112 Bacteria 2808
457 Ga0316574_0516480 3300035398 Bacteria 744
458 Ga0395899_0002611 3300037312 Bacteria 14528
459 Ga0395900_0010043 3300037418 Bacteria 9685
460 Ga0395900_0032290 3300037418 Bacteria 5383
461 Ga0395900_0418911 3300037418 Bacteria 1300
462 Ga0395898_0083168 3300037466 Bacteria 3085
463 Ga0395898_0402221 3300037466 Bacteria 1306
464 Ga0395905_0091569 3300037471 Bacteria 2851
465 Ga0395905_0113453 3300037471 Bacteria 2546
466 Ga0395905_0192495 3300037471 Bacteria 1913
467 Ga0451800_1536917 3300041459 Bacteria 811
468 Ga0451802_0647442 3300041460 Bacteria 1727
469 Ga0451853_1688911 3300041512 Bacteria 1820
470 Ga0439448_0000682 3300042005 Bacteria 8111
471 Ga0439448_0006111 3300042005 Bacteria 3454
472 Ga0439448_0007335 3300042005 Bacteria 3193
473 Ga0439455_0006286 3300042012 Bacteria 2458
474 Ga0439458_0000401 3300042157 Bacteria 10908
475 Ga0439458_0001321 3300042157 Bacteria 6261
476 Ga0439458_0005411 3300042157 Bacteria 2871
477 Ga0466972_0001033 3300044658 Bacteria 13353
478 Ga0466965_0004366 3300044683 Bacteria 6286
479 Ga0466965_0329440 3300044683 Bacteria 833
480 Ga0466966_0015458 3300044684 Bacteria 5045
481 Ga0466961_0003630 3300044693 Bacteria 9609
482 Ga0466961_0151671 3300044693 Bacteria 1447
483 Ga0466963_0001012 3300044694 Bacteria 14536
484 Ga0466964_0034760 3300044706 Bacteria 2012
485 Ga0466971_0017725 3300044719 Bacteria 3153
486 Ga0466968_0240721 3300044735 Bacteria 857
487 Ga0466970_0006546 3300044765 Bacteria 5821
488 Ga0466957_0044461 3300044842 Bacteria 2691
489 Ga0466957_0487446 3300044842 Bacteria 853
490 Ga0466960_0019912 3300044901 Bacteria 2964
491 Ga0466959_0003970 3300045049 Bacteria 9831
492 Ga0466967_0045808 3300045976 Bacteria 3803
493 Ga0466967_0545258 3300045976 Bacteria 1141
494 Ga0495603_0003196 3300046455 Bacteria 9751
495 Ga0495591_004493 3300046458 Bacteria 6810
496 Ga0495629_0005720 3300046459 Bacteria 9276
497 Ga0495629_0008470 3300046459 Bacteria 7572
498 Ga0495629_0263078 3300046459 Bacteria 1185
499 Ga0495651_0004351 3300046462 Bacteria 10840
500 Ga0495653_0051319 3300046463 Bacteria 3167
501 Ga0495653_0099301 3300046463 Bacteria 2112
502 Ga0495653_0313275 3300046463 Bacteria 1019
503 Ga0495650_0001337 3300046471 Bacteria 24602
504 Ga0495580_0000090 3300046472 Bacteria 59451
505 Ga0495580_0000879 3300046472 Bacteria 26043
506 Ga0495580_0030106 3300046472 Bacteria 3933
507 Ga0495580_0131769 3300046472 Bacteria 1734
508 Ga0495662_0004557 3300046476 Bacteria 6952
509 Ga0495664_0004969 3300046477 Bacteria 7278
510 Ga0495664_0014885 3300046477 Bacteria 4415
511 Ga0495596_0004191 3300046500 Bacteria 7082
512 Ga0495583_0106244 3300046506 Bacteria 1193
513 Ga0495606_0000406 3300046507 Bacteria 72668
514 Ga0495606_0162930 3300046507 Bacteria 1299
515 Ga0495606_0187583 3300046507 Bacteria 1188
516 Ga0495608_0005489 3300046511 Bacteria 9063
517 Ga0495618_0003258 3300046514 Bacteria 10164
518 Ga0495628_0000937 3300046516 Bacteria 26727
519 Ga0495628_0081023 3300046516 Bacteria 2521
520 Ga0495630_0010828 3300046517 Bacteria 6586
521 Ga0495648_0001922 3300046524 Bacteria 19797
522 Ga0495648_0038725 3300046524 Bacteria 3044
523 Ga0495648_0047499 3300046524 Bacteria 2652
524 Ga0495648_0049019 3300046524 Bacteria 2593
525 Ga0495666_0003365 3300046526 Bacteria 8067
526 Ga0495666_0013705 3300046526 Bacteria 4041
527 Ga0495652_0028340 3300046529 Bacteria 4927
528 Ga0495652_0029548 3300046529 Unclassified 4815
529 Ga0495652_0291941 3300046529 Bacteria 1189
530 Ga0495665_0003549 3300046531 Bacteria 8475
531 Ga0495640_0007079 3300046533 Bacteria 8830
532 Ga0495640_0029402 3300046533 Bacteria 3946
533 Ga0495587_0005019 3300046536 Bacteria 8666
534 Ga0495587_0017094 3300046536 Unclassified 4510
535 Ga0495645_0009889 3300046543 Bacteria 6673
536 Ga0495645_0090929 3300046543 Unclassified 2180
537 Ga0495622_0000183 3300046557 Bacteria 50803
538 Ga0495633_0000305 3300046558 Bacteria 55923
539 Ga0495633_0119991 3300046558 Bacteria 1218
540 Ga0495667_0037149 3300046559 Bacteria 3247
541 Ga0495656_0137699 3300046615 Bacteria 1168
542 Ga0495668_0134634 3300046616 Bacteria 1352
543 Ga0495634_0000984 3300046642 Bacteria 26848
544 Ga0495634_0014129 3300046642 Bacteria 5764
545 Ga0495611_0032419 3300046648 Bacteria 2302
546 Ga0495625_0000158 3300046660 Bacteria 104399
547 Ga0495625_0097274 3300046660 Bacteria 2026
548 Ga0495625_0140417 3300046660 Bacteria 1630
549 Ga0495625_0291575 3300046660 Bacteria 1047
550 Ga0495635_0000661 3300046663 Bacteria 22131
551 Ga0495635_0037463 3300046663 Bacteria 3357
552 Ga0495661_0015416 3300046665 Bacteria 5101
553 Ga0495661_0050749 3300046665 Bacteria 2509
554 Ga0495661_0124485 3300046665 Bacteria 1420
555 Ga0495588_0029525 3300046674 Bacteria 2751
556 Ga0495599_0004051 3300046678 Bacteria 8631
557 Ga0495599_0013448 3300046678 Bacteria 5056
558 Ga0495623_0003736 3300046679 Bacteria 10041
559 Ga0495623_0030723 3300046679 Bacteria 3455
560 Ga0495646_0004327 3300046680 Bacteria 8949
561 Ga0495646_0007191 3300046680 Bacteria 7070
562 Ga0495646_0132342 3300046680 Bacteria 1403
563 Ga0495613_0000802 3300046689 Bacteria 24365
564 Ga0495613_0007363 3300046689 Bacteria 8202
565 Ga0495613_0019898 3300046689 Bacteria 5003
566 Ga0495624_0007757 3300046690 Bacteria 7530
567 Ga0495624_0046068 3300046690 Bacteria 2773
568 Ga0495671_0030331 3300046692 Bacteria 2770
569 Ga0495649_0058788 3300046694 Bacteria 2071
570 Ga0495589_0019545 3300046794 Bacteria 3470
571 Ga0495581_0003351 3300047315 Bacteria 9196
572 Ga0495604_0023345 3300047317 Bacteria 4933
573 Ga0495674_0033874 3300047319 Bacteria 4622
574 Ga0495676_0038823 3300047321 Bacteria 3951
575 Ga0495680_0003534 3300047322 Bacteria 15320
576 Ga0495680_0150011 3300047322 Bacteria 1700
577 Ga0495683_0003122 3300047323 Bacteria 9705
578 Ga0495683_0061089 3300047323 Bacteria 1866
579 Ga0495687_036902 3300047443 Bacteria 2182
580 Ga0495679_000287 3300047446 Bacteria 41484
581 Ga0495679_000344 3300047446 Bacteria 36397
582 Ga0495673_0027977 3300047469 Bacteria 2675
583 Ga0495684_0067812 3300047471 Bacteria 2713
584 Ga0495684_0097931 3300047471 Bacteria 2218
585 Ga0495684_0137726 3300047471 Bacteria 1831
586 Ga0495686_0000861 3300047472 Bacteria 38948
587 Ga0495686_0006026 3300047472 Bacteria 9419
588 Ga0495593_0002076 3300047673 Bacteria 11967
589 Ga0495593_0006339 3300047673 Bacteria 6941
590 Ga0495602_0011519 3300048088 Bacteria 9137
591 Ga0495602_0080542 3300048088 Bacteria 2742
592 Ga0496102_0000100 3300048905 Bacteria 123531
593 Ga0496102_0017559 3300048905 Bacteria 6267
594 Ga0496103_0000070 3300048906 Bacteria 121077
595 Ga0496103_0001574 3300048906 Bacteria 15064
596 Ga0496106_0096133 3300048909 Bacteria 2292
597 Ga0496107_0044858 3300048910 Bacteria 3179
598 Ga0496110_0003673 3300048913 Bacteria 11805
599 Ga0496116_0002579 3300048919 Bacteria 18871
600 Ga0496116_0056365 3300048919 Bacteria 2576
601 Ga0496116_0123878 3300048919 Bacteria 1489
602 Ga0496117_0000194 3300048920 Bacteria 123531
603 Ga0496117_0005305 3300048920 Bacteria 13633
604 Ga0496117_0011492 3300048920 Bacteria 7926
605 Ga0496117_0034784 3300048920 Bacteria 3791
606 Ga0496117_0068079 3300048920 Bacteria 2405
607 Ga0496117_0369424 3300048920 Bacteria 734
608 Ga0496118_0000146 3300048921 Bacteria 123531
609 Ga0496118_0001200 3300048921 Bacteria 39881
610 Ga0496118_0003430 3300048921 Bacteria 19994
611 Ga0496118_0004003 3300048921 Bacteria 17936
612 Ga0496118_0012474 3300048921 Bacteria 8151
613 Ga0496118_0100272 3300048921 Bacteria 1959
614 Ga0496119_0009849 3300048922 Bacteria 8122
615 Ga0496119_0012504 3300048922 Bacteria 6887
616 Ga0496120_0053791 3300048923 Bacteria 2285
617 Ga0496121_0000822 3300048924 Bacteria 56626
618 Ga0496121_0003499 3300048924 Bacteria 22330
619 Ga0496121_0081007 3300048924 Bacteria 2571
620 Ga0496121_0082218 3300048924 Bacteria 2547
621 Ga0496121_0262135 3300048924 Bacteria 1193
622 Ga0496122_0003016 3300048925 Bacteria 22836
623 Ga0496122_0016579 3300048925 Bacteria 6957
624 Ga0496123_0004726 3300048926 Bacteria 14097
625 Ga0496123_0016846 3300048926 Bacteria 5908
626 Ga0496124_0000185 3300048927 Bacteria 123531
627 Ga0496124_0015091 3300048927 Bacteria 7427
628 Ga0496124_0076810 3300048927 Bacteria 2756
629 Ga0496125_0008495 3300048928 Bacteria 10743
630 Ga0496125_0302192 3300048928 Bacteria 980
631 Ga0496126_0001126 3300048929 Bacteria 44695
632 Ga0496126_0004413 3300048929 Bacteria 16849
633 Ga0466983_0040851 3300048986 Bacteria 3874
634 Ga0495682_0035383 3300049460 Bacteria 1840
635 Ga0501032_0037427 3300049569 Bacteria 3309
636 Ga0501034_0149154 3300049571 Bacteria 2315
637 Ga0501043_0018243 3300049579 Bacteria 5501
638 Ga0501046_0180685 3300049580 Bacteria 1578
639 Ga0501047_0000713 3300049581 Bacteria 34681
640 Ga0501047_0000876 3300049581 Bacteria 30712
641 Ga0501047_0213720 3300049581 Bacteria 1786
642 Ga0501070_0073604 3300049586 Bacteria 2827
643 Ga0501072_0208637 3300049588 Bacteria 1557
644 Ga0501249_000464 3300049679 Bacteria 10123
645 Ga0501080_0002920 3300049742 Bacteria 15017
646 Ga0501080_0548584 3300049742 Bacteria 1030
647 Ga0501083_0002714 3300049744 Bacteria 12220
648 Ga0501044_0161031 3300049823 Bacteria 2221
649 Ga0501044_0492331 3300049823 Bacteria 1128
650 Ga0501284_03672 3300050005 Bacteria 861
651 nmdc:mga03683_728_c1 3300050489 Bacteria 9423
652 nmdc:mga03683_906_c1 3300050489 Bacteria 8520
653 nmdc:mga03n38_124304_c1 3300050490 Bacteria 1272
654 nmdc:mga00v17_186191_c1 3300050491 Bacteria 1340
655 nmdc:mga00v17_23619_c1 3300050491 Bacteria 3557
656 nmdc:mga00v17_30823_c1 3300050491 Bacteria 3158
657 nmdc:mga00v17_68152_c1 3300050491 Bacteria 2199
658 nmdc:mga0yw44_13471_c1 3300050492 Bacteria 4309
659 nmdc:mga0k408_11042_c1 3300050493 Bacteria 4905
660 nmdc:mga0k408_201933_c1 3300050493 Bacteria 1187
661 nmdc:mga0k408_89986_c1 3300050493 Bacteria 1802
662 nmdc:mga0k408_98477_c1 3300050493 Bacteria 1723
663 nmdc:mga06z11_9095_c1 3300050494 Bacteria 4174
664 nmdc:mga04h51_127956_c1 3300050495 Bacteria 952
665 nmdc:mga07m45_232748_c1 3300050496 Bacteria 1072
666 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
667 nmdc:mga07m45_58127_c1 3300050496 Bacteria 2188
668 nmdc:mga0sz30_12029_c1 3300050516 Bacteria 2830
669 nmdc:mga0sz30_337_c2 3300050516 Bacteria 17733
670 Ga0495601_0060041 3300053077 Unclassified 2412
671 Ga0495595_0183207 3300053084 Bacteria 1039
672 Ga0495619_0033882 3300053085 Bacteria 3318
673 Ga0500643_000363 3300053087 Bacteria 35844
674 Ga0500643_004836 3300053087 Bacteria 5951
675 Ga0500643_008874 3300053087 Bacteria 3901
676 Ga0500643_014441 3300053087 Bacteria 2745
677 Ga0500643_046444 3300053087 Bacteria 1254
678 Ga0500643_069067 3300053087 Bacteria 982
679 Ga0500641_0000125 3300053096 Bacteria 28797
680 Ga0500594_0125797 3300053118 Bacteria 808
681 Ga0500607_000055 3300053121 Bacteria 78780
682 Ga0500642_0001182 3300053130 Bacteria 7472
683 Ga0500642_0016748 3300053130 Bacteria 2792
684 Ga0500559_0321164 3300053136 Bacteria 726
685 Ga0500573_0000030 3300053140 Bacteria 135037
686 Ga0500616_0045054 3300053153 Bacteria 2352
687 Ga0500622_0025249 3300053156 Bacteria 3140
688 Ga0500634_0069018 3300053161 Bacteria 1855
689 Ga0500645_002352 3300053730 Bacteria 8517
690 Ga0500645_009526 3300053730 Bacteria 3259
691 Ga0500645_047436 3300053730 Bacteria 1259
692 Ga0466962_0003412 3300061719 Bacteria 7568
693 Ga0466962_0065913 3300061719 Bacteria 1729

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0516480 Ga0316574_0516480_10_687 200
2 3300048920 Ga0496117_0369424 Ga0496117_0369424_53_667 204
3 3300031852 Ga0307410_10149311 Ga0307410_101493111 215
4 3300025923 Ga0207681_10035754 Ga0207681_100357542 220
5 iso_pu_bacteria 2501025501 2501072470 220
6 iso_pu_bacteria 2501025504 2501409103 220
7 iso_pu_bacteria 2510917014 2511101151 220
8 iso_pu_bacteria 2510917015 2511107132 220
9 iso_pu_bacteria 2515154122 2515680305 220
10 iso_pu_bacteria 2599185239 2599734363 220
11 iso_pu_bacteria 2599185240 2599747456 220
12 iso_pu_bacteria 2599185355 2600209340 220
13 iso_pu_bacteria 2643221541 2643730021 220
14 iso_pu_bacteria 2643221605 2644039797 220
15 iso_pu_bacteria 2643221606 2644045507 220
16 iso_pu_bacteria 2643221671 2644392867 220
17 iso_pu_bacteria 2675903129 2676746112 220
18 iso_pu_bacteria 2744054900 2746089896 220
19 iso_pu_bacteria 2744054901 2746098137 220
20 iso_pu_bacteria 2818991452 2819636498 220
21 iso_pu_bacteria 2842324504 2842332775 220
22 iso_pu_bacteria 2842348783 2842356981 220
23 iso_pu_bacteria 2842454564 2842460759 220
24 iso_pu_bacteria 2863421361 2863424106 220
25 iso_pu_bacteria 2870068957 2870073219 220
26 iso_pu_bacteria 2885270888 2885278073 220
27 iso_pu_bacteria 2902682994 2902687949 220
28 iso_pu_bacteria 2904564687 2904567259 220
29 iso_pu_bacteria 2904571731 2904574304 220
30 iso_pu_bacteria 2928157003 2928158678 220
31 iso_pu_bacteria 2928163908 2928167641 220
32 iso_pu_bacteria 2928170801 2928174559 220
33 iso_pu_bacteria 2928536128 2928540574 220
34 iso_pu_bacteria 2981990288 2981992164 220
35 iso_pu_bacteria 641736154 642417704 220
36 iso_pu_bacteria 8002060224 8002062185 220
37 iso_pu_bacteria 8018845410 8018852558 220
38 iso_pu_bacteria 8020938398 8020942744 220
39 iso_pu_bacteria 8020945358 8020951742 220
40 iso_pu_bacteria 8020953355 8020959063 220
41 iso_pu_bacteria 8021120328 8021121428 220
42 iso_pu_bacteria 8039098773 8039100117 220
43 3300005338 Ga0068868_100580509 Ga0068868_1005805092 221
44 3300005339 Ga0070660_100563357 Ga0070660_1005633572 221
45 3300005344 Ga0070661_100080760 Ga0070661_1000807602 221
46 3300005539 Ga0068853_100004394 Ga0068853_1000043947 221
47 3300005563 Ga0068855_100611148 Ga0068855_1006111482 221
48 3300005614 Ga0068856_100014767 Ga0068856_1000147673 221
49 3300009093 Ga0105240_10026941 Ga0105240_100269414 221
50 3300009174 Ga0105241_10537986 Ga0105241_105379862 221
51 3300025911 Ga0207654_10272466 Ga0207654_102724662 221
52 3300025913 Ga0207695_10029082 Ga0207695_100290822 221
53 3300025919 Ga0207657_10201668 Ga0207657_102016682 221
54 3300025920 Ga0207649_10051407 Ga0207649_100514072 221
55 3300025949 Ga0207667_10078998 Ga0207667_100789983 221
56 3300026041 Ga0207639_10583051 Ga0207639_105830511 221
57 3300026078 Ga0207702_10292270 Ga0207702_102922702 221
58 3300005327 Ga0070658_10000055 Ga0070658_1000005591 222
59 3300005339 Ga0070660_100000528 Ga0070660_1000005285 222
60 3300005435 Ga0070714_100007023 Ga0070714_1000070233 222
61 3300006051 Ga0075364_10065301 Ga0075364_100653012 222
62 3300009176 Ga0105242_10263885 Ga0105242_102638852 222
63 3300014969 Ga0157376_10246174 Ga0157376_102461742 222
64 3300025909 Ga0207705_10001077 Ga0207705_1000107711 222
65 3300025911 Ga0207654_10215808 Ga0207654_102158082 222
66 3300025919 Ga0207657_10001160 Ga0207657_100011609 222
67 3300025929 Ga0207664_10000966 Ga0207664_1000096615 222
68 3300025934 Ga0207686_10068267 Ga0207686_100682672 222
69 3300026035 Ga0207703_10979829 Ga0207703_109798291 222
70 3300026089 Ga0207648_10020229 Ga0207648_100202292 222
71 3300026118 Ga0207675_100425178 Ga0207675_1004251782 222
72 3300026121 Ga0207683_10063880 Ga0207683_100638801 222
73 3300028380 Ga0268265_10459001 Ga0268265_104590012 222
74 3300037418 Ga0395900_0010043 Ga0395900_0010043_3235_3966 222
75 3300037466 Ga0395898_0083168 Ga0395898_0083168_2001_2732 222
76 3300044683 Ga0466965_0329440 Ga0466965_0329440_19_699 222
77 3300046459 Ga0495629_0008470 Ga0495629_0008470_5086_5766 222
78 3300046472 Ga0495580_0131769 Ga0495580_0131769_949_1629 222
79 3300046529 Ga0495652_0029548 Ga0495652_0029548_824_1504 222
80 3300046536 Ga0495587_0017094 Ga0495587_0017094_2095_2775 222
81 3300046543 Ga0495645_0090929 Ga0495645_0090929_229_909 222
82 3300046558 Ga0495633_0000305 Ga0495633_0000305_36687_37367 222
83 3300046615 Ga0495656_0137699 Ga0495656_0137699_428_1108 222
84 3300046689 Ga0495613_0019898 Ga0495613_0019898_1947_2627 222
85 3300047471 Ga0495684_0097931 Ga0495684_0097931_1432_2112 222
86 3300047472 Ga0495686_0000861 Ga0495686_0000861_23229_23909 222
87 3300048913 Ga0496110_0003673 Ga0496110_0003673_4850_5533 222
88 3300048929 Ga0496126_0004413 Ga0496126_0004413_13928_14608 222
89 3300049823 Ga0501044_0492331 Ga0501044_0492331_50_730 222
90 3300050005 Ga0501284_03672 Ga0501284_03672_167_847 222
91 3300050491 nmdc:mga00v17_68152_c1 nmdc:mga00v17_68152_c1_253_933 222
92 3300053077 Ga0495601_0060041 Ga0495601_0060041_1121_1801 222
93 3300053084 Ga0495595_0183207 Ga0495595_0183207_81_761 222
94 3300053085 Ga0495619_0033882 Ga0495619_0033882_643_1323 222
95 3300053087 Ga0500643_008874 Ga0500643_008874_551_1231 222
96 3300053096 Ga0500641_0000125 Ga0500641_0000125_6527_7207 222
97 3300053156 Ga0500622_0025249 Ga0500622_0025249_56_736 222
98 3300001904 JGI24736J21556_1019791 JGI24736J21556_10197912 223
99 3300001979 JGI24740J21852_10015655 JGI24740J21852_100156553 223
100 3300001979 JGI24740J21852_10055397 JGI24740J21852_100553971 223
101 3300001989 JGI24739J22299_10009167 JGI24739J22299_100091674 223
102 3300001989 JGI24739J22299_10011951 JGI24739J22299_100119513 223
103 3300001989 JGI24739J22299_10017615 JGI24739J22299_100176152 223
104 3300001989 JGI24739J22299_10028812 JGI24739J22299_100288123 223
105 3300001989 JGI24739J22299_10034258 JGI24739J22299_100342582 223
106 3300001989 JGI24739J22299_10056136 JGI24739J22299_100561362 223
107 3300001990 JGI24737J22298_10001498 JGI24737J22298_100014986 223
108 3300001990 JGI24737J22298_10007618 JGI24737J22298_100076183 223
109 3300001990 JGI24737J22298_10033516 JGI24737J22298_100335163 223
110 3300001990 JGI24737J22298_10062472 JGI24737J22298_100624722 223
111 3300002067 JGI24735J21928_10000192 JGI24735J21928_1000019223 223
112 3300002067 JGI24735J21928_10002707 JGI24735J21928_100027074 223
113 3300002067 JGI24735J21928_10019771 JGI24735J21928_100197713 223
114 3300002067 JGI24735J21928_10024506 JGI24735J21928_100245062 223
115 3300002067 JGI24735J21928_10047776 JGI24735J21928_100477762 223
116 3300002067 JGI24735J21928_10050064 JGI24735J21928_100500642 223
117 3300002070 JGI24750J21931_1000069 JGI24750J21931_100006912 223
118 3300002074 JGI24748J21848_1000066 JGI24748J21848_100006623 223
119 3300002075 JGI24738J21930_10003996 JGI24738J21930_100039964 223
120 3300002075 JGI24738J21930_10047337 JGI24738J21930_100473372 223
121 3300002076 JGI24749J21850_1001470 JGI24749J21850_10014702 223
122 3300002077 JGI24744J21845_10011969 JGI24744J21845_100119691 223
123 3300002239 JGI24034J26672_10000015 JGI24034J26672_1000001523 223
124 3300002244 JGI24742J22300_10013507 JGI24742J22300_100135072 223
125 3300002459 JGI24751J29686_10000081 JGI24751J29686_1000008170 223
126 3300002459 JGI24751J29686_10018967 JGI24751J29686_100189671 223
127 3300002741 JGI25157J39369_1015763 JGI25157J39369_10157631 223
128 3300003187 JGI25151J46595_10000729 JGI25151J46595_1000072925 223
129 3300003214 JGI25165J46597_1000210 JGI25165J46597_100021010 223
130 3300003316 rootH1_10011990 rootH1_100119902 223
131 3300003320 rootH2_10096727 rootH2_100967272 223
132 3300003320 rootH2_10244599 rootH2_102445991 223
133 3300003323 rootH1_10034821 rootH1_100348211 223
134 3300003323 rootH1_10106373 rootH1_101063735 223
135 3300003758 Ga0055532_1000295 Ga0055532_100029510 223
136 3300003758 Ga0055532_1000337 Ga0055532_10003379 223
137 3300003758 Ga0055532_1000383 Ga0055532_10003839 223
138 3300003760 Ga0055527_1000104 Ga0055527_100010432 223
139 3300003760 Ga0055527_1000154 Ga0055527_100015426 223
140 3300003761 Ga0055535_1000218 Ga0055535_100021832 223
141 3300003761 Ga0055535_1000320 Ga0055535_100032026 223
142 3300003762 Ga0055542_1000153 Ga0055542_100015344 223
143 3300003762 Ga0055542_1017039 Ga0055542_10170392 223
144 3300003763 Ga0055529_1000176 Ga0055529_100017657 223
145 3300003763 Ga0055529_1005697 Ga0055529_10056972 223
146 3300003773 Ga0055537_1000955 Ga0055537_100095513 223
147 3300003775 Ga0055524_1003436 Ga0055524_10034367 223
148 3300003784 Ga0055534_1005791 Ga0055534_10057911 223
149 3300003790 Ga0055528_1001345 Ga0055528_100134511 223
150 3300003794 Ga0055531_10004535 Ga0055531_100045358 223
151 3300003856 Ga0058692_1015940 Ga0058692_10159402 223
152 3300005262 Ga0065165_1000554 Ga0065165_100055428 223
153 3300005295 Ga0065707_10119358 Ga0065707_101193582 223
154 3300005295 Ga0065707_10141752 Ga0065707_101417523 223
155 3300005295 Ga0065707_10291499 Ga0065707_102914991 223
156 3300005327 Ga0070658_10002322 Ga0070658_1000232213 223
157 3300005327 Ga0070658_10062126 Ga0070658_100621263 223
158 3300005327 Ga0070658_10063942 Ga0070658_100639423 223
159 3300005328 Ga0070676_10008260 Ga0070676_100082603 223
160 3300005328 Ga0070676_10145143 Ga0070676_101451432 223
161 3300005330 Ga0070690_100000025 Ga0070690_10000002522 223
162 3300005331 Ga0070670_100000003 Ga0070670_100000003128 223
163 3300005331 Ga0070670_100641275 Ga0070670_1006412752 223
164 3300005333 Ga0070677_10044357 Ga0070677_100443572 223
165 3300005334 Ga0068869_100000341 Ga0068869_10000034125 223
166 3300005335 Ga0070666_10000015 Ga0070666_10000015205 223
167 3300005338 Ga0068868_100003972 Ga0068868_1000039729 223
168 3300005339 Ga0070660_100000808 Ga0070660_1000008085 223
169 3300005339 Ga0070660_100002294 Ga0070660_1000022949 223
170 3300005339 Ga0070660_100014948 Ga0070660_1000149486 223
171 3300005339 Ga0070660_100383762 Ga0070660_1003837621 223
172 3300005339 Ga0070660_100482566 Ga0070660_1004825662 223
173 3300005339 Ga0070660_100493352 Ga0070660_1004933522 223
174 3300005340 Ga0070689_100044006 Ga0070689_1000440064 223
175 3300005344 Ga0070661_100020324 Ga0070661_1000203244 223
176 3300005344 Ga0070661_100116020 Ga0070661_1001160204 223
177 3300005347 Ga0070668_100001896 Ga0070668_1000018969 223
178 3300005347 Ga0070668_100017496 Ga0070668_1000174961 223
179 3300005347 Ga0070668_100029444 Ga0070668_1000294444 223
180 3300005347 Ga0070668_100098141 Ga0070668_1000981412 223
181 3300005353 Ga0070669_100000044 Ga0070669_10000004452 223
182 3300005353 Ga0070669_100000059 Ga0070669_100000059105 223
183 3300005353 Ga0070669_100018483 Ga0070669_1000184835 223
184 3300005355 Ga0070671_100000769 Ga0070671_10000076916 223
185 3300005355 Ga0070671_100019548 Ga0070671_1000195484 223
186 3300005355 Ga0070671_100034287 Ga0070671_1000342874 223
187 3300005356 Ga0070674_100034464 Ga0070674_1000344643 223
188 3300005356 Ga0070674_100116594 Ga0070674_1001165942 223
189 3300005364 Ga0070673_100000014 Ga0070673_100000014126 223
190 3300005365 Ga0070688_100001673 Ga0070688_10000167310 223
191 3300005366 Ga0070659_100000012 Ga0070659_100000012104 223
192 3300005366 Ga0070659_100033494 Ga0070659_1000334943 223
193 3300005366 Ga0070659_100736610 Ga0070659_1007366102 223
194 3300005367 Ga0070667_100000122 Ga0070667_10000012232 223
195 3300005367 Ga0070667_100021344 Ga0070667_1000213442 223
196 3300005367 Ga0070667_100113228 Ga0070667_1001132283 223
197 3300005455 Ga0070663_100002534 Ga0070663_1000025343 223
198 3300005455 Ga0070663_100007613 Ga0070663_1000076135 223
199 3300005455 Ga0070663_100083165 Ga0070663_1000831652 223
200 3300005456 Ga0070678_100025451 Ga0070678_1000254513 223
201 3300005457 Ga0070662_100011712 Ga0070662_1000117123 223
202 3300005457 Ga0070662_100057319 Ga0070662_1000573194 223
203 3300005457 Ga0070662_100078818 Ga0070662_1000788182 223
204 3300005457 Ga0070662_100340661 Ga0070662_1003406612 223
205 3300005457 Ga0070662_100661740 Ga0070662_1006617401 223
206 3300005459 Ga0068867_100000002 Ga0068867_10000000210 223
207 3300005466 Ga0070685_10000297 Ga0070685_1000029722 223
208 3300005539 Ga0068853_100012544 Ga0068853_1000125443 223
209 3300005539 Ga0068853_100108371 Ga0068853_1001083712 223
210 3300005543 Ga0070672_100161678 Ga0070672_1001616782 223
211 3300005544 Ga0070686_100000006 Ga0070686_10000000648 223
212 3300005547 Ga0070693_100698981 Ga0070693_1006989811 223
213 3300005548 Ga0070665_100000217 Ga0070665_10000021791 223
214 3300005548 Ga0070665_100577392 Ga0070665_1005773922 223
215 3300005563 Ga0068855_100000504 Ga0068855_10000050445 223
216 3300005563 Ga0068855_100023939 Ga0068855_1000239393 223
217 3300005563 Ga0068855_100141969 Ga0068855_1001419692 223
218 3300005563 Ga0068855_100150611 Ga0068855_1001506113 223
219 3300005564 Ga0070664_100118181 Ga0070664_1001181812 223
220 3300005577 Ga0068857_100056055 Ga0068857_1000560552 223
221 3300005577 Ga0068857_100106634 Ga0068857_1001066343 223
222 3300005577 Ga0068857_100682101 Ga0068857_1006821012 223
223 3300005577 Ga0068857_100744091 Ga0068857_1007440911 223
224 3300005578 Ga0068854_100000118 Ga0068854_10000011818 223
225 3300005578 Ga0068854_100003080 Ga0068854_1000030807 223
226 3300005578 Ga0068854_100213736 Ga0068854_1002137362 223
227 3300005614 Ga0068856_100006838 Ga0068856_10000683810 223
228 3300005614 Ga0068856_100068422 Ga0068856_1000684222 223
229 3300005614 Ga0068856_100078523 Ga0068856_1000785232 223
230 3300005616 Ga0068852_100000052 Ga0068852_10000005254 223
231 3300005616 Ga0068852_100040513 Ga0068852_1000405134 223
232 3300005616 Ga0068852_100484646 Ga0068852_1004846462 223
233 3300005616 Ga0068852_100532832 Ga0068852_1005328322 223
234 3300005617 Ga0068859_100017939 Ga0068859_1000179395 223
235 3300005617 Ga0068859_100086474 Ga0068859_1000864744 223
236 3300005618 Ga0068864_100000158 Ga0068864_10000015872 223
237 3300005618 Ga0068864_100010503 Ga0068864_1000105035 223
238 3300005618 Ga0068864_100012183 Ga0068864_1000121838 223
239 3300005719 Ga0068861_100012847 Ga0068861_1000128474 223
240 3300005834 Ga0068851_10281296 Ga0068851_102812962 223
241 3300005841 Ga0068863_100000108 Ga0068863_10000010878 223
242 3300005841 Ga0068863_100000822 Ga0068863_1000008223 223
243 3300005842 Ga0068858_100000582 Ga0068858_10000058218 223
244 3300005842 Ga0068858_100107169 Ga0068858_1001071692 223
245 3300005843 Ga0068860_100000027 Ga0068860_100000027150 223
246 3300005843 Ga0068860_100000050 Ga0068860_100000050206 223
247 3300005843 Ga0068860_100000152 Ga0068860_10000015282 223
248 3300005843 Ga0068860_100064295 Ga0068860_1000642952 223
249 3300005844 Ga0068862_100000001 Ga0068862_100000001476 223
250 3300005844 Ga0068862_100000062 Ga0068862_10000006223 223
251 3300005844 Ga0068862_100012059 Ga0068862_1000120595 223
252 3300005844 Ga0068862_100087844 Ga0068862_1000878442 223
253 3300006038 Ga0075365_10067723 Ga0075365_100677232 223
254 3300006042 Ga0075368_10126319 Ga0075368_101263191 223
255 3300006042 Ga0075368_10142748 Ga0075368_101427481 223
256 3300006048 Ga0075363_100104477 Ga0075363_1001044772 223
257 3300006051 Ga0075364_10030582 Ga0075364_100305822 223
258 3300006051 Ga0075364_10034355 Ga0075364_100343552 223
259 3300006178 Ga0075367_10041669 Ga0075367_100416692 223
260 3300006186 Ga0075369_10016731 Ga0075369_100167312 223
261 3300006186 Ga0075369_10048667 Ga0075369_100486673 223
262 3300006195 Ga0075366_10012947 Ga0075366_100129473 223
263 3300006195 Ga0075366_10098496 Ga0075366_100984962 223
264 3300006195 Ga0075366_10182120 Ga0075366_101821202 223
265 3300006237 Ga0097621_100079644 Ga0097621_1000796442 223
266 3300006353 Ga0075370_10016652 Ga0075370_100166523 223
267 3300006881 Ga0068865_100001468 Ga0068865_10000146810 223
268 3300006931 Ga0097620_100017941 Ga0097620_1000179415 223
269 3300006931 Ga0097620_100086477 Ga0097620_1000864772 223
270 3300009092 Ga0105250_10021233 Ga0105250_100212332 223
271 3300009092 Ga0105250_10037938 Ga0105250_100379382 223
272 3300009093 Ga0105240_10001781 Ga0105240_1000178132 223
273 3300009093 Ga0105240_10029050 Ga0105240_100290501 223
274 3300009093 Ga0105240_10037814 Ga0105240_100378146 223
275 3300009093 Ga0105240_10100701 Ga0105240_101007013 223
276 3300009093 Ga0105240_10108847 Ga0105240_101088472 223
277 3300009093 Ga0105240_10491836 Ga0105240_104918362 223
278 3300009098 Ga0105245_10021319 Ga0105245_100213193 223
279 3300009098 Ga0105245_10738422 Ga0105245_107384221 223
280 3300009101 Ga0105247_10004563 Ga0105247_100045635 223
281 3300009148 Ga0105243_10004912 Ga0105243_100049123 223
282 3300009148 Ga0105243_10069073 Ga0105243_100690732 223
283 3300009174 Ga0105241_10100053 Ga0105241_101000533 223
284 3300009176 Ga0105242_10032014 Ga0105242_100320143 223
285 3300009176 Ga0105242_10246115 Ga0105242_102461152 223
286 3300009177 Ga0105248_10000287 Ga0105248_1000028713 223
287 3300009545 Ga0105237_10010942 Ga0105237_100109421 223
288 3300009545 Ga0105237_10014511 Ga0105237_100145114 223
289 3300009545 Ga0105237_10251237 Ga0105237_102512372 223
290 3300009545 Ga0105237_10764331 Ga0105237_107643311 223
291 3300009551 Ga0105238_10025625 Ga0105238_100256256 223
292 3300009551 Ga0105238_10032172 Ga0105238_100321726 223
293 3300009551 Ga0105238_10093566 Ga0105238_100935663 223
294 3300009551 Ga0105238_10265730 Ga0105238_102657302 223
295 3300009553 Ga0105249_10000034 Ga0105249_1000003421 223
296 3300009553 Ga0105249_10022159 Ga0105249_100221595 223
297 3300009553 Ga0105249_10280644 Ga0105249_102806442 223
298 3300010375 Ga0105239_10035096 Ga0105239_100350963 223
299 3300010375 Ga0105239_10039763 Ga0105239_100397635 223
300 3300010375 Ga0105239_10535060 Ga0105239_105350602 223
301 3300011119 Ga0105246_10019158 Ga0105246_100191582 223
302 3300011119 Ga0105246_10372685 Ga0105246_103726852 223
303 3300013100 Ga0157373_10033893 Ga0157373_100338933 223
304 3300013104 Ga0157370_10000417 Ga0157370_1000041752 223
305 3300013104 Ga0157370_10034274 Ga0157370_100342742 223
306 3300013104 Ga0157370_10114459 Ga0157370_101144592 223
307 3300013105 Ga0157369_10028725 Ga0157369_100287255 223
308 3300013105 Ga0157369_10054005 Ga0157369_100540052 223
309 3300013105 Ga0157369_10067052 Ga0157369_100670523 223
310 3300013105 Ga0157369_10067333 Ga0157369_100673334 223
311 3300013296 Ga0157374_10036569 Ga0157374_100365693 223
312 3300013296 Ga0157374_10041240 Ga0157374_100412403 223
313 3300013297 Ga0157378_10038203 Ga0157378_100382032 223
314 3300013306 Ga0163162_10491301 Ga0163162_104913012 223
315 3300013306 Ga0163162_10536804 Ga0163162_105368042 223
316 3300013306 Ga0163162_11062791 Ga0163162_110627911 223
317 3300013307 Ga0157372_10017620 Ga0157372_100176206 223
318 3300013307 Ga0157372_10047910 Ga0157372_100479103 223
319 3300013307 Ga0157372_10056034 Ga0157372_100560343 223
320 3300013307 Ga0157372_10565479 Ga0157372_105654792 223
321 3300013307 Ga0157372_10631355 Ga0157372_106313552 223
322 3300013307 Ga0157372_11168844 Ga0157372_111688442 223
323 3300013308 Ga0157375_10011625 Ga0157375_100116256 223
324 3300014325 Ga0163163_10012276 Ga0163163_100122769 223
325 3300014325 Ga0163163_10065573 Ga0163163_100655733 223
326 3300014326 Ga0157380_10000755 Ga0157380_100007554 223
327 3300014326 Ga0157380_10117710 Ga0157380_101177102 223
328 3300014745 Ga0157377_10052178 Ga0157377_100521782 223
329 3300014968 Ga0157379_10070753 Ga0157379_100707534 223
330 3300014969 Ga0157376_10000337 Ga0157376_1000033710 223
331 3300015262 Ga0182007_10001530 Ga0182007_100015309 223
332 3300017792 Ga0163161_10000051 Ga0163161_10000051131 223
333 3300025225 Ga0209566_100245 Ga0209566_10024544 223
334 3300025226 Ga0209674_102389 Ga0209674_1023891 223
335 3300025228 Ga0209672_100032 Ga0209672_10003282 223
336 3300025228 Ga0209672_100042 Ga0209672_100042138 223
337 3300025229 Ga0209147_100012 Ga0209147_100012212 223
338 3300025229 Ga0209147_100046 Ga0209147_100046192 223
339 3300025229 Ga0209147_100052 Ga0209147_100052138 223
340 3300025231 Ga0207427_101415 Ga0207427_1014157 223
341 3300025242 Ga0209258_100030 Ga0209258_100030209 223
342 3300025242 Ga0209258_100073 Ga0209258_100073138 223
343 3300025250 Ga0209026_1000525 Ga0209026_10005253 223
344 3300025250 Ga0209026_1000593 Ga0209026_100059324 223
345 3300025250 Ga0209026_1002460 Ga0209026_10024607 223
346 3300025254 Ga0209148_1000022 Ga0209148_1000022415 223
347 3300025254 Ga0209148_1000146 Ga0209148_100014636 223
348 3300025254 Ga0209148_1000807 Ga0209148_10008072 223
349 3300025254 Ga0209148_1002629 Ga0209148_10026295 223
350 3300025261 Ga0209233_1000003 Ga0209233_1000003100 223
351 3300025263 Ga0209565_1000156 Ga0209565_100015628 223
352 3300025263 Ga0209565_1001983 Ga0209565_10019832 223
353 3300025263 Ga0209565_1007365 Ga0209565_10073653 223
354 3300025272 Ga0209455_1000024 Ga0209455_1000024208 223
355 3300025272 Ga0209455_1000324 Ga0209455_100032425 223
356 3300025272 Ga0209455_1001136 Ga0209455_10011364 223
357 3300025273 Ga0209673_1000021 Ga0209673_1000021386 223
358 3300025291 Ga0209675_1002385 Ga0209675_10023855 223
359 3300025291 Ga0209675_1004411 Ga0209675_10044112 223
360 3300025294 Ga0209025_1002038 Ga0209025_10020386 223
361 3300025294 Ga0209025_1002325 Ga0209025_100232523 223
362 3300025295 Ga0209564_1000779 Ga0209564_100077921 223
363 3300025295 Ga0209564_1001967 Ga0209564_10019678 223
364 3300025297 Ga0209758_1001451 Ga0209758_10014516 223
365 3300025298 Ga0209050_1000245 Ga0209050_100024555 223
366 3300025299 Ga0209256_1000486 Ga0209256_100048657 223
367 3300025299 Ga0209256_1001034 Ga0209256_10010349 223
368 3300025303 Ga0209051_1049422 Ga0209051_10494222 223
369 3300025304 Ga0209257_1002240 Ga0209257_100224011 223
370 3300025315 Ga0207697_10083898 Ga0207697_100838982 223
371 3300025321 Ga0207656_10003640 Ga0207656_100036405 223
372 3300025321 Ga0207656_10249528 Ga0207656_102495281 223
373 3300025711 Ga0207696_1044986 Ga0207696_10449862 223
374 3300025711 Ga0207696_1059561 Ga0207696_10595612 223
375 3300025901 Ga0207688_10144551 Ga0207688_101445512 223
376 3300025903 Ga0207680_10000007 Ga0207680_10000007425 223
377 3300025904 Ga0207647_10001490 Ga0207647_1000149013 223
378 3300025904 Ga0207647_10002206 Ga0207647_1000220612 223
379 3300025904 Ga0207647_10008343 Ga0207647_100083434 223
380 3300025904 Ga0207647_10012534 Ga0207647_100125343 223
381 3300025904 Ga0207647_10016981 Ga0207647_100169814 223
382 3300025904 Ga0207647_10123136 Ga0207647_101231362 223
383 3300025904 Ga0207647_10126392 Ga0207647_101263922 223
384 3300025904 Ga0207647_10136430 Ga0207647_101364302 223
385 3300025904 Ga0207647_10356645 Ga0207647_103566451 223
386 3300025907 Ga0207645_10014651 Ga0207645_100146516 223
387 3300025909 Ga0207705_10000025 Ga0207705_10000025134 223
388 3300025909 Ga0207705_10003820 Ga0207705_100038203 223
389 3300025909 Ga0207705_10151565 Ga0207705_101515651 223
390 3300025911 Ga0207654_10004007 Ga0207654_100040074 223
391 3300025911 Ga0207654_10021492 Ga0207654_100214924 223
392 3300025913 Ga0207695_10001076 Ga0207695_1000107641 223
393 3300025913 Ga0207695_10006157 Ga0207695_100061575 223
394 3300025913 Ga0207695_10037531 Ga0207695_100375313 223
395 3300025913 Ga0207695_10081454 Ga0207695_100814542 223
396 3300025913 Ga0207695_10150044 Ga0207695_101500442 223
397 3300025913 Ga0207695_10360639 Ga0207695_103606391 223
398 3300025914 Ga0207671_10000658 Ga0207671_1000065847 223
399 3300025914 Ga0207671_10001304 Ga0207671_1000130411 223
400 3300025914 Ga0207671_10067494 Ga0207671_100674943 223
401 3300025914 Ga0207671_10114499 Ga0207671_101144992 223
402 3300025914 Ga0207671_10271865 Ga0207671_102718652 223
403 3300025919 Ga0207657_10000013 Ga0207657_1000001348 223
404 3300025919 Ga0207657_10001846 Ga0207657_100018464 223
405 3300025919 Ga0207657_10018891 Ga0207657_100188914 223
406 3300025919 Ga0207657_10023265 Ga0207657_100232653 223
407 3300025920 Ga0207649_10133213 Ga0207649_101332132 223
408 3300025920 Ga0207649_10163182 Ga0207649_101631821 223
409 3300025923 Ga0207681_10000041 Ga0207681_1000004179 223
410 3300025923 Ga0207681_10000089 Ga0207681_1000008933 223
411 3300025924 Ga0207694_10001347 Ga0207694_1000134718 223
412 3300025924 Ga0207694_10014825 Ga0207694_100148253 223
413 3300025925 Ga0207650_10000004 Ga0207650_10000004125 223
414 3300025925 Ga0207650_10613215 Ga0207650_106132152 223
415 3300025926 Ga0207659_10082336 Ga0207659_100823362 223
416 3300025931 Ga0207644_10033388 Ga0207644_100333882 223
417 3300025931 Ga0207644_10117783 Ga0207644_101177832 223
418 3300025931 Ga0207644_10167615 Ga0207644_101676152 223
419 3300025932 Ga0207690_10000107 Ga0207690_1000010749 223
420 3300025932 Ga0207690_10134778 Ga0207690_101347782 223
421 3300025932 Ga0207690_10352367 Ga0207690_103523672 223
422 3300025932 Ga0207690_10795736 Ga0207690_107957361 223
423 3300025933 Ga0207706_10007212 Ga0207706_1000721213 223
424 3300025933 Ga0207706_10024340 Ga0207706_100243403 223
425 3300025933 Ga0207706_10027727 Ga0207706_100277274 223
426 3300025933 Ga0207706_10070121 Ga0207706_100701212 223
427 3300025933 Ga0207706_10158944 Ga0207706_101589443 223
428 3300025933 Ga0207706_10352695 Ga0207706_103526952 223
429 3300025934 Ga0207686_10015986 Ga0207686_100159863 223
430 3300025934 Ga0207686_10289287 Ga0207686_102892872 223
431 3300025935 Ga0207709_10000221 Ga0207709_1000022168 223
432 3300025935 Ga0207709_10499181 Ga0207709_104991812 223
433 3300025936 Ga0207670_10106950 Ga0207670_101069502 223
434 3300025937 Ga0207669_10017310 Ga0207669_100173104 223
435 3300025937 Ga0207669_10019730 Ga0207669_100197303 223
436 3300025937 Ga0207669_10058530 Ga0207669_100585302 223
437 3300025938 Ga0207704_10000072 Ga0207704_1000007210 223
438 3300025938 Ga0207704_10586284 Ga0207704_105862842 223
439 3300025941 Ga0207711_10000658 Ga0207711_1000065830 223
440 3300025941 Ga0207711_10019349 Ga0207711_100193497 223
441 3300025941 Ga0207711_10038559 Ga0207711_100385592 223
442 3300025941 Ga0207711_10053973 Ga0207711_100539732 223
443 3300025942 Ga0207689_10000890 Ga0207689_1000089025 223
444 3300025945 Ga0207679_10577545 Ga0207679_105775452 223
445 3300025949 Ga0207667_10000017 Ga0207667_100000179 223
446 3300025949 Ga0207667_10004684 Ga0207667_1000468415 223
447 3300025949 Ga0207667_10007685 Ga0207667_1000768512 223
448 3300025949 Ga0207667_10026817 Ga0207667_100268173 223
449 3300025949 Ga0207667_10064882 Ga0207667_100648825 223
450 3300025949 Ga0207667_10073584 Ga0207667_100735844 223
451 3300025949 Ga0207667_10325035 Ga0207667_103250353 223
452 3300025960 Ga0207651_10000004 Ga0207651_1000000410 223
453 3300025961 Ga0207712_10000004 Ga0207712_10000004413 223
454 3300025961 Ga0207712_10014752 Ga0207712_100147525 223
455 3300025972 Ga0207668_10005056 Ga0207668_100050565 223
456 3300025972 Ga0207668_10011837 Ga0207668_100118373 223
457 3300025972 Ga0207668_10020402 Ga0207668_100204022 223
458 3300025972 Ga0207668_10034517 Ga0207668_100345172 223
459 3300025972 Ga0207668_10163054 Ga0207668_101630542 223
460 3300025981 Ga0207640_10000085 Ga0207640_1000008527 223
461 3300025981 Ga0207640_10150829 Ga0207640_101508293 223
462 3300025981 Ga0207640_10562878 Ga0207640_105628782 223
463 3300025986 Ga0207658_10000092 Ga0207658_1000009271 223
464 3300025986 Ga0207658_10000921 Ga0207658_100009218 223
465 3300025986 Ga0207658_10010969 Ga0207658_100109696 223
466 3300026023 Ga0207677_10000138 Ga0207677_1000013859 223
467 3300026035 Ga0207703_10001141 Ga0207703_1000114121 223
468 3300026041 Ga0207639_10008807 Ga0207639_100088076 223
469 3300026041 Ga0207639_10075564 Ga0207639_100755642 223
470 3300026041 Ga0207639_10089269 Ga0207639_100892692 223
471 3300026041 Ga0207639_10881638 Ga0207639_108816381 223
472 3300026067 Ga0207678_10006932 Ga0207678_100069324 223
473 3300026067 Ga0207678_10024856 Ga0207678_100248563 223
474 3300026067 Ga0207678_10056282 Ga0207678_100562823 223
475 3300026067 Ga0207678_10079999 Ga0207678_100799993 223
476 3300026078 Ga0207702_10007061 Ga0207702_100070618 223
477 3300026078 Ga0207702_10007774 Ga0207702_100077744 223
478 3300026078 Ga0207702_10038800 Ga0207702_100388003 223
479 3300026078 Ga0207702_10120006 Ga0207702_101200062 223
480 3300026088 Ga0207641_10000428 Ga0207641_1000042831 223
481 3300026088 Ga0207641_10000580 Ga0207641_1000058028 223
482 3300026088 Ga0207641_10009974 Ga0207641_100099747 223
483 3300026089 Ga0207648_10000003 Ga0207648_10000003279 223
484 3300026095 Ga0207676_10000006 Ga0207676_10000006585 223
485 3300026095 Ga0207676_10007870 Ga0207676_100078705 223
486 3300026095 Ga0207676_10008879 Ga0207676_100088793 223
487 3300026116 Ga0207674_10028673 Ga0207674_100286733 223
488 3300026116 Ga0207674_10038526 Ga0207674_100385262 223
489 3300026118 Ga0207675_100000309 Ga0207675_10000030949 223
490 3300026118 Ga0207675_100000449 Ga0207675_10000044940 223
491 3300026121 Ga0207683_10036983 Ga0207683_100369832 223
492 3300026142 Ga0207698_10000198 Ga0207698_1000019829 223
493 3300026142 Ga0207698_10082607 Ga0207698_100826073 223
494 3300026142 Ga0207698_10873425 Ga0207698_108734252 223
495 3300027312 Ga0209371_1000850 Ga0209371_100085022 223
496 3300027866 Ga0209813_10000078 Ga0209813_1000007837 223
497 3300028379 Ga0268266_10000225 Ga0268266_1000022522 223
498 3300028379 Ga0268266_10116000 Ga0268266_101160003 223
499 3300028379 Ga0268266_10493023 Ga0268266_104930232 223
500 3300028380 Ga0268265_10000001 Ga0268265_10000001560 223
501 3300028380 Ga0268265_10000086 Ga0268265_10000086121 223
502 3300028380 Ga0268265_10053268 Ga0268265_100532682 223
503 3300028380 Ga0268265_10068436 Ga0268265_100684362 223
504 3300028381 Ga0268264_10000003 Ga0268264_10000003427 223
505 3300028381 Ga0268264_10000014 Ga0268264_10000014438 223
506 3300028381 Ga0268264_10000111 Ga0268264_1000011167 223
507 3300030500 Ga0268256_1000711 Ga0268256_100071122 223
508 3300031239 Ga0265328_10000259 Ga0265328_100002594 223
509 3300031239 Ga0265328_10003790 Ga0265328_100037903 223
510 3300031239 Ga0265328_10004540 Ga0265328_100045405 223
511 3300031250 Ga0265331_10000026 Ga0265331_1000002675 223
512 3300031251 Ga0265327_10016714 Ga0265327_100167143 223
513 3300031456 Ga0307513_10049167 Ga0307513_100491672 223
514 3300031456 Ga0307513_10070975 Ga0307513_100709752 223
515 3300031731 Ga0307405_10155226 Ga0307405_101552262 223
516 3300031911 Ga0307412_10001980 Ga0307412_100019808 223
517 3300031911 Ga0307412_10081410 Ga0307412_100814103 223
518 3300032005 Ga0307411_10051058 Ga0307411_100510582 223
519 3300033180 Ga0307510_10099793 Ga0307510_100997932 223
520 3300035112 Ga0373932_0006287 Ga0373932_0006287_304_975 223
521 3300037312 Ga0395899_0002611 Ga0395899_0002611_4305_4976 223
522 3300037418 Ga0395900_0032290 Ga0395900_0032290_3976_4650 223
523 3300037418 Ga0395900_0418911 Ga0395900_0418911_403_1074 223
524 3300037466 Ga0395898_0402221 Ga0395898_0402221_215_898 223
525 3300037471 Ga0395905_0091569 Ga0395905_0091569_2148_2819 223
526 3300037471 Ga0395905_0113453 Ga0395905_0113453_1268_1939 223
527 3300037471 Ga0395905_0192495 Ga0395905_0192495_407_1081 223
528 3300041459 Ga0451800_1536917 Ga0451800_1536917_23_694 223
529 3300041460 Ga0451802_0647442 Ga0451802_0647442_493_1164 223
530 3300041512 Ga0451853_1688911 Ga0451853_1688911_44_727 223
531 3300042005 Ga0439448_0000682 Ga0439448_0000682_1849_2520 223
532 3300042005 Ga0439448_0006111 Ga0439448_0006111_1590_2261 223
533 3300042005 Ga0439448_0007335 Ga0439448_0007335_1301_1972 223
534 3300042012 Ga0439455_0006286 Ga0439455_0006286_521_1192 223
535 3300042157 Ga0439458_0000401 Ga0439458_0000401_2632_3303 223
536 3300042157 Ga0439458_0001321 Ga0439458_0001321_5502_6173 223
537 3300042157 Ga0439458_0005411 Ga0439458_0005411_1115_1801 223
538 3300044658 Ga0466972_0001033 Ga0466972_0001033_2340_3011 223
539 3300044683 Ga0466965_0004366 Ga0466965_0004366_313_984 223
540 3300044684 Ga0466966_0015458 Ga0466966_0015458_4135_4818 223
541 3300044693 Ga0466961_0003630 Ga0466961_0003630_5585_6256 223
542 3300044693 Ga0466961_0151671 Ga0466961_0151671_16_687 223
543 3300044694 Ga0466963_0001012 Ga0466963_0001012_3807_4478 223
544 3300044706 Ga0466964_0034760 Ga0466964_0034760_322_993 223
545 3300044719 Ga0466971_0017725 Ga0466971_0017725_16_687 223
546 3300044735 Ga0466968_0240721 Ga0466968_0240721_47_730 223
547 3300044765 Ga0466970_0006546 Ga0466970_0006546_5004_5675 223
548 3300044842 Ga0466957_0044461 Ga0466957_0044461_1993_2664 223
549 3300044842 Ga0466957_0487446 Ga0466957_0487446_127_798 223
550 3300044901 Ga0466960_0019912 Ga0466960_0019912_74_745 223
551 3300045049 Ga0466959_0003970 Ga0466959_0003970_2482_3153 223
552 3300045976 Ga0466967_0045808 Ga0466967_0045808_2127_2798 223
553 3300045976 Ga0466967_0545258 Ga0466967_0545258_366_1037 223
554 3300046455 Ga0495603_0003196 Ga0495603_0003196_1119_1802 223
555 3300046458 Ga0495591_004493 Ga0495591_004493_4164_4844 223
556 3300046459 Ga0495629_0005720 Ga0495629_0005720_2020_2703 223
557 3300046459 Ga0495629_0263078 Ga0495629_0263078_444_1127 223
558 3300046462 Ga0495651_0004351 Ga0495651_0004351_7497_8177 223
559 3300046463 Ga0495653_0051319 Ga0495653_0051319_1020_1703 223
560 3300046463 Ga0495653_0099301 Ga0495653_0099301_479_1162 223
561 3300046463 Ga0495653_0313275 Ga0495653_0313275_240_923 223
562 3300046471 Ga0495650_0001337 Ga0495650_0001337_17625_18308 223
563 3300046472 Ga0495580_0000090 Ga0495580_0000090_35221_35904 223
564 3300046472 Ga0495580_0000879 Ga0495580_0000879_7627_8310 223
565 3300046472 Ga0495580_0030106 Ga0495580_0030106_2912_3595 223
566 3300046476 Ga0495662_0004557 Ga0495662_0004557_4625_5308 223
567 3300046477 Ga0495664_0004969 Ga0495664_0004969_1109_1792 223
568 3300046477 Ga0495664_0014885 Ga0495664_0014885_2239_2919 223
569 3300046500 Ga0495596_0004191 Ga0495596_0004191_3855_4538 223
570 3300046506 Ga0495583_0106244 Ga0495583_0106244_406_1089 223
571 3300046507 Ga0495606_0000406 Ga0495606_0000406_53864_54538 223
572 3300046507 Ga0495606_0162930 Ga0495606_0162930_303_974 223
573 3300046507 Ga0495606_0187583 Ga0495606_0187583_457_1140 223
574 3300046511 Ga0495608_0005489 Ga0495608_0005489_7489_8172 223
575 3300046514 Ga0495618_0003258 Ga0495618_0003258_3539_4222 223
576 3300046516 Ga0495628_0000937 Ga0495628_0000937_24645_25328 223
577 3300046516 Ga0495628_0081023 Ga0495628_0081023_1292_1972 223
578 3300046517 Ga0495630_0010828 Ga0495630_0010828_5565_6248 223
579 3300046524 Ga0495648_0001922 Ga0495648_0001922_13823_14506 223
580 3300046524 Ga0495648_0038725 Ga0495648_0038725_94_777 223
581 3300046524 Ga0495648_0047499 Ga0495648_0047499_1145_1828 223
582 3300046524 Ga0495648_0049019 Ga0495648_0049019_814_1494 223
583 3300046526 Ga0495666_0003365 Ga0495666_0003365_404_1087 223
584 3300046526 Ga0495666_0013705 Ga0495666_0013705_3334_4014 223
585 3300046529 Ga0495652_0028340 Ga0495652_0028340_4123_4806 223
586 3300046529 Ga0495652_0291941 Ga0495652_0291941_257_940 223
587 3300046531 Ga0495665_0003549 Ga0495665_0003549_812_1495 223
588 3300046533 Ga0495640_0007079 Ga0495640_0007079_5692_6372 223
589 3300046533 Ga0495640_0029402 Ga0495640_0029402_2558_3241 223
590 3300046536 Ga0495587_0005019 Ga0495587_0005019_2186_2866 223
591 3300046543 Ga0495645_0009889 Ga0495645_0009889_5676_6359 223
592 3300046557 Ga0495622_0000183 Ga0495622_0000183_22671_23354 223
593 3300046558 Ga0495633_0119991 Ga0495633_0119991_340_1023 223
594 3300046559 Ga0495667_0037149 Ga0495667_0037149_2322_3002 223
595 3300046616 Ga0495668_0134634 Ga0495668_0134634_574_1254 223
596 3300046642 Ga0495634_0000984 Ga0495634_0000984_1637_2320 223
597 3300046642 Ga0495634_0014129 Ga0495634_0014129_2518_3201 223
598 3300046648 Ga0495611_0032419 Ga0495611_0032419_73_756 223
599 3300046660 Ga0495625_0000158 Ga0495625_0000158_41636_42319 223
600 3300046660 Ga0495625_0097274 Ga0495625_0097274_157_840 223
601 3300046660 Ga0495625_0140417 Ga0495625_0140417_539_1219 223
602 3300046660 Ga0495625_0291575 Ga0495625_0291575_105_788 223
603 3300046663 Ga0495635_0000661 Ga0495635_0000661_16170_16853 223
604 3300046663 Ga0495635_0037463 Ga0495635_0037463_2459_3142 223
605 3300046665 Ga0495661_0015416 Ga0495661_0015416_1674_2357 223
606 3300046665 Ga0495661_0050749 Ga0495661_0050749_1659_2342 223
607 3300046665 Ga0495661_0124485 Ga0495661_0124485_636_1319 223
608 3300046674 Ga0495588_0029525 Ga0495588_0029525_2056_2739 223
609 3300046678 Ga0495599_0004051 Ga0495599_0004051_1491_2174 223
610 3300046678 Ga0495599_0013448 Ga0495599_0013448_2208_2891 223
611 3300046679 Ga0495623_0003736 Ga0495623_0003736_5286_5969 223
612 3300046679 Ga0495623_0030723 Ga0495623_0030723_393_1076 223
613 3300046680 Ga0495646_0004327 Ga0495646_0004327_2811_3491 223
614 3300046680 Ga0495646_0007191 Ga0495646_0007191_6198_6881 223
615 3300046680 Ga0495646_0132342 Ga0495646_0132342_13_696 223
616 3300046689 Ga0495613_0000802 Ga0495613_0000802_23494_24177 223
617 3300046689 Ga0495613_0007363 Ga0495613_0007363_3617_4300 223
618 3300046690 Ga0495624_0007757 Ga0495624_0007757_871_1554 223
619 3300046690 Ga0495624_0046068 Ga0495624_0046068_1459_2142 223
620 3300046692 Ga0495671_0030331 Ga0495671_0030331_1532_2212 223
621 3300046694 Ga0495649_0058788 Ga0495649_0058788_1334_2005 223
622 3300046794 Ga0495589_0019545 Ga0495589_0019545_696_1376 223
623 3300047315 Ga0495581_0003351 Ga0495581_0003351_564_1247 223
624 3300047317 Ga0495604_0023345 Ga0495604_0023345_482_1162 223
625 3300047319 Ga0495674_0033874 Ga0495674_0033874_323_1006 223
626 3300047321 Ga0495676_0038823 Ga0495676_0038823_3097_3780 223
627 3300047322 Ga0495680_0003534 Ga0495680_0003534_14398_15081 223
628 3300047322 Ga0495680_0150011 Ga0495680_0150011_823_1506 223
629 3300047323 Ga0495683_0003122 Ga0495683_0003122_2942_3622 223
630 3300047323 Ga0495683_0061089 Ga0495683_0061089_816_1487 223
631 3300047443 Ga0495687_036902 Ga0495687_036902_987_1658 223
632 3300047446 Ga0495679_000287 Ga0495679_000287_17218_17901 223
633 3300047446 Ga0495679_000344 Ga0495679_000344_27806_28486 223
634 3300047469 Ga0495673_0027977 Ga0495673_0027977_637_1320 223
635 3300047471 Ga0495684_0067812 Ga0495684_0067812_1881_2564 223
636 3300047471 Ga0495684_0137726 Ga0495684_0137726_1105_1788 223
637 3300047472 Ga0495686_0006026 Ga0495686_0006026_1733_2416 223
638 3300047673 Ga0495593_0002076 Ga0495593_0002076_5839_6522 223
639 3300047673 Ga0495593_0006339 Ga0495593_0006339_3542_4222 223
640 3300048088 Ga0495602_0011519 Ga0495602_0011519_814_1497 223
641 3300048088 Ga0495602_0080542 Ga0495602_0080542_1181_1864 223
642 3300048905 Ga0496102_0000100 Ga0496102_0000100_107580_108260 223
643 3300048905 Ga0496102_0017559 Ga0496102_0017559_658_1338 223
644 3300048906 Ga0496103_0000070 Ga0496103_0000070_107561_108241 223
645 3300048906 Ga0496103_0001574 Ga0496103_0001574_4599_5279 223
646 3300048909 Ga0496106_0096133 Ga0496106_0096133_1408_2088 223
647 3300048910 Ga0496107_0044858 Ga0496107_0044858_1815_2495 223
648 3300048919 Ga0496116_0002579 Ga0496116_0002579_5443_6123 223
649 3300048919 Ga0496116_0056365 Ga0496116_0056365_1570_2253 223
650 3300048919 Ga0496116_0123878 Ga0496116_0123878_473_1153 223
651 3300048920 Ga0496117_0000194 Ga0496117_0000194_107580_108260 223
652 3300048920 Ga0496117_0005305 Ga0496117_0005305_8661_9344 223
653 3300048920 Ga0496117_0011492 Ga0496117_0011492_760_1443 223
654 3300048920 Ga0496117_0034784 Ga0496117_0034784_972_1652 223
655 3300048920 Ga0496117_0068079 Ga0496117_0068079_1027_1698 223
656 3300048921 Ga0496118_0000146 Ga0496118_0000146_107580_108260 223
657 3300048921 Ga0496118_0001200 Ga0496118_0001200_25285_25968 223
658 3300048921 Ga0496118_0003430 Ga0496118_0003430_7723_8406 223
659 3300048921 Ga0496118_0004003 Ga0496118_0004003_3682_4353 223
660 3300048921 Ga0496118_0012474 Ga0496118_0012474_3624_4295 223
661 3300048921 Ga0496118_0100272 Ga0496118_0100272_979_1659 223
662 3300048922 Ga0496119_0009849 Ga0496119_0009849_2227_2898 223
663 3300048922 Ga0496119_0012504 Ga0496119_0012504_5513_6193 223
664 3300048923 Ga0496120_0053791 Ga0496120_0053791_1249_1920 223
665 3300048924 Ga0496121_0000822 Ga0496121_0000822_33431_34114 223
666 3300048924 Ga0496121_0003499 Ga0496121_0003499_10719_11402 223
667 3300048924 Ga0496121_0081007 Ga0496121_0081007_887_1567 223
668 3300048924 Ga0496121_0082218 Ga0496121_0082218_936_1607 223
669 3300048924 Ga0496121_0262135 Ga0496121_0262135_318_1001 223
670 3300048925 Ga0496122_0003016 Ga0496122_0003016_15620_16294 223
671 3300048925 Ga0496122_0016579 Ga0496122_0016579_607_1278 223
672 3300048926 Ga0496123_0004726 Ga0496123_0004726_9514_10188 223
673 3300048926 Ga0496123_0016846 Ga0496123_0016846_1106_1777 223
674 3300048927 Ga0496124_0000185 Ga0496124_0000185_15272_15952 223
675 3300048927 Ga0496124_0015091 Ga0496124_0015091_2442_3116 223
676 3300048927 Ga0496124_0076810 Ga0496124_0076810_760_1440 223
677 3300048928 Ga0496125_0008495 Ga0496125_0008495_4517_5188 223
678 3300048928 Ga0496125_0302192 Ga0496125_0302192_223_903 223
679 3300048929 Ga0496126_0001126 Ga0496126_0001126_33513_34196 223
680 3300048986 Ga0466983_0040851 Ga0466983_0040851_238_921 223
681 3300049460 Ga0495682_0035383 Ga0495682_0035383_961_1641 223
682 3300049569 Ga0501032_0037427 Ga0501032_0037427_286_969 223
683 3300049571 Ga0501034_0149154 Ga0501034_0149154_1353_2036 223
684 3300049579 Ga0501043_0018243 Ga0501043_0018243_1316_1999 223
685 3300049580 Ga0501046_0180685 Ga0501046_0180685_772_1455 223
686 3300049581 Ga0501047_0000713 Ga0501047_0000713_17927_18610 223
687 3300049581 Ga0501047_0000876 Ga0501047_0000876_15025_15708 223
688 3300049581 Ga0501047_0213720 Ga0501047_0213720_66_749 223
689 3300049586 Ga0501070_0073604 Ga0501070_0073604_56_739 223
690 3300049588 Ga0501072_0208637 Ga0501072_0208637_851_1534 223
691 3300049679 Ga0501249_000464 Ga0501249_000464_4829_5512 223
692 3300049742 Ga0501080_0002920 Ga0501080_0002920_867_1550 223
693 3300049742 Ga0501080_0548584 Ga0501080_0548584_133_816 223
694 3300049744 Ga0501083_0002714 Ga0501083_0002714_145_828 223
695 3300049823 Ga0501044_0161031 Ga0501044_0161031_1073_1756 223
696 3300050489 nmdc:mga03683_728_c1 nmdc:mga03683_728_c1_854_1537 223
697 3300050489 nmdc:mga03683_906_c1 nmdc:mga03683_906_c1_5676_6356 223
698 3300050490 nmdc:mga03n38_124304_c1 nmdc:mga03n38_124304_c1_280_963 223
699 3300050491 nmdc:mga00v17_186191_c1 nmdc:mga00v17_186191_c1_239_919 223
700 3300050491 nmdc:mga00v17_23619_c1 nmdc:mga00v17_23619_c1_659_1339 223
701 3300050491 nmdc:mga00v17_30823_c1 nmdc:mga00v17_30823_c1_578_1261 223
702 3300050492 nmdc:mga0yw44_13471_c1 nmdc:mga0yw44_13471_c1_352_1035 223
703 3300050493 nmdc:mga0k408_11042_c1 nmdc:mga0k408_11042_c1_285_956 223
704 3300050493 nmdc:mga0k408_201933_c1 nmdc:mga0k408_201933_c1_378_1061 223
705 3300050493 nmdc:mga0k408_89986_c1 nmdc:mga0k408_89986_c1_778_1461 223
706 3300050493 nmdc:mga0k408_98477_c1 nmdc:mga0k408_98477_c1_808_1488 223
707 3300050494 nmdc:mga06z11_9095_c1 nmdc:mga06z11_9095_c1_324_1007 223
708 3300050495 nmdc:mga04h51_127956_c1 nmdc:mga04h51_127956_c1_161_844 223
709 3300050496 nmdc:mga07m45_232748_c1 nmdc:mga07m45_232748_c1_68_748 223
710 3300050496 nmdc:mga07m45_4_c1 nmdc:mga07m45_4_c1_59354_60037 223
711 3300050496 nmdc:mga07m45_58127_c1 nmdc:mga07m45_58127_c1_432_1103 223
712 3300050516 nmdc:mga0sz30_12029_c1 nmdc:mga0sz30_12029_c1_249_929 223
713 3300050516 nmdc:mga0sz30_337_c2 nmdc:mga0sz30_337_c2_14331_15014 223
714 3300053087 Ga0500643_000363 Ga0500643_000363_5560_6243 223
715 3300053087 Ga0500643_004836 Ga0500643_004836_4130_4813 223
716 3300053087 Ga0500643_014441 Ga0500643_014441_1501_2184 223
717 3300053087 Ga0500643_046444 Ga0500643_046444_19_702 223
718 3300053087 Ga0500643_069067 Ga0500643_069067_275_955 223
719 3300053118 Ga0500594_0125797 Ga0500594_0125797_109_789 223
720 3300053121 Ga0500607_000055 Ga0500607_000055_15745_16428 223
721 3300053130 Ga0500642_0001182 Ga0500642_0001182_964_1647 223
722 3300053130 Ga0500642_0016748 Ga0500642_0016748_1143_1823 223
723 3300053136 Ga0500559_0321164 Ga0500559_0321164_13_696 223
724 3300053140 Ga0500573_0000030 Ga0500573_0000030_6084_6767 223
725 3300053153 Ga0500616_0045054 Ga0500616_0045054_540_1211 223
726 3300053161 Ga0500634_0069018 Ga0500634_0069018_152_877 223
727 3300053730 Ga0500645_002352 Ga0500645_002352_2473_3153 223
728 3300053730 Ga0500645_009526 Ga0500645_009526_316_999 223
729 3300053730 Ga0500645_047436 Ga0500645_047436_354_1037 223
730 3300061719 Ga0466962_0003412 Ga0466962_0003412_5256_5927 223
731 3300061719 Ga0466962_0065913 Ga0466962_0065913_1007_1690 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18331

PKHD_C

PKHD-type hydroxylase C-terminal domain

182

224

0.99

PF13640

2OG-FeII_Oxy_3

2OG-Fe(II) oxygenase superfamily

81

176

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0s-assembly1.cif.gz_A nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis 0.9725 180 219
3dkq-assembly1.cif.gz_C-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9567 2 223
3dkq-assembly1.cif.gz_B-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.953 2 223
5nfd-assembly2.cif.gz_B antiparallel monomeric coiled coil of kif21a 0.9319 180 219
3dkq-assembly1.cif.gz_A-2 crystal structure of putative oxygenase (yp_001051978.1) from shewanella baltica os155 at 2.26 a resolution 0.9298 2 223
ID Description Score Start End Superfamily
2c0sA00 Few Secondary Structures;Irregular;MYOD Basic-Helix-Loop-Helix Domain, subunit B;Helix-loop-helix DNA-binding domain 0.9725 180 219 4.10.280.10
af_Q8N4C7_48_170_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9596 185 220 1.20.58.70
af_Q8R1Q0_41_164_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9533 185 220 1.20.58.70
af_A5PMK2_44_240_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9488 185 220 1.20.58.70
3dkqC01 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.9335 1 174 2.60.120.620
ID Description Score Start End GO Terms
AF-J7J7R1-F1-model_v4 deleted 0.9865 2 223
AF-A0A4Q3SUN3-F1-model_v4 PKHD-type hydroxylase 0.9849 1 97 GO:0006879
GO:0006974
GO:0016706
AF-A0A2P0B596-F1-model_v4 PKHD-type hydroxylase 0.9825 2 223 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-F6IKS0-F1-model_v4 Putative hydroxylase 0.9811 77 223 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418
AF-A0A537MUA1-F1-model_v4 Fe2+-dependent dioxygenase 0.9806 40 223 GO:0005506
GO:0006879
GO:0006974
GO:0016706
GO:0031418

Feature Viewer

pLDDT pTM Quality
94.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map