F477856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 325 | 1458 | 321 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100388411|Ga0075428_1003884111 |
| Length | 354 |
| Sequence | VILRRIPRSPVPIRHRRLAPARCAIAAFGASSARKPVWLRLSAFLILIVACGTGWTQSYPAKPVRVIVVFPPGGATDVVSRFVFQKVGEQLNQQFLIDNRAGAAGMLGAAIVAKSPPDGYTIMVYSQTLLNNMHLYQKVAYDALKDFIGITTLTRIVGVLTVHPALPVRTTKDFIALAKTRPGEVLYGSAGIGAYQHFAMSVLANTTGLKMNHVPFKGGAPAVVALMGGEIHAIITPIAEVYPYLKSGRLRPIAVSSDKRTTQFPDIPTIAETVQGYEFTSWFGAFAPAGTPKPIIDRLNAEIKKAMQDADVAAKLSVQVLDPMYMTPEEFAKHLRFEYDRMRDVVKLSGARIE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 201 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 202 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 219 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 222 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 223 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 224 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 306 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 323 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 324 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 325 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.96 |
| Nodule | 0.27 |
| Rhizoplane | 9.05 |
| Rhizosphere | 89.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100388411 | 3300006844 | Bacteria | 1496 |
| 2 | JGI24743J22301_10009365 | 3300001991 | Unclassified | 1734 |
| 3 | JGI24748J21848_1000379 | 3300002074 | Bacteria | 5050 |
| 4 | JGI24749J21850_1003401 | 3300002076 | Unclassified | 2226 |
| 5 | JGI25406J46586_10018950 | 3300003203 | Bacteria | 2816 |
| 6 | JGI25404J52841_10001295 | 3300003659 | Bacteria | 4338 |
| 7 | Ga0065707_10085662 | 3300005295 | Bacteria | 5985 |
| 8 | Ga0070658_10322796 | 3300005327 | Bacteria | 1319 |
| 9 | Ga0070676_10048185 | 3300005328 | Bacteria | 2491 |
| 10 | Ga0070676_10119518 | 3300005328 | Bacteria | 1652 |
| 11 | Ga0070683_100013424 | 3300005329 | Bacteria | 7144 |
| 12 | Ga0070683_100134501 | 3300005329 | Bacteria | 2341 |
| 13 | Ga0070683_100196511 | 3300005329 | Bacteria | 1915 |
| 14 | Ga0070690_100004147 | 3300005330 | Bacteria | 8015 |
| 15 | Ga0070690_100013183 | 3300005330 | Bacteria | 4879 |
| 16 | Ga0070690_100031922 | 3300005330 | Bacteria | 3285 |
| 17 | Ga0070690_100034122 | 3300005330 | Bacteria | 3188 |
| 18 | Ga0070690_100290678 | 3300005330 | Bacteria | 1169 |
| 19 | Ga0070670_100125297 | 3300005331 | Bacteria | 2217 |
| 20 | Ga0070670_100260477 | 3300005331 | Bacteria | 1512 |
| 21 | Ga0070677_10034785 | 3300005333 | Bacteria | 1948 |
| 22 | Ga0068869_100069513 | 3300005334 | Bacteria | 2604 |
| 23 | Ga0068869_100115512 | 3300005334 | Bacteria | 2047 |
| 24 | Ga0068869_100133797 | 3300005334 | Bacteria | 1908 |
| 25 | Ga0070666_10005392 | 3300005335 | Bacteria | 7839 |
| 26 | Ga0070666_10047402 | 3300005335 | Bacteria | 2884 |
| 27 | Ga0070666_10158790 | 3300005335 | Bacteria | 1580 |
| 28 | Ga0070666_10368508 | 3300005335 | Bacteria | 1030 |
| 29 | Ga0070680_100051961 | 3300005336 | Unclassified | 3345 |
| 30 | Ga0070682_100153724 | 3300005337 | Unclassified | 1582 |
| 31 | Ga0070682_100154886 | 3300005337 | Bacteria | 1576 |
| 32 | Ga0070682_100192993 | 3300005337 | Bacteria | 1431 |
| 33 | Ga0068868_100011144 | 3300005338 | Bacteria | 6544 |
| 34 | Ga0068868_100024999 | 3300005338 | Bacteria | 4537 |
| 35 | Ga0068868_100051947 | 3300005338 | Bacteria | 3226 |
| 36 | Ga0070660_100418923 | 3300005339 | Unclassified | 1109 |
| 37 | Ga0070689_100006311 | 3300005340 | Bacteria | 8190 |
| 38 | Ga0070689_100024447 | 3300005340 | Bacteria | 4531 |
| 39 | Ga0070689_100216748 | 3300005340 | Bacteria | 1569 |
| 40 | Ga0070691_10052807 | 3300005341 | Bacteria | 1943 |
| 41 | Ga0070661_100068941 | 3300005344 | Bacteria | 2600 |
| 42 | Ga0070661_100152424 | 3300005344 | Bacteria | 1748 |
| 43 | Ga0070692_10028338 | 3300005345 | Bacteria | 2783 |
| 44 | Ga0070668_100054851 | 3300005347 | Bacteria | 3075 |
| 45 | Ga0070669_100292261 | 3300005353 | Bacteria | 1309 |
| 46 | Ga0070675_100015692 | 3300005354 | Bacteria | 5994 |
| 47 | Ga0070675_100023459 | 3300005354 | Bacteria | 4934 |
| 48 | Ga0070675_100049133 | 3300005354 | Unclassified | 3461 |
| 49 | Ga0070675_100052961 | 3300005354 | Bacteria | 3337 |
| 50 | Ga0070675_100262109 | 3300005354 | Bacteria | 1515 |
| 51 | Ga0070671_100012390 | 3300005355 | Bacteria | 6867 |
| 52 | Ga0070671_100068953 | 3300005355 | Bacteria | 2949 |
| 53 | Ga0070671_100130177 | 3300005355 | Bacteria | 2119 |
| 54 | Ga0070671_100192068 | 3300005355 | Bacteria | 1730 |
| 55 | Ga0070671_100312462 | 3300005355 | Bacteria | 1339 |
| 56 | Ga0070674_100051660 | 3300005356 | Bacteria | 2833 |
| 57 | Ga0070673_100006994 | 3300005364 | Bacteria | 7393 |
| 58 | Ga0070673_100019007 | 3300005364 | Bacteria | 4927 |
| 59 | Ga0070673_100081294 | 3300005364 | Unclassified | 2627 |
| 60 | Ga0070673_100210722 | 3300005364 | Bacteria | 1678 |
| 61 | Ga0070688_100001567 | 3300005365 | Bacteria | 11419 |
| 62 | Ga0070688_100018910 | 3300005365 | Bacteria | 3984 |
| 63 | Ga0070659_100200244 | 3300005366 | Bacteria | 1644 |
| 64 | Ga0070659_100205352 | 3300005366 | Bacteria | 1623 |
| 65 | Ga0070667_100026295 | 3300005367 | Bacteria | 4840 |
| 66 | Ga0070667_100028580 | 3300005367 | Bacteria | 4642 |
| 67 | Ga0070667_100052782 | 3300005367 | Bacteria | 3431 |
| 68 | Ga0070667_100219061 | 3300005367 | Bacteria | 1694 |
| 69 | Ga0070709_10001527 | 3300005434 | Bacteria | 12492 |
| 70 | Ga0070709_10330503 | 3300005434 | Unclassified | 1121 |
| 71 | Ga0070714_100044057 | 3300005435 | Bacteria | 3776 |
| 72 | Ga0070713_100009205 | 3300005436 | Bacteria | 7051 |
| 73 | Ga0070713_100070099 | 3300005436 | Bacteria | 2958 |
| 74 | Ga0070710_10002893 | 3300005437 | Bacteria | 8181 |
| 75 | Ga0070710_10007779 | 3300005437 | Bacteria | 5201 |
| 76 | Ga0070701_10078744 | 3300005438 | Bacteria | 1779 |
| 77 | Ga0070711_100007009 | 3300005439 | Bacteria | 6838 |
| 78 | Ga0070711_100026301 | 3300005439 | Bacteria | 3813 |
| 79 | Ga0070711_100080541 | 3300005439 | Bacteria | 2319 |
| 80 | Ga0070711_100238889 | 3300005439 | Unclassified | 1420 |
| 81 | Ga0070705_100128362 | 3300005440 | Bacteria | 1650 |
| 82 | Ga0070700_100018633 | 3300005441 | Bacteria | 3993 |
| 83 | Ga0070700_100131766 | 3300005441 | Bacteria | 1688 |
| 84 | Ga0070700_100167168 | 3300005441 | Bacteria | 1520 |
| 85 | Ga0070700_100201052 | 3300005441 | Bacteria | 1400 |
| 86 | Ga0070700_100315023 | 3300005441 | Bacteria | 1147 |
| 87 | Ga0070694_100087635 | 3300005444 | Bacteria | 2178 |
| 88 | Ga0070694_100118723 | 3300005444 | Bacteria | 1895 |
| 89 | Ga0070708_100261999 | 3300005445 | Bacteria | 1625 |
| 90 | Ga0070678_100013433 | 3300005456 | Bacteria | 5134 |
| 91 | Ga0070678_100041779 | 3300005456 | Bacteria | 3254 |
| 92 | Ga0070678_100090121 | 3300005456 | Bacteria | 2349 |
| 93 | Ga0070678_100104088 | 3300005456 | Bacteria | 2207 |
| 94 | Ga0070678_100167626 | 3300005456 | Bacteria | 1785 |
| 95 | Ga0070662_100080601 | 3300005457 | Bacteria | 2423 |
| 96 | Ga0070681_10007657 | 3300005458 | Bacteria | 10561 |
| 97 | Ga0070681_10079041 | 3300005458 | Bacteria | 3246 |
| 98 | Ga0070681_10178565 | 3300005458 | Bacteria | 2045 |
| 99 | Ga0068867_100010069 | 3300005459 | Bacteria | 6663 |
| 100 | Ga0068867_100323291 | 3300005459 | Bacteria | 1279 |
| 101 | Ga0070685_10248164 | 3300005466 | Bacteria | 1178 |
| 102 | Ga0070679_100445525 | 3300005530 | Unclassified | 1240 |
| 103 | Ga0070684_100029686 | 3300005535 | Bacteria | 4636 |
| 104 | Ga0070684_100036565 | 3300005535 | Bacteria | 4208 |
| 105 | Ga0070684_100275657 | 3300005535 | Bacteria | 1540 |
| 106 | Ga0068853_100027547 | 3300005539 | Bacteria | 4773 |
| 107 | Ga0070672_100007677 | 3300005543 | Bacteria | 7342 |
| 108 | Ga0070672_100067888 | 3300005543 | Unclassified | 2827 |
| 109 | Ga0070672_100128413 | 3300005543 | Bacteria | 2081 |
| 110 | Ga0070672_100134708 | 3300005543 | Bacteria | 2034 |
| 111 | Ga0070672_100311696 | 3300005543 | Bacteria | 1336 |
| 112 | Ga0070686_100006669 | 3300005544 | Bacteria | 6429 |
| 113 | Ga0070686_100151908 | 3300005544 | Unclassified | 1623 |
| 114 | Ga0070686_100178768 | 3300005544 | Bacteria | 1506 |
| 115 | Ga0070686_100281042 | 3300005544 | Bacteria | 1228 |
| 116 | Ga0070695_100185563 | 3300005545 | Unclassified | 1477 |
| 117 | Ga0070693_100081502 | 3300005547 | Bacteria | 1930 |
| 118 | Ga0070665_100035742 | 3300005548 | Bacteria | 4997 |
| 119 | Ga0070665_100106110 | 3300005548 | Bacteria | 2811 |
| 120 | Ga0070665_100146891 | 3300005548 | Bacteria | 2361 |
| 121 | Ga0070665_100248801 | 3300005548 | Unclassified | 1778 |
| 122 | Ga0070664_100044055 | 3300005564 | Bacteria | 3767 |
| 123 | Ga0070664_100183891 | 3300005564 | Bacteria | 1859 |
| 124 | Ga0068857_100082490 | 3300005577 | Bacteria | 2872 |
| 125 | Ga0068857_100082942 | 3300005577 | Bacteria | 2864 |
| 126 | Ga0068857_100380529 | 3300005577 | Bacteria | 1311 |
| 127 | Ga0068854_100151009 | 3300005578 | Bacteria | 1791 |
| 128 | Ga0068856_100042879 | 3300005614 | Bacteria | 4452 |
| 129 | Ga0070702_100093460 | 3300005615 | Bacteria | 1829 |
| 130 | Ga0070702_100104263 | 3300005615 | Unclassified | 1745 |
| 131 | Ga0070702_100150482 | 3300005615 | Bacteria | 1493 |
| 132 | Ga0068852_100026913 | 3300005616 | Bacteria | 4681 |
| 133 | Ga0068859_100013289 | 3300005617 | Bacteria | 8260 |
| 134 | Ga0068859_100053039 | 3300005617 | Bacteria | 4078 |
| 135 | Ga0068859_100113304 | 3300005617 | Bacteria | 2776 |
| 136 | Ga0068864_100022881 | 3300005618 | Bacteria | 5243 |
| 137 | Ga0068864_100028183 | 3300005618 | Bacteria | 4745 |
| 138 | Ga0068864_100090043 | 3300005618 | Bacteria | 2704 |
| 139 | Ga0068864_100130065 | 3300005618 | Bacteria | 2260 |
| 140 | Ga0068866_10015259 | 3300005718 | Bacteria | 3410 |
| 141 | Ga0068866_10067513 | 3300005718 | Unclassified | 1877 |
| 142 | Ga0068861_100016553 | 3300005719 | Bacteria | 5220 |
| 143 | Ga0068861_100090792 | 3300005719 | Bacteria | 2410 |
| 144 | Ga0068851_10023517 | 3300005834 | Unclassified | 3013 |
| 145 | Ga0068870_10136954 | 3300005840 | Bacteria | 1429 |
| 146 | Ga0068863_100049738 | 3300005841 | Bacteria | 3975 |
| 147 | Ga0068863_100279471 | 3300005841 | Bacteria | 1617 |
| 148 | Ga0068863_100303019 | 3300005841 | Bacteria | 1550 |
| 149 | Ga0068858_100005710 | 3300005842 | Bacteria | 12157 |
| 150 | Ga0068858_100021701 | 3300005842 | Bacteria | 6000 |
| 151 | Ga0068858_100170703 | 3300005842 | Bacteria | 2051 |
| 152 | Ga0068858_100344051 | 3300005842 | Bacteria | 1428 |
| 153 | Ga0068858_100422744 | 3300005842 | Bacteria | 1282 |
| 154 | Ga0068860_100122724 | 3300005843 | Bacteria | 2489 |
| 155 | Ga0068860_100355989 | 3300005843 | Bacteria | 1441 |
| 156 | Ga0068860_100561269 | 3300005843 | Unclassified | 1144 |
| 157 | Ga0068862_100070336 | 3300005844 | Bacteria | 3021 |
| 158 | Ga0068862_100076120 | 3300005844 | Bacteria | 2904 |
| 159 | Ga0081455_10008059 | 3300005937 | Bacteria | 11004 |
| 160 | Ga0081455_10109003 | 3300005937 | Bacteria | 2204 |
| 161 | Ga0081540_1018178 | 3300005983 | Unclassified | 4324 |
| 162 | Ga0081539_10003231 | 3300005985 | Bacteria | 20543 |
| 163 | Ga0070717_10000378 | 3300006028 | Bacteria | 28453 |
| 164 | Ga0070717_10175425 | 3300006028 | Unclassified | 1866 |
| 165 | Ga0075365_10006652 | 3300006038 | Bacteria | 6385 |
| 166 | Ga0075365_10018969 | 3300006038 | Bacteria | 4237 |
| 167 | Ga0075363_100040777 | 3300006048 | Bacteria | 2448 |
| 168 | Ga0070716_100003615 | 3300006173 | Bacteria | 7307 |
| 169 | Ga0070716_100034168 | 3300006173 | Unclassified | 2786 |
| 170 | Ga0070712_100045755 | 3300006175 | Bacteria | 3023 |
| 171 | Ga0070712_100140778 | 3300006175 | Unclassified | 1841 |
| 172 | Ga0075362_10112408 | 3300006177 | Bacteria | 1283 |
| 173 | Ga0075427_10000064 | 3300006194 | Bacteria | 8096 |
| 174 | Ga0097621_100002046 | 3300006237 | Bacteria | 13800 |
| 175 | Ga0097621_100018187 | 3300006237 | Bacteria | 5361 |
| 176 | Ga0097621_100092959 | 3300006237 | Bacteria | 2527 |
| 177 | Ga0068871_100002303 | 3300006358 | Bacteria | 12987 |
| 178 | Ga0068871_100020288 | 3300006358 | Bacteria | 5089 |
| 179 | Ga0068871_100033463 | 3300006358 | Bacteria | 4071 |
| 180 | Ga0068871_100063616 | 3300006358 | Bacteria | 3018 |
| 181 | Ga0068871_100069620 | 3300006358 | Bacteria | 2890 |
| 182 | Ga0068871_100077886 | 3300006358 | Bacteria | 2740 |
| 183 | Ga0068871_100078812 | 3300006358 | Bacteria | 2724 |
| 184 | Ga0075428_100000448 | 3300006844 | Bacteria | 41130 |
| 185 | Ga0075428_100000967 | 3300006844 | Bacteria | 30387 |
| 186 | Ga0075430_100001050 | 3300006846 | Bacteria | 21847 |
| 187 | Ga0075430_100171161 | 3300006846 | Bacteria | 1807 |
| 188 | Ga0075431_100003360 | 3300006847 | Bacteria | 15512 |
| 189 | Ga0075433_10012052 | 3300006852 | Bacteria | 6973 |
| 190 | Ga0075434_100026403 | 3300006871 | Bacteria | 5689 |
| 191 | Ga0075434_100028341 | 3300006871 | Bacteria | 5501 |
| 192 | Ga0075434_100483589 | 3300006871 | Bacteria | 1259 |
| 193 | Ga0075429_100002015 | 3300006880 | Bacteria | 16889 |
| 194 | Ga0075429_100002988 | 3300006880 | Bacteria | 14341 |
| 195 | Ga0075429_100049000 | 3300006880 | Bacteria | 3673 |
| 196 | Ga0075429_100073404 | 3300006880 | Bacteria | 2980 |
| 197 | Ga0068865_100010270 | 3300006881 | Bacteria | 5823 |
| 198 | Ga0068865_100025806 | 3300006881 | Bacteria | 3870 |
| 199 | Ga0068865_100228400 | 3300006881 | Bacteria | 1459 |
| 200 | Ga0097620_100013289 | 3300006931 | Bacteria | 8260 |
| 201 | Ga0097620_100053040 | 3300006931 | Bacteria | 4078 |
| 202 | Ga0097620_100113298 | 3300006931 | Bacteria | 2776 |
| 203 | Ga0075435_100004859 | 3300007076 | Bacteria | 9304 |
| 204 | Ga0075435_100073453 | 3300007076 | Bacteria | 2796 |
| 205 | Ga0075435_100245235 | 3300007076 | Bacteria | 1524 |
| 206 | Ga0105251_10008344 | 3300009011 | Bacteria | 6250 |
| 207 | Ga0105251_10066128 | 3300009011 | Unclassified | 1691 |
| 208 | Ga0105244_10037406 | 3300009036 | Bacteria | 2538 |
| 209 | Ga0105240_10137768 | 3300009093 | Bacteria | 2921 |
| 210 | Ga0105240_10450240 | 3300009093 | Bacteria | 1441 |
| 211 | Ga0111539_10002898 | 3300009094 | Bacteria | 22772 |
| 212 | Ga0111539_10006831 | 3300009094 | Bacteria | 14668 |
| 213 | Ga0111539_10009942 | 3300009094 | Bacteria | 11997 |
| 214 | Ga0111539_10040460 | 3300009094 | Bacteria | 5612 |
| 215 | Ga0111539_10517453 | 3300009094 | Bacteria | 1390 |
| 216 | Ga0105245_10029765 | 3300009098 | Bacteria | 4826 |
| 217 | Ga0105245_10052248 | 3300009098 | Bacteria | 3665 |
| 218 | Ga0105245_10196882 | 3300009098 | Bacteria | 1933 |
| 219 | Ga0105245_10212986 | 3300009098 | Unclassified | 1861 |
| 220 | Ga0105245_10357993 | 3300009098 | Unclassified | 1448 |
| 221 | Ga0114129_10008407 | 3300009147 | Bacteria | 14700 |
| 222 | Ga0114129_10054819 | 3300009147 | Bacteria | 5588 |
| 223 | Ga0114129_10240271 | 3300009147 | Bacteria | 2435 |
| 224 | Ga0114129_10628923 | 3300009147 | Bacteria | 1387 |
| 225 | Ga0105243_10006140 | 3300009148 | Bacteria | 9291 |
| 226 | Ga0105243_10031503 | 3300009148 | Bacteria | 4089 |
| 227 | Ga0105241_10002857 | 3300009174 | Bacteria | 12897 |
| 228 | Ga0105241_10049635 | 3300009174 | Bacteria | 3196 |
| 229 | Ga0105241_10356108 | 3300009174 | Bacteria | 1272 |
| 230 | Ga0105242_10006587 | 3300009176 | Bacteria | 8948 |
| 231 | Ga0105242_10025049 | 3300009176 | Bacteria | 4716 |
| 232 | Ga0105242_10180412 | 3300009176 | Unclassified | 1862 |
| 233 | Ga0105248_10015999 | 3300009177 | Bacteria | 8258 |
| 234 | Ga0105248_10022700 | 3300009177 | Bacteria | 6964 |
| 235 | Ga0105248_10030928 | 3300009177 | Bacteria | 5981 |
| 236 | Ga0105248_10032918 | 3300009177 | Bacteria | 5790 |
| 237 | Ga0105248_10116517 | 3300009177 | Bacteria | 3013 |
| 238 | Ga0105237_10031682 | 3300009545 | Bacteria | 5355 |
| 239 | Ga0105237_10252698 | 3300009545 | Bacteria | 1765 |
| 240 | Ga0105238_10019101 | 3300009551 | Bacteria | 6982 |
| 241 | Ga0105238_10103993 | 3300009551 | Bacteria | 2821 |
| 242 | Ga0105238_10488187 | 3300009551 | Bacteria | 1231 |
| 243 | Ga0105239_10100375 | 3300010375 | Bacteria | 3201 |
| 244 | Ga0105239_10563999 | 3300010375 | Bacteria | 1297 |
| 245 | Ga0105239_11030447 | 3300010375 | Bacteria | 947 |
| 246 | Ga0105246_10015821 | 3300011119 | Bacteria | 4769 |
| 247 | Ga0105246_10050197 | 3300011119 | Bacteria | 2861 |
| 248 | Ga0105246_10430762 | 3300011119 | Bacteria | 1103 |
| 249 | Ga0157369_10537981 | 3300013105 | Bacteria | 1208 |
| 250 | Ga0157374_10017030 | 3300013296 | Bacteria | 6398 |
| 251 | Ga0157374_10151613 | 3300013296 | Bacteria | 2254 |
| 252 | Ga0157378_10015392 | 3300013297 | Bacteria | 6699 |
| 253 | Ga0163162_10007279 | 3300013306 | Bacteria | 10750 |
| 254 | Ga0163162_10038416 | 3300013306 | Bacteria | 4778 |
| 255 | Ga0163162_10114426 | 3300013306 | Bacteria | 2797 |
| 256 | Ga0163162_10283591 | 3300013306 | Bacteria | 1788 |
| 257 | Ga0163162_10352946 | 3300013306 | Bacteria | 1603 |
| 258 | Ga0157372_10336778 | 3300013307 | Bacteria | 1757 |
| 259 | Ga0157372_10465060 | 3300013307 | Bacteria | 1474 |
| 260 | Ga0157375_10049962 | 3300013308 | Bacteria | 4101 |
| 261 | Ga0157375_10067078 | 3300013308 | Bacteria | 3584 |
| 262 | Ga0157375_10070507 | 3300013308 | Bacteria | 3505 |
| 263 | Ga0157375_10167191 | 3300013308 | Bacteria | 2345 |
| 264 | Ga0157375_10271585 | 3300013308 | Unclassified | 1858 |
| 265 | Ga0163163_10051995 | 3300014325 | Bacteria | 4040 |
| 266 | Ga0157380_10195163 | 3300014326 | Unclassified | 1791 |
| 267 | Ga0157380_10465709 | 3300014326 | Unclassified | 1218 |
| 268 | Ga0182008_10013760 | 3300014497 | Bacteria | 4251 |
| 269 | Ga0157377_10001697 | 3300014745 | Bacteria | 9604 |
| 270 | Ga0157377_10175826 | 3300014745 | Bacteria | 1342 |
| 271 | Ga0157379_10044044 | 3300014968 | Bacteria | 3985 |
| 272 | Ga0157379_10065976 | 3300014968 | Bacteria | 3236 |
| 273 | Ga0157379_10263871 | 3300014968 | Bacteria | 1565 |
| 274 | Ga0157376_10007504 | 3300014969 | Bacteria | 7793 |
| 275 | Ga0157376_10114368 | 3300014969 | Bacteria | 2381 |
| 276 | Ga0157376_10135535 | 3300014969 | Bacteria | 2203 |
| 277 | Ga0157376_10375403 | 3300014969 | Bacteria | 1368 |
| 278 | Ga0182007_10000918 | 3300015262 | Bacteria | 16302 |
| 279 | Ga0163161_10031508 | 3300017792 | Unclassified | 3778 |
| 280 | Ga0163161_10083593 | 3300017792 | Bacteria | 2353 |
| 281 | Ga0163161_10087535 | 3300017792 | Bacteria | 2301 |
| 282 | Ga0207697_10018773 | 3300025315 | Unclassified | 2834 |
| 283 | Ga0207697_10025227 | 3300025315 | Bacteria | 2431 |
| 284 | Ga0207656_10014038 | 3300025321 | Bacteria | 3077 |
| 285 | Ga0207696_1048005 | 3300025711 | Bacteria | 1229 |
| 286 | Ga0207682_10002811 | 3300025893 | Bacteria | 7695 |
| 287 | Ga0207692_10004188 | 3300025898 | Bacteria | 5694 |
| 288 | Ga0207642_10003568 | 3300025899 | Bacteria | 4932 |
| 289 | Ga0207642_10078176 | 3300025899 | Bacteria | 1598 |
| 290 | Ga0207710_10003481 | 3300025900 | Bacteria | 7006 |
| 291 | Ga0207710_10003917 | 3300025900 | Bacteria | 6575 |
| 292 | Ga0207688_10000990 | 3300025901 | Bacteria | 14488 |
| 293 | Ga0207688_10007616 | 3300025901 | Bacteria | 5894 |
| 294 | Ga0207688_10048716 | 3300025901 | Bacteria | 2367 |
| 295 | Ga0207680_10005429 | 3300025903 | Bacteria | 6091 |
| 296 | Ga0207680_10042100 | 3300025903 | Bacteria | 2669 |
| 297 | Ga0207685_10002461 | 3300025905 | Bacteria | 4253 |
| 298 | Ga0207685_10040702 | 3300025905 | Bacteria | 1734 |
| 299 | Ga0207699_10001414 | 3300025906 | Bacteria | 11391 |
| 300 | Ga0207699_10035373 | 3300025906 | Unclassified | 2842 |
| 301 | Ga0207699_10070614 | 3300025906 | Bacteria | 2132 |
| 302 | Ga0207645_10018793 | 3300025907 | Bacteria | 4540 |
| 303 | Ga0207645_10092678 | 3300025907 | Unclassified | 1943 |
| 304 | Ga0207645_10103058 | 3300025907 | Bacteria | 1842 |
| 305 | Ga0207645_10187825 | 3300025907 | Bacteria | 1357 |
| 306 | Ga0207643_10000401 | 3300025908 | Bacteria | 28895 |
| 307 | Ga0207643_10074129 | 3300025908 | Bacteria | 1962 |
| 308 | Ga0207643_10079757 | 3300025908 | Unclassified | 1895 |
| 309 | Ga0207654_10004249 | 3300025911 | Bacteria | 7226 |
| 310 | Ga0207654_10204631 | 3300025911 | Bacteria | 1302 |
| 311 | Ga0207707_10030138 | 3300025912 | Unclassified | 4744 |
| 312 | Ga0207707_10126397 | 3300025912 | Bacteria | 2236 |
| 313 | Ga0207707_10140475 | 3300025912 | Bacteria | 2112 |
| 314 | Ga0207707_10179447 | 3300025912 | Bacteria | 1849 |
| 315 | Ga0207671_10174565 | 3300025914 | Bacteria | 1670 |
| 316 | Ga0207671_10291848 | 3300025914 | Unclassified | 1288 |
| 317 | Ga0207693_10011667 | 3300025915 | Bacteria | 7108 |
| 318 | Ga0207693_10021607 | 3300025915 | Bacteria | 5115 |
| 319 | Ga0207693_10061055 | 3300025915 | Unclassified | 2953 |
| 320 | Ga0207693_10131485 | 3300025915 | Bacteria | 1967 |
| 321 | Ga0207663_10046347 | 3300025916 | Bacteria | 2678 |
| 322 | Ga0207663_10053755 | 3300025916 | Bacteria | 2518 |
| 323 | Ga0207660_10021413 | 3300025917 | Bacteria | 4347 |
| 324 | Ga0207662_10002358 | 3300025918 | Bacteria | 9465 |
| 325 | Ga0207662_10039515 | 3300025918 | Bacteria | 2769 |
| 326 | Ga0207657_10118040 | 3300025919 | Bacteria | 2184 |
| 327 | Ga0207649_10019229 | 3300025920 | Bacteria | 3901 |
| 328 | Ga0207652_10251507 | 3300025921 | Bacteria | 1594 |
| 329 | Ga0207681_10028847 | 3300025923 | Bacteria | 3598 |
| 330 | Ga0207681_10189832 | 3300025923 | Bacteria | 1571 |
| 331 | Ga0207694_10075790 | 3300025924 | Bacteria | 2633 |
| 332 | Ga0207694_10320028 | 3300025924 | Bacteria | 1280 |
| 333 | Ga0207650_10015019 | 3300025925 | Bacteria | 5386 |
| 334 | Ga0207659_10010758 | 3300025926 | Bacteria | 5757 |
| 335 | Ga0207659_10010852 | 3300025926 | Bacteria | 5736 |
| 336 | Ga0207659_10028037 | 3300025926 | Bacteria | 3821 |
| 337 | Ga0207659_10030900 | 3300025926 | Bacteria | 3663 |
| 338 | Ga0207659_10221212 | 3300025926 | Bacteria | 1522 |
| 339 | Ga0207687_10009654 | 3300025927 | Bacteria | 6310 |
| 340 | Ga0207687_10015928 | 3300025927 | Bacteria | 4933 |
| 341 | Ga0207687_10022301 | 3300025927 | Bacteria | 4212 |
| 342 | Ga0207687_10187326 | 3300025927 | Bacteria | 1608 |
| 343 | Ga0207700_10005138 | 3300025928 | Bacteria | 7785 |
| 344 | Ga0207700_10075050 | 3300025928 | Bacteria | 2619 |
| 345 | Ga0207664_10003302 | 3300025929 | Bacteria | 10730 |
| 346 | Ga0207644_10002298 | 3300025931 | Bacteria | 12399 |
| 347 | Ga0207644_10012793 | 3300025931 | Bacteria | 5580 |
| 348 | Ga0207644_10181705 | 3300025931 | Bacteria | 1649 |
| 349 | Ga0207644_10263339 | 3300025931 | Bacteria | 1379 |
| 350 | Ga0207690_10021475 | 3300025932 | Bacteria | 4004 |
| 351 | Ga0207706_10009345 | 3300025933 | Bacteria | 9002 |
| 352 | Ga0207706_10010690 | 3300025933 | Bacteria | 8385 |
| 353 | Ga0207706_10026853 | 3300025933 | Bacteria | 5154 |
| 354 | Ga0207686_10004054 | 3300025934 | Bacteria | 7865 |
| 355 | Ga0207686_10124343 | 3300025934 | Bacteria | 1761 |
| 356 | Ga0207686_10230580 | 3300025934 | Unclassified | 1342 |
| 357 | Ga0207709_10016749 | 3300025935 | Bacteria | 4080 |
| 358 | Ga0207670_10000656 | 3300025936 | Bacteria | 18332 |
| 359 | Ga0207670_10014147 | 3300025936 | Bacteria | 4727 |
| 360 | Ga0207669_10032664 | 3300025937 | Bacteria | 2926 |
| 361 | Ga0207669_10079274 | 3300025937 | Bacteria | 2096 |
| 362 | Ga0207704_10065748 | 3300025938 | Bacteria | 2272 |
| 363 | Ga0207665_10005865 | 3300025939 | Bacteria | 8173 |
| 364 | Ga0207665_10038750 | 3300025939 | Unclassified | 3175 |
| 365 | Ga0207691_10002719 | 3300025940 | Bacteria | 17278 |
| 366 | Ga0207691_10013556 | 3300025940 | Bacteria | 7795 |
| 367 | Ga0207691_10080853 | 3300025940 | Unclassified | 2922 |
| 368 | Ga0207691_10145597 | 3300025940 | Bacteria | 2085 |
| 369 | Ga0207691_10161006 | 3300025940 | Bacteria | 1969 |
| 370 | Ga0207711_10011703 | 3300025941 | Bacteria | 7289 |
| 371 | Ga0207711_10060016 | 3300025941 | Bacteria | 3276 |
| 372 | Ga0207711_10064226 | 3300025941 | Bacteria | 3170 |
| 373 | Ga0207689_10021839 | 3300025942 | Bacteria | 5382 |
| 374 | Ga0207689_10038393 | 3300025942 | Bacteria | 3967 |
| 375 | Ga0207661_10122512 | 3300025944 | Bacteria | 2216 |
| 376 | Ga0207679_10059717 | 3300025945 | Bacteria | 2830 |
| 377 | Ga0207651_10013019 | 3300025960 | Bacteria | 4739 |
| 378 | Ga0207651_10013319 | 3300025960 | Unclassified | 4701 |
| 379 | Ga0207651_10100460 | 3300025960 | Bacteria | 2145 |
| 380 | Ga0207651_10109927 | 3300025960 | Bacteria | 2067 |
| 381 | Ga0207651_10135376 | 3300025960 | Bacteria | 1894 |
| 382 | Ga0207651_10251835 | 3300025960 | Unclassified | 1445 |
| 383 | Ga0207651_10266581 | 3300025960 | Bacteria | 1409 |
| 384 | Ga0207712_10007514 | 3300025961 | Bacteria | 6882 |
| 385 | Ga0207668_10068810 | 3300025972 | Bacteria | 2519 |
| 386 | Ga0207668_10102175 | 3300025972 | Unclassified | 2132 |
| 387 | Ga0207658_10009391 | 3300025986 | Bacteria | 6634 |
| 388 | Ga0207658_10121796 | 3300025986 | Bacteria | 2081 |
| 389 | Ga0207677_10007106 | 3300026023 | Bacteria | 6164 |
| 390 | Ga0207677_10174976 | 3300026023 | Bacteria | 1683 |
| 391 | Ga0207677_10327824 | 3300026023 | Bacteria | 1275 |
| 392 | Ga0207703_10010690 | 3300026035 | Bacteria | 7166 |
| 393 | Ga0207703_10070430 | 3300026035 | Bacteria | 2886 |
| 394 | Ga0207703_10332990 | 3300026035 | Bacteria | 1393 |
| 395 | Ga0207678_10015702 | 3300026067 | Bacteria | 6654 |
| 396 | Ga0207678_10099529 | 3300026067 | Bacteria | 2483 |
| 397 | Ga0207708_10004051 | 3300026075 | Bacteria | 10769 |
| 398 | Ga0207708_10004545 | 3300026075 | Bacteria | 10214 |
| 399 | Ga0207708_10111665 | 3300026075 | Bacteria | 2122 |
| 400 | Ga0207708_10285369 | 3300026075 | Unclassified | 1339 |
| 401 | Ga0207702_10030813 | 3300026078 | Bacteria | 4468 |
| 402 | Ga0207702_10179538 | 3300026078 | Bacteria | 1948 |
| 403 | Ga0207641_10011065 | 3300026088 | Bacteria | 7401 |
| 404 | Ga0207641_10086580 | 3300026088 | Bacteria | 2732 |
| 405 | Ga0207648_10031557 | 3300026089 | Bacteria | 4684 |
| 406 | Ga0207648_10048220 | 3300026089 | Bacteria | 3730 |
| 407 | Ga0207676_10005605 | 3300026095 | Bacteria | 8883 |
| 408 | Ga0207676_10008174 | 3300026095 | Bacteria | 7442 |
| 409 | Ga0207676_10029341 | 3300026095 | Bacteria | 4117 |
| 410 | Ga0207674_10010261 | 3300026116 | Bacteria | 10629 |
| 411 | Ga0207674_10043527 | 3300026116 | Bacteria | 4630 |
| 412 | Ga0207674_10374583 | 3300026116 | Bacteria | 1376 |
| 413 | Ga0207675_100092741 | 3300026118 | Bacteria | 2840 |
| 414 | Ga0207683_10001187 | 3300026121 | Bacteria | 23607 |
| 415 | Ga0207683_10001573 | 3300026121 | Bacteria | 20555 |
| 416 | Ga0207683_10022534 | 3300026121 | Bacteria | 5406 |
| 417 | Ga0207683_10056244 | 3300026121 | Bacteria | 3450 |
| 418 | Ga0207683_10084530 | 3300026121 | Unclassified | 2821 |
| 419 | Ga0207683_10085445 | 3300026121 | Bacteria | 2805 |
| 420 | Ga0207683_10086404 | 3300026121 | Bacteria | 2789 |
| 421 | Ga0207683_10090880 | 3300026121 | Bacteria | 2719 |
| 422 | Ga0207683_10108527 | 3300026121 | Bacteria | 2484 |
| 423 | Ga0207698_10088047 | 3300026142 | Bacteria | 2531 |
| 424 | Ga0209995_1005005 | 3300027471 | Bacteria | 2126 |
| 425 | Ga0209982_1008525 | 3300027552 | Bacteria | 1504 |
| 426 | Ga0209974_10006906 | 3300027876 | Bacteria | 3934 |
| 427 | Ga0207428_10001083 | 3300027907 | Bacteria | 29663 |
| 428 | Ga0207428_10002784 | 3300027907 | Bacteria | 17363 |
| 429 | Ga0207428_10002888 | 3300027907 | Bacteria | 17027 |
| 430 | Ga0207428_10009642 | 3300027907 | Bacteria | 8647 |
| 431 | Ga0268266_10004945 | 3300028379 | Bacteria | 12614 |
| 432 | Ga0268266_10269418 | 3300028379 | Bacteria | 1580 |
| 433 | Ga0268264_10050989 | 3300028381 | Bacteria | 3447 |
| 434 | Ga0268264_10058053 | 3300028381 | Bacteria | 3239 |
| 435 | Ga0268264_10398261 | 3300028381 | Bacteria | 1322 |
| 436 | Ga0265320_10096454 | 3300031240 | Bacteria | 1365 |
| 437 | Ga0265325_10112626 | 3300031241 | Bacteria | 1320 |
| 438 | Ga0265329_10008365 | 3300031242 | Bacteria | 3930 |
| 439 | Ga0265340_10016163 | 3300031247 | Bacteria | 3868 |
| 440 | Ga0265331_10003802 | 3300031250 | Bacteria | 9577 |
| 441 | Ga0265331_10027506 | 3300031250 | Bacteria | 2849 |
| 442 | Ga0265331_10072894 | 3300031250 | Bacteria | 1604 |
| 443 | Ga0265316_10026251 | 3300031344 | Bacteria | 4850 |
| 444 | Ga0265316_10244851 | 3300031344 | Bacteria | 1318 |
| 445 | Ga0265313_10010130 | 3300031595 | Bacteria | 6022 |
| 446 | Ga0265314_10000394 | 3300031711 | Bacteria | 59418 |
| 447 | Ga0265314_10007419 | 3300031711 | Bacteria | 9510 |
| 448 | Ga0265342_10030198 | 3300031712 | Bacteria | 3360 |
| 449 | Ga0307410_10355220 | 3300031852 | Bacteria | 1172 |
| 450 | Ga0307409_100219389 | 3300031995 | Bacteria | 1716 |
| 451 | Ga0307416_100063889 | 3300032002 | Bacteria | 3017 |
| 452 | Ga0307416_100510525 | 3300032002 | Bacteria | 1268 |
| 453 | Ga0307416_100603984 | 3300032002 | Bacteria | 1177 |
| 454 | Ga0307411_10023471 | 3300032005 | Bacteria | 3655 |
| 455 | Ga0307415_100099696 | 3300032126 | Bacteria | 2127 |
| 456 | Ga0373948_0003259 | 3300034817 | Bacteria | 2482 |
| 457 | Ga0373938_0007363 | 3300034957 | Bacteria | 1934 |
| 458 | Ga0373926_0050968 | 3300035083 | Bacteria | 1492 |
| 459 | Ga0373928_0007096 | 3300035084 | Bacteria | 2160 |
| 460 | Ga0373928_0009350 | 3300035084 | Bacteria | 1914 |
| 461 | Ga0373944_0011279 | 3300035089 | Bacteria | 2446 |
| 462 | Ga0373936_0033702 | 3300035113 | Unclassified | 2031 |
| 463 | Ga0373936_0083966 | 3300035113 | Bacteria | 1328 |
| 464 | Ga0373936_0097073 | 3300035113 | Unclassified | 1240 |
| 465 | Ga0373939_0002202 | 3300035114 | Bacteria | 4614 |
| 466 | Ga0373954_0016722 | 3300035118 | Bacteria | 3287 |
| 467 | Ga0373957_0086636 | 3300035120 | Bacteria | 1241 |
| 468 | Ga0373960_0014091 | 3300035121 | Bacteria | 2019 |
| 469 | Ga0373943_0002844 | 3300035170 | Bacteria | 7863 |
| 470 | Ga0373955_0003402 | 3300035172 | Bacteria | 6994 |
| 471 | Ga0373955_0005412 | 3300035172 | Bacteria | 5737 |
| 472 | Ga0373955_0031245 | 3300035172 | Bacteria | 2788 |
| 473 | Ga0373962_0001159 | 3300035242 | Bacteria | 6148 |
| 474 | Ga0373924_0126168 | 3300035410 | Bacteria | 1112 |
| 475 | Ga0373931_0000377 | 3300035691 | Bacteria | 18341 |
| 476 | Ga0373931_0001635 | 3300035691 | Bacteria | 9689 |
| 477 | Ga0373931_0005853 | 3300035691 | Bacteria | 5720 |
| 478 | Ga0373935_0020879 | 3300035692 | Bacteria | 4006 |
| 479 | Ga0373935_0036203 | 3300035692 | Unclassified | 3084 |
| 480 | Ga0373937_0023451 | 3300036401 | Bacteria | 5555 |
| 481 | Ga0373937_0076963 | 3300036401 | Unclassified | 3082 |
| 482 | Ga0373937_0186509 | 3300036401 | Bacteria | 1948 |
| 483 | Ga0373925_0070220 | 3300037068 | Unclassified | 2647 |
| 484 | Ga0373925_0321645 | 3300037068 | Bacteria | 1252 |
| 485 | Ga0451807_2464558 | 3300041486 | Bacteria | 1079 |
| 486 | Ga0439441_005885 | 3300042001 | Unclassified | 1924 |
| 487 | Ga0439460_0047779 | 3300042461 | Bacteria | 1275 |
| 488 | Ga0450916_010742 | 3300042530 | Bacteria | 1149 |
| 489 | Ga0466969_0087749 | 3300044656 | Bacteria | 1477 |
| 490 | Ga0451576_0041505 | 3300045051 | Bacteria | 4864 |
| 491 | Ga0495592_0001183 | 3300046454 | Bacteria | 18097 |
| 492 | Ga0495592_0010278 | 3300046454 | Bacteria | 7056 |
| 493 | Ga0495592_0013701 | 3300046454 | Bacteria | 6167 |
| 494 | Ga0495592_0059898 | 3300046454 | Bacteria | 2802 |
| 495 | Ga0495603_0003568 | 3300046455 | Bacteria | 9267 |
| 496 | Ga0495591_063947 | 3300046458 | Bacteria | 971 |
| 497 | Ga0495629_0000026 | 3300046459 | Bacteria | 134719 |
| 498 | Ga0495641_0017257 | 3300046461 | Unclassified | 3766 |
| 499 | Ga0495651_0006473 | 3300046462 | Bacteria | 8952 |
| 500 | Ga0495653_0006528 | 3300046463 | Bacteria | 9571 |
| 501 | Ga0495653_0084360 | 3300046463 | Unclassified | 2340 |
| 502 | Ga0495653_0088061 | 3300046463 | Bacteria | 2279 |
| 503 | Ga0495580_0099536 | 3300046472 | Unclassified | 2022 |
| 504 | Ga0495582_0010491 | 3300046473 | Bacteria | 5095 |
| 505 | Ga0495639_0000829 | 3300046475 | Bacteria | 14097 |
| 506 | Ga0495639_0043613 | 3300046475 | Unclassified | 2026 |
| 507 | Ga0495664_0016991 | 3300046477 | Unclassified | 4155 |
| 508 | Ga0495664_0017341 | 3300046477 | Bacteria | 4114 |
| 509 | Ga0495664_0062951 | 3300046477 | Unclassified | 2210 |
| 510 | Ga0495594_0013609 | 3300046499 | Unclassified | 4250 |
| 511 | Ga0495596_0114757 | 3300046500 | Bacteria | 1046 |
| 512 | Ga0495608_0015339 | 3300046511 | Bacteria | 5315 |
| 513 | Ga0495608_0031115 | 3300046511 | Bacteria | 3610 |
| 514 | Ga0495608_0065655 | 3300046511 | Bacteria | 2376 |
| 515 | Ga0495618_0004629 | 3300046514 | Bacteria | 8424 |
| 516 | Ga0495628_0012354 | 3300046516 | Bacteria | 7199 |
| 517 | Ga0495628_0048949 | 3300046516 | Bacteria | 3348 |
| 518 | Ga0495630_0022981 | 3300046517 | Bacteria | 4607 |
| 519 | Ga0495630_0099406 | 3300046517 | Bacteria | 2201 |
| 520 | Ga0495643_0025697 | 3300046522 | Bacteria | 3330 |
| 521 | Ga0495642_0026902 | 3300046528 | Bacteria | 2287 |
| 522 | Ga0495652_0013358 | 3300046529 | Bacteria | 7390 |
| 523 | Ga0495652_0019752 | 3300046529 | Bacteria | 5993 |
| 524 | Ga0495652_0173519 | 3300046529 | Bacteria | 1662 |
| 525 | Ga0495640_0011653 | 3300046533 | Bacteria | 6750 |
| 526 | Ga0495640_0069472 | 3300046533 | Bacteria | 2369 |
| 527 | Ga0495640_0200287 | 3300046533 | Unclassified | 1266 |
| 528 | Ga0495587_0002158 | 3300046536 | Bacteria | 13166 |
| 529 | Ga0495587_0079341 | 3300046536 | Bacteria | 1903 |
| 530 | Ga0495598_0014852 | 3300046537 | Unclassified | 1954 |
| 531 | Ga0495645_0004873 | 3300046543 | Bacteria | 9173 |
| 532 | Ga0495645_0005953 | 3300046543 | Bacteria | 8429 |
| 533 | Ga0495645_0182553 | 3300046543 | Bacteria | 1436 |
| 534 | Ga0495667_0004643 | 3300046559 | Bacteria | 9289 |
| 535 | Ga0495667_0006737 | 3300046559 | Bacteria | 7795 |
| 536 | Ga0495667_0052211 | 3300046559 | Bacteria | 2694 |
| 537 | Ga0495667_0080018 | 3300046559 | Bacteria | 2124 |
| 538 | Ga0495656_0058592 | 3300046615 | Bacteria | 1672 |
| 539 | Ga0495634_0055792 | 3300046642 | Bacteria | 2641 |
| 540 | Ga0495634_0080755 | 3300046642 | Bacteria | 2127 |
| 541 | Ga0495634_0110840 | 3300046642 | Bacteria | 1765 |
| 542 | Ga0495634_0123256 | 3300046642 | Bacteria | 1659 |
| 543 | Ga0495634_0218201 | 3300046642 | Bacteria | 1178 |
| 544 | Ga0495635_0011540 | 3300046663 | Bacteria | 6192 |
| 545 | Ga0495635_0014610 | 3300046663 | Bacteria | 5492 |
| 546 | Ga0495635_0036043 | 3300046663 | Unclassified | 3430 |
| 547 | Ga0495635_0043829 | 3300046663 | Unclassified | 3086 |
| 548 | Ga0495635_0231116 | 3300046663 | Bacteria | 1249 |
| 549 | Ga0495588_0037337 | 3300046674 | Bacteria | 2468 |
| 550 | Ga0495657_0004096 | 3300046675 | Bacteria | 11690 |
| 551 | Ga0495657_0021580 | 3300046675 | Bacteria | 4620 |
| 552 | Ga0495599_0008501 | 3300046678 | Bacteria | 6243 |
| 553 | Ga0495623_0002369 | 3300046679 | Bacteria | 12531 |
| 554 | Ga0495623_0002592 | 3300046679 | Bacteria | 11946 |
| 555 | Ga0495623_0005955 | 3300046679 | Bacteria | 7944 |
| 556 | Ga0495646_0001551 | 3300046680 | Bacteria | 13663 |
| 557 | Ga0495658_0001832 | 3300046683 | Bacteria | 10877 |
| 558 | Ga0495658_0033104 | 3300046683 | Bacteria | 2828 |
| 559 | Ga0495658_0043316 | 3300046683 | Bacteria | 2517 |
| 560 | Ga0495669_0029785 | 3300046684 | Unclassified | 2395 |
| 561 | Ga0495600_0080564 | 3300046809 | Bacteria | 2126 |
| 562 | Ga0495581_0020165 | 3300047315 | Bacteria | 3870 |
| 563 | Ga0495604_0012226 | 3300047317 | Bacteria | 6824 |
| 564 | Ga0495604_0027565 | 3300047317 | Bacteria | 4516 |
| 565 | Ga0495604_0202525 | 3300047317 | Bacteria | 1376 |
| 566 | Ga0495674_0018822 | 3300047319 | Bacteria | 6422 |
| 567 | Ga0495674_0032302 | 3300047319 | Unclassified | 4748 |
| 568 | Ga0495676_0023279 | 3300047321 | Bacteria | 5379 |
| 569 | Ga0495676_0073019 | 3300047321 | Unclassified | 2632 |
| 570 | Ga0495676_0105554 | 3300047321 | Bacteria | 2077 |
| 571 | Ga0495680_0001148 | 3300047322 | Bacteria | 29161 |
| 572 | Ga0495680_0002496 | 3300047322 | Bacteria | 18808 |
| 573 | Ga0495680_0002890 | 3300047322 | Bacteria | 17261 |
| 574 | Ga0495680_0061591 | 3300047322 | Bacteria | 2886 |
| 575 | Ga0495680_0293825 | 3300047322 | Bacteria | 1142 |
| 576 | Ga0495675_0000903 | 3300047444 | Bacteria | 18076 |
| 577 | Ga0495675_0020171 | 3300047444 | Unclassified | 4237 |
| 578 | Ga0495684_0055037 | 3300047471 | Unclassified | 3034 |
| 579 | Ga0495593_0024539 | 3300047673 | Bacteria | 3341 |
| 580 | Ga0495593_0119719 | 3300047673 | Bacteria | 1340 |
| 581 | Ga0495602_0007794 | 3300048088 | Bacteria | 11193 |
| 582 | Ga0495602_0015488 | 3300048088 | Bacteria | 7693 |
| 583 | Ga0495602_0154194 | 3300048088 | Bacteria | 1801 |
| 584 | Ga0495602_0190573 | 3300048088 | Bacteria | 1573 |
| 585 | Ga0496100_0055293 | 3300048903 | Unclassified | 2592 |
| 586 | Ga0496100_0071984 | 3300048903 | Bacteria | 2309 |
| 587 | Ga0496101_0018322 | 3300048904 | Bacteria | 4759 |
| 588 | Ga0496101_0085666 | 3300048904 | Unclassified | 2335 |
| 589 | Ga0496101_0087092 | 3300048904 | Bacteria | 2317 |
| 590 | Ga0496101_0456998 | 3300048904 | Bacteria | 1008 |
| 591 | Ga0496102_0001102 | 3300048905 | Bacteria | 24871 |
| 592 | Ga0496102_0015478 | 3300048905 | Bacteria | 6644 |
| 593 | Ga0496102_0029922 | 3300048905 | Bacteria | 4873 |
| 594 | Ga0496102_0083858 | 3300048905 | Bacteria | 2941 |
| 595 | Ga0496102_0134912 | 3300048905 | Bacteria | 2312 |
| 596 | Ga0496103_0001332 | 3300048906 | Bacteria | 16721 |
| 597 | Ga0496103_0015537 | 3300048906 | Bacteria | 4533 |
| 598 | Ga0496104_0000524 | 3300048907 | Bacteria | 32873 |
| 599 | Ga0496104_0191591 | 3300048907 | Bacteria | 1956 |
| 600 | Ga0496104_0236525 | 3300048907 | Bacteria | 1738 |
| 601 | Ga0496104_0336372 | 3300048907 | Bacteria | 1423 |
| 602 | Ga0496104_0432225 | 3300048907 | Bacteria | 1228 |
| 603 | Ga0496104_0455154 | 3300048907 | Bacteria | 1191 |
| 604 | Ga0496105_0010077 | 3300048908 | Bacteria | 7417 |
| 605 | Ga0496105_0012640 | 3300048908 | Bacteria | 6685 |
| 606 | Ga0496105_0053793 | 3300048908 | Bacteria | 3324 |
| 607 | Ga0496105_0054998 | 3300048908 | Bacteria | 3286 |
| 608 | Ga0496105_0059853 | 3300048908 | Bacteria | 3143 |
| 609 | Ga0496105_0093825 | 3300048908 | Bacteria | 2478 |
| 610 | Ga0496105_0293877 | 3300048908 | Bacteria | 1307 |
| 611 | Ga0496106_0003107 | 3300048909 | Bacteria | 12399 |
| 612 | Ga0496106_0012080 | 3300048909 | Bacteria | 6373 |
| 613 | Ga0496106_0139832 | 3300048909 | Bacteria | 1904 |
| 614 | Ga0496107_0009585 | 3300048910 | Bacteria | 6715 |
| 615 | Ga0496107_0107906 | 3300048910 | Unclassified | 2044 |
| 616 | Ga0496107_0145808 | 3300048910 | Bacteria | 1750 |
| 617 | Ga0496108_0017206 | 3300048911 | Bacteria | 5914 |
| 618 | Ga0496108_0037054 | 3300048911 | Unclassified | 4061 |
| 619 | Ga0496108_0335004 | 3300048911 | Bacteria | 1320 |
| 620 | Ga0496109_0059151 | 3300048912 | Bacteria | 3501 |
| 621 | Ga0496109_0114840 | 3300048912 | Bacteria | 2505 |
| 622 | Ga0496109_0132993 | 3300048912 | Bacteria | 2323 |
| 623 | Ga0496110_0161010 | 3300048913 | Bacteria | 2034 |
| 624 | Ga0496110_0247023 | 3300048913 | Bacteria | 1624 |
| 625 | Ga0496111_0209899 | 3300048914 | Bacteria | 1446 |
| 626 | Ga0496112_0033457 | 3300048915 | Bacteria | 4998 |
| 627 | Ga0496112_0047201 | 3300048915 | Bacteria | 4225 |
| 628 | Ga0496112_0053373 | 3300048915 | Bacteria | 3969 |
| 629 | Ga0496112_0139851 | 3300048915 | Bacteria | 2390 |
| 630 | Ga0496112_0216879 | 3300048915 | Bacteria | 1870 |
| 631 | Ga0496113_0008910 | 3300048916 | Bacteria | 6564 |
| 632 | Ga0496113_0182873 | 3300048916 | Bacteria | 1662 |
| 633 | Ga0496113_0252081 | 3300048916 | Bacteria | 1409 |
| 634 | Ga0496113_0284091 | 3300048916 | Bacteria | 1323 |
| 635 | Ga0496114_0019963 | 3300048917 | Bacteria | 5436 |
| 636 | Ga0496114_0022262 | 3300048917 | Bacteria | 5164 |
| 637 | Ga0496114_0027029 | 3300048917 | Bacteria | 4700 |
| 638 | Ga0496114_0035489 | 3300048917 | Bacteria | 4117 |
| 639 | Ga0496114_0068999 | 3300048917 | Bacteria | 2968 |
| 640 | Ga0496114_0083183 | 3300048917 | Bacteria | 2707 |
| 641 | Ga0496114_0100880 | 3300048917 | Bacteria | 2464 |
| 642 | Ga0496114_0139189 | 3300048917 | Bacteria | 2100 |
| 643 | Ga0496114_0192872 | 3300048917 | Bacteria | 1783 |
| 644 | Ga0496115_0009667 | 3300048918 | Bacteria | 7174 |
| 645 | Ga0496115_0010728 | 3300048918 | Bacteria | 6851 |
| 646 | Ga0496115_0022114 | 3300048918 | Bacteria | 4920 |
| 647 | Ga0496115_0078506 | 3300048918 | Bacteria | 2686 |
| 648 | Ga0496115_0130574 | 3300048918 | Unclassified | 2070 |
| 649 | Ga0496115_0157288 | 3300048918 | Bacteria | 1877 |
| 650 | Ga0501033_0016371 | 3300049570 | Bacteria | 5615 |
| 651 | Ga0501033_0170345 | 3300049570 | Bacteria | 1564 |
| 652 | Ga0501034_0158652 | 3300049571 | Bacteria | 2235 |
| 653 | Ga0501036_0032020 | 3300049572 | Bacteria | 4443 |
| 654 | Ga0501036_0137875 | 3300049572 | Bacteria | 2059 |
| 655 | Ga0501039_0005613 | 3300049575 | Bacteria | 9497 |
| 656 | Ga0501039_0092121 | 3300049575 | Bacteria | 2362 |
| 657 | Ga0501039_0239389 | 3300049575 | Bacteria | 1427 |
| 658 | Ga0501040_0013209 | 3300049576 | Bacteria | 5431 |
| 659 | Ga0501041_0013321 | 3300049577 | Bacteria | 4873 |
| 660 | Ga0501042_0023571 | 3300049578 | Bacteria | 4309 |
| 661 | Ga0501047_0018304 | 3300049581 | Bacteria | 6713 |
| 662 | Ga0501071_0012299 | 3300049587 | Bacteria | 5800 |
| 663 | Ga0501074_0036521 | 3300049590 | Bacteria | 3559 |
| 664 | Ga0501075_0000850 | 3300049591 | Bacteria | 19233 |
| 665 | Ga0501076_0091753 | 3300049592 | Bacteria | 2443 |
| 666 | Ga0501079_0019291 | 3300049741 | Bacteria | 5208 |
| 667 | Ga0501080_0004907 | 3300049742 | Bacteria | 11918 |
| 668 | Ga0501080_0128181 | 3300049742 | Bacteria | 2349 |
| 669 | Ga0501080_0307959 | 3300049742 | Unclassified | 1436 |
| 670 | Ga0501081_0000396 | 3300049743 | Bacteria | 24049 |
| 671 | Ga0501083_0306561 | 3300049744 | Bacteria | 1033 |
| 672 | Ga0501035_0016853 | 3300049822 | Bacteria | 6736 |
| 673 | Ga0501044_0014976 | 3300049823 | Bacteria | 8361 |
| 674 | Ga0501045_0023162 | 3300049824 | Bacteria | 4450 |
| 675 | nmdc:mga0yw44_38355_c1 | 3300050492 | Bacteria | 2835 |
| 676 | nmdc:mga06z11_23048_c1 | 3300050494 | Bacteria | 2918 |
| 677 | nmdc:mga05p37_129_c2 | 3300050507 | Bacteria | 23302 |
| 678 | nmdc:mga05p37_229923_c1 | 3300050507 | Bacteria | 2235 |
| 679 | nmdc:mga09592_4060_c1 | 3300050508 | Bacteria | 11820 |
| 680 | nmdc:mga09592_4639_c1 | 3300050508 | Bacteria | 11130 |
| 681 | nmdc:mga09592_90509_c1 | 3300050508 | Bacteria | 2614 |
| 682 | nmdc:mga09592_9848_c1 | 3300050508 | Bacteria | 7770 |
| 683 | nmdc:mga0qj67_252132_c1 | 3300050509 | Bacteria | 1432 |
| 684 | nmdc:mga0qj67_258548_c1 | 3300050509 | Bacteria | 1412 |
| 685 | nmdc:mga0qj67_426099_c1 | 3300050509 | Bacteria | 1069 |
| 686 | nmdc:mga08y16_1682_c1 | 3300050511 | Bacteria | 22429 |
| 687 | nmdc:mga08y16_33305_c1 | 3300050511 | Bacteria | 5412 |
| 688 | nmdc:mga08y16_39116_c1 | 3300050511 | Bacteria | 4977 |
| 689 | nmdc:mga08y16_5239_c1 | 3300050511 | Bacteria | 13543 |
| 690 | nmdc:mga08y16_7844_c1 | 3300050511 | Bacteria | 11181 |
| 691 | nmdc:mga0n895_142806_c1 | 3300050512 | Bacteria | 2423 |
| 692 | nmdc:mga0n895_1756_c1 | 3300050512 | Bacteria | 16406 |
| 693 | nmdc:mga0n895_531143_c1 | 3300050512 | Bacteria | 1183 |
| 694 | nmdc:mga0rr50_15183_c1 | 3300050513 | Bacteria | 5077 |
| 695 | nmdc:mga0rr50_427239_c1 | 3300050513 | Unclassified | 1121 |
| 696 | nmdc:mga0rr50_6737_c1 | 3300050513 | Bacteria | 7033 |
| 697 | nmdc:mga0a205_24558_c1 | 3300050515 | Bacteria | 5733 |
| 698 | nmdc:mga0a205_6374_c1 | 3300050515 | Bacteria | 10660 |
| 699 | Ga0495601_0000152 | 3300053077 | Bacteria | 38651 |
| 700 | Ga0495601_0001120 | 3300053077 | Bacteria | 14681 |
| 701 | Ga0495601_0004716 | 3300053077 | Bacteria | 7902 |
| 702 | Ga0495601_0005030 | 3300053077 | Bacteria | 7674 |
| 703 | Ga0495601_0023714 | 3300053077 | Bacteria | 3773 |
| 704 | Ga0495612_0002232 | 3300053078 | Bacteria | 7962 |
| 705 | Ga0495612_0020911 | 3300053078 | Bacteria | 2623 |
| 706 | Ga0495612_0021545 | 3300053078 | Bacteria | 2585 |
| 707 | Ga0495612_0022824 | 3300053078 | Bacteria | 2509 |
| 708 | Ga0495655_0050225 | 3300053083 | Unclassified | 1101 |
| 709 | Ga0495595_0001962 | 3300053084 | Bacteria | 7990 |
| 710 | Ga0495595_0002054 | 3300053084 | Bacteria | 7834 |
| 711 | Ga0495595_0006148 | 3300053084 | Bacteria | 4881 |
| 712 | Ga0495595_0017630 | 3300053084 | Bacteria | 3074 |
| 713 | Ga0495595_0059800 | 3300053084 | Bacteria | 1782 |
| 714 | Ga0495619_0000115 | 3300053085 | Bacteria | 58866 |
| 715 | Ga0495619_0000544 | 3300053085 | Bacteria | 24920 |
| 716 | Ga0495619_0003936 | 3300053085 | Bacteria | 9545 |
| 717 | Ga0495619_0005898 | 3300053085 | Bacteria | 7761 |
| 718 | Ga0495619_0043196 | 3300053085 | Bacteria | 2954 |
| 719 | Ga0495619_0078026 | 3300053085 | Bacteria | 2226 |
| 720 | Ga0495619_0105453 | 3300053085 | Bacteria | 1922 |
| 721 | Ga0500634_0013616 | 3300053161 | Bacteria | 4271 |
| 722 | Ga0501084_0208465 | 3300054114 | Bacteria | 1649 |
| 723 | Ga0590077_020703 | 3300059426 | Bacteria | 1397 |
| 724 | Ga0501082_0004834 | 3300060353 | Bacteria | 11749 |
| 725 | Ga0530510_0087209 | 3300061734 | Bacteria | 2274 |
| 726 | Ga0530510_0316801 | 3300061734 | Bacteria | 1169 |
| 727 | 2513693615 | 2513237101 | Bacteria | 7952346 |
| 728 | 2739249413 | 2738543013 | Bacteria | 5618633 |
| 729 | 2922362915 | 2922361189 | Bacteria | 7436256 |
| 730 | Ga0075428_100388411 | |||
| 731 | JGI24743J22301_10009365 | |||
| 732 | JGI24748J21848_1000379 | |||
| 733 | JGI24749J21850_1003401 | |||
| 734 | JGI25406J46586_10018950 | |||
| 735 | JGI25404J52841_10001295 | |||
| 736 | Ga0065707_10085662 | |||
| 737 | Ga0070658_10322796 | |||
| 738 | Ga0070676_10048185 | |||
| 739 | Ga0070676_10119518 | |||
| 740 | Ga0070683_100013424 | |||
| 741 | Ga0070683_100134501 | |||
| 742 | Ga0070683_100196511 | |||
| 743 | Ga0070690_100004147 | |||
| 744 | Ga0070690_100013183 | |||
| 745 | Ga0070690_100031922 | |||
| 746 | Ga0070690_100034122 | |||
| 747 | Ga0070690_100290678 | |||
| 748 | Ga0070670_100125297 | |||
| 749 | Ga0070670_100260477 | |||
| 750 | Ga0070677_10034785 | |||
| 751 | Ga0068869_100069513 | |||
| 752 | Ga0068869_100115512 | |||
| 753 | Ga0068869_100133797 | |||
| 754 | Ga0070666_10005392 | |||
| 755 | Ga0070666_10047402 | |||
| 756 | Ga0070666_10158790 | |||
| 757 | Ga0070666_10368508 | |||
| 758 | Ga0070680_100051961 | |||
| 759 | Ga0070682_100153724 | |||
| 760 | Ga0070682_100154886 | |||
| 761 | Ga0070682_100192993 | |||
| 762 | Ga0068868_100011144 | |||
| 763 | Ga0068868_100024999 | |||
| 764 | Ga0068868_100051947 | |||
| 765 | Ga0070660_100418923 | |||
| 766 | Ga0070689_100006311 | |||
| 767 | Ga0070689_100024447 | |||
| 768 | Ga0070689_100216748 | |||
| 769 | Ga0070691_10052807 | |||
| 770 | Ga0070661_100068941 | |||
| 771 | Ga0070661_100152424 | |||
| 772 | Ga0070692_10028338 | |||
| 773 | Ga0070668_100054851 | |||
| 774 | Ga0070669_100292261 | |||
| 775 | Ga0070675_100015692 | |||
| 776 | Ga0070675_100023459 | |||
| 777 | Ga0070675_100049133 | |||
| 778 | Ga0070675_100052961 | |||
| 779 | Ga0070675_100262109 | |||
| 780 | Ga0070671_100012390 | |||
| 781 | Ga0070671_100068953 | |||
| 782 | Ga0070671_100130177 | |||
| 783 | Ga0070671_100192068 | |||
| 784 | Ga0070671_100312462 | |||
| 785 | Ga0070674_100051660 | |||
| 786 | Ga0070673_100006994 | |||
| 787 | Ga0070673_100019007 | |||
| 788 | Ga0070673_100081294 | |||
| 789 | Ga0070673_100210722 | |||
| 790 | Ga0070688_100001567 | |||
| 791 | Ga0070688_100018910 | |||
| 792 | Ga0070659_100200244 | |||
| 793 | Ga0070659_100205352 | |||
| 794 | Ga0070667_100026295 | |||
| 795 | Ga0070667_100028580 | |||
| 796 | Ga0070667_100052782 | |||
| 797 | Ga0070667_100219061 | |||
| 798 | Ga0070709_10001527 | |||
| 799 | Ga0070709_10330503 | |||
| 800 | Ga0070714_100044057 | |||
| 801 | Ga0070713_100009205 | |||
| 802 | Ga0070713_100070099 | |||
| 803 | Ga0070710_10002893 | |||
| 804 | Ga0070710_10007779 | |||
| 805 | Ga0070701_10078744 | |||
| 806 | Ga0070711_100007009 | |||
| 807 | Ga0070711_100026301 | |||
| 808 | Ga0070711_100080541 | |||
| 809 | Ga0070711_100238889 | |||
| 810 | Ga0070705_100128362 | |||
| 811 | Ga0070700_100018633 | |||
| 812 | Ga0070700_100131766 | |||
| 813 | Ga0070700_100167168 | |||
| 814 | Ga0070700_100201052 | |||
| 815 | Ga0070700_100315023 | |||
| 816 | Ga0070694_100087635 | |||
| 817 | Ga0070694_100118723 | |||
| 818 | Ga0070708_100261999 | |||
| 819 | Ga0070678_100013433 | |||
| 820 | Ga0070678_100041779 | |||
| 821 | Ga0070678_100090121 | |||
| 822 | Ga0070678_100104088 | |||
| 823 | Ga0070678_100167626 | |||
| 824 | Ga0070662_100080601 | |||
| 825 | Ga0070681_10007657 | |||
| 826 | Ga0070681_10079041 | |||
| 827 | Ga0070681_10178565 | |||
| 828 | Ga0068867_100010069 | |||
| 829 | Ga0068867_100323291 | |||
| 830 | Ga0070685_10248164 | |||
| 831 | Ga0070679_100445525 | |||
| 832 | Ga0070684_100029686 | |||
| 833 | Ga0070684_100036565 | |||
| 834 | Ga0070684_100275657 | |||
| 835 | Ga0068853_100027547 | |||
| 836 | Ga0070672_100007677 | |||
| 837 | Ga0070672_100067888 | |||
| 838 | Ga0070672_100128413 | |||
| 839 | Ga0070672_100134708 | |||
| 840 | Ga0070672_100311696 | |||
| 841 | Ga0070686_100006669 | |||
| 842 | Ga0070686_100151908 | |||
| 843 | Ga0070686_100178768 | |||
| 844 | Ga0070686_100281042 | |||
| 845 | Ga0070695_100185563 | |||
| 846 | Ga0070693_100081502 | |||
| 847 | Ga0070665_100035742 | |||
| 848 | Ga0070665_100106110 | |||
| 849 | Ga0070665_100146891 | |||
| 850 | Ga0070665_100248801 | |||
| 851 | Ga0070664_100044055 | |||
| 852 | Ga0070664_100183891 | |||
| 853 | Ga0068857_100082490 | |||
| 854 | Ga0068857_100082942 | |||
| 855 | Ga0068857_100380529 | |||
| 856 | Ga0068854_100151009 | |||
| 857 | Ga0068856_100042879 | |||
| 858 | Ga0070702_100093460 | |||
| 859 | Ga0070702_100104263 | |||
| 860 | Ga0070702_100150482 | |||
| 861 | Ga0068852_100026913 | |||
| 862 | Ga0068859_100013289 | |||
| 863 | Ga0068859_100053039 | |||
| 864 | Ga0068859_100113304 | |||
| 865 | Ga0068864_100022881 | |||
| 866 | Ga0068864_100028183 | |||
| 867 | Ga0068864_100090043 | |||
| 868 | Ga0068864_100130065 | |||
| 869 | Ga0068866_10015259 | |||
| 870 | Ga0068866_10067513 | |||
| 871 | Ga0068861_100016553 | |||
| 872 | Ga0068861_100090792 | |||
| 873 | Ga0068851_10023517 | |||
| 874 | Ga0068870_10136954 | |||
| 875 | Ga0068863_100049738 | |||
| 876 | Ga0068863_100279471 | |||
| 877 | Ga0068863_100303019 | |||
| 878 | Ga0068858_100005710 | |||
| 879 | Ga0068858_100021701 | |||
| 880 | Ga0068858_100170703 | |||
| 881 | Ga0068858_100344051 | |||
| 882 | Ga0068858_100422744 | |||
| 883 | Ga0068860_100122724 | |||
| 884 | Ga0068860_100355989 | |||
| 885 | Ga0068860_100561269 | |||
| 886 | Ga0068862_100070336 | |||
| 887 | Ga0068862_100076120 | |||
| 888 | Ga0081455_10008059 | |||
| 889 | Ga0081455_10109003 | |||
| 890 | Ga0081540_1018178 | |||
| 891 | Ga0081539_10003231 | |||
| 892 | Ga0070717_10000378 | |||
| 893 | Ga0070717_10175425 | |||
| 894 | Ga0075365_10006652 | |||
| 895 | Ga0075365_10018969 | |||
| 896 | Ga0075363_100040777 | |||
| 897 | Ga0070716_100003615 | |||
| 898 | Ga0070716_100034168 | |||
| 899 | Ga0070712_100045755 | |||
| 900 | Ga0070712_100140778 | |||
| 901 | Ga0075362_10112408 | |||
| 902 | Ga0075427_10000064 | |||
| 903 | Ga0097621_100002046 | |||
| 904 | Ga0097621_100018187 | |||
| 905 | Ga0097621_100092959 | |||
| 906 | Ga0068871_100002303 | |||
| 907 | Ga0068871_100020288 | |||
| 908 | Ga0068871_100033463 | |||
| 909 | Ga0068871_100063616 | |||
| 910 | Ga0068871_100069620 | |||
| 911 | Ga0068871_100077886 | |||
| 912 | Ga0068871_100078812 | |||
| 913 | Ga0075428_100000448 | |||
| 914 | Ga0075428_100000967 | |||
| 915 | Ga0075430_100001050 | |||
| 916 | Ga0075430_100171161 | |||
| 917 | Ga0075431_100003360 | |||
| 918 | Ga0075433_10012052 | |||
| 919 | Ga0075434_100026403 | |||
| 920 | Ga0075434_100028341 | |||
| 921 | Ga0075434_100483589 | |||
| 922 | Ga0075429_100002015 | |||
| 923 | Ga0075429_100002988 | |||
| 924 | Ga0075429_100049000 | |||
| 925 | Ga0075429_100073404 | |||
| 926 | Ga0068865_100010270 | |||
| 927 | Ga0068865_100025806 | |||
| 928 | Ga0068865_100228400 | |||
| 929 | Ga0097620_100013289 | |||
| 930 | Ga0097620_100053040 | |||
| 931 | Ga0097620_100113298 | |||
| 932 | Ga0075435_100004859 | |||
| 933 | Ga0075435_100073453 | |||
| 934 | Ga0075435_100245235 | |||
| 935 | Ga0105251_10008344 | |||
| 936 | Ga0105251_10066128 | |||
| 937 | Ga0105244_10037406 | |||
| 938 | Ga0105240_10137768 | |||
| 939 | Ga0105240_10450240 | |||
| 940 | Ga0111539_10002898 | |||
| 941 | Ga0111539_10006831 | |||
| 942 | Ga0111539_10009942 | |||
| 943 | Ga0111539_10040460 | |||
| 944 | Ga0111539_10517453 | |||
| 945 | Ga0105245_10029765 | |||
| 946 | Ga0105245_10052248 | |||
| 947 | Ga0105245_10196882 | |||
| 948 | Ga0105245_10212986 | |||
| 949 | Ga0105245_10357993 | |||
| 950 | Ga0114129_10008407 | |||
| 951 | Ga0114129_10054819 | |||
| 952 | Ga0114129_10240271 | |||
| 953 | Ga0114129_10628923 | |||
| 954 | Ga0105243_10006140 | |||
| 955 | Ga0105243_10031503 | |||
| 956 | Ga0105241_10002857 | |||
| 957 | Ga0105241_10049635 | |||
| 958 | Ga0105241_10356108 | |||
| 959 | Ga0105242_10006587 | |||
| 960 | Ga0105242_10025049 | |||
| 961 | Ga0105242_10180412 | |||
| 962 | Ga0105248_10015999 | |||
| 963 | Ga0105248_10022700 | |||
| 964 | Ga0105248_10030928 | |||
| 965 | Ga0105248_10032918 | |||
| 966 | Ga0105248_10116517 | |||
| 967 | Ga0105237_10031682 | |||
| 968 | Ga0105237_10252698 | |||
| 969 | Ga0105238_10019101 | |||
| 970 | Ga0105238_10103993 | |||
| 971 | Ga0105238_10488187 | |||
| 972 | Ga0105239_10100375 | |||
| 973 | Ga0105239_10563999 | |||
| 974 | Ga0105239_11030447 | |||
| 975 | Ga0105246_10015821 | |||
| 976 | Ga0105246_10050197 | |||
| 977 | Ga0105246_10430762 | |||
| 978 | Ga0157369_10537981 | |||
| 979 | Ga0157374_10017030 | |||
| 980 | Ga0157374_10151613 | |||
| 981 | Ga0157378_10015392 | |||
| 982 | Ga0163162_10007279 | |||
| 983 | Ga0163162_10038416 | |||
| 984 | Ga0163162_10114426 | |||
| 985 | Ga0163162_10283591 | |||
| 986 | Ga0163162_10352946 | |||
| 987 | Ga0157372_10336778 | |||
| 988 | Ga0157372_10465060 | |||
| 989 | Ga0157375_10049962 | |||
| 990 | Ga0157375_10067078 | |||
| 991 | Ga0157375_10070507 | |||
| 992 | Ga0157375_10167191 | |||
| 993 | Ga0157375_10271585 | |||
| 994 | Ga0163163_10051995 | |||
| 995 | Ga0157380_10195163 | |||
| 996 | Ga0157380_10465709 | |||
| 997 | Ga0182008_10013760 | |||
| 998 | Ga0157377_10001697 | |||
| 999 | Ga0157377_10175826 | |||
| 1000 | Ga0157379_10044044 | |||
| 1001 | Ga0157379_10065976 | |||
| 1002 | Ga0157379_10263871 | |||
| 1003 | Ga0157376_10007504 | |||
| 1004 | Ga0157376_10114368 | |||
| 1005 | Ga0157376_10135535 | |||
| 1006 | Ga0157376_10375403 | |||
| 1007 | Ga0182007_10000918 | |||
| 1008 | Ga0163161_10031508 | |||
| 1009 | Ga0163161_10083593 | |||
| 1010 | Ga0163161_10087535 | |||
| 1011 | Ga0207697_10018773 | |||
| 1012 | Ga0207697_10025227 | |||
| 1013 | Ga0207656_10014038 | |||
| 1014 | Ga0207696_1048005 | |||
| 1015 | Ga0207682_10002811 | |||
| 1016 | Ga0207692_10004188 | |||
| 1017 | Ga0207642_10003568 | |||
| 1018 | Ga0207642_10078176 | |||
| 1019 | Ga0207710_10003481 | |||
| 1020 | Ga0207710_10003917 | |||
| 1021 | Ga0207688_10000990 | |||
| 1022 | Ga0207688_10007616 | |||
| 1023 | Ga0207688_10048716 | |||
| 1024 | Ga0207680_10005429 | |||
| 1025 | Ga0207680_10042100 | |||
| 1026 | Ga0207685_10002461 | |||
| 1027 | Ga0207685_10040702 | |||
| 1028 | Ga0207699_10001414 | |||
| 1029 | Ga0207699_10035373 | |||
| 1030 | Ga0207699_10070614 | |||
| 1031 | Ga0207645_10018793 | |||
| 1032 | Ga0207645_10092678 | |||
| 1033 | Ga0207645_10103058 | |||
| 1034 | Ga0207645_10187825 | |||
| 1035 | Ga0207643_10000401 | |||
| 1036 | Ga0207643_10074129 | |||
| 1037 | Ga0207643_10079757 | |||
| 1038 | Ga0207654_10004249 | |||
| 1039 | Ga0207654_10204631 | |||
| 1040 | Ga0207707_10030138 | |||
| 1041 | Ga0207707_10126397 | |||
| 1042 | Ga0207707_10140475 | |||
| 1043 | Ga0207707_10179447 | |||
| 1044 | Ga0207671_10174565 | |||
| 1045 | Ga0207671_10291848 | |||
| 1046 | Ga0207693_10011667 | |||
| 1047 | Ga0207693_10021607 | |||
| 1048 | Ga0207693_10061055 | |||
| 1049 | Ga0207693_10131485 | |||
| 1050 | Ga0207663_10046347 | |||
| 1051 | Ga0207663_10053755 | |||
| 1052 | Ga0207660_10021413 | |||
| 1053 | Ga0207662_10002358 | |||
| 1054 | Ga0207662_10039515 | |||
| 1055 | Ga0207657_10118040 | |||
| 1056 | Ga0207649_10019229 | |||
| 1057 | Ga0207652_10251507 | |||
| 1058 | Ga0207681_10028847 | |||
| 1059 | Ga0207681_10189832 | |||
| 1060 | Ga0207694_10075790 | |||
| 1061 | Ga0207694_10320028 | |||
| 1062 | Ga0207650_10015019 | |||
| 1063 | Ga0207659_10010758 | |||
| 1064 | Ga0207659_10010852 | |||
| 1065 | Ga0207659_10028037 | |||
| 1066 | Ga0207659_10030900 | |||
| 1067 | Ga0207659_10221212 | |||
| 1068 | Ga0207687_10009654 | |||
| 1069 | Ga0207687_10015928 | |||
| 1070 | Ga0207687_10022301 | |||
| 1071 | Ga0207687_10187326 | |||
| 1072 | Ga0207700_10005138 | |||
| 1073 | Ga0207700_10075050 | |||
| 1074 | Ga0207664_10003302 | |||
| 1075 | Ga0207644_10002298 | |||
| 1076 | Ga0207644_10012793 | |||
| 1077 | Ga0207644_10181705 | |||
| 1078 | Ga0207644_10263339 | |||
| 1079 | Ga0207690_10021475 | |||
| 1080 | Ga0207706_10009345 | |||
| 1081 | Ga0207706_10010690 | |||
| 1082 | Ga0207706_10026853 | |||
| 1083 | Ga0207686_10004054 | |||
| 1084 | Ga0207686_10124343 | |||
| 1085 | Ga0207686_10230580 | |||
| 1086 | Ga0207709_10016749 | |||
| 1087 | Ga0207670_10000656 | |||
| 1088 | Ga0207670_10014147 | |||
| 1089 | Ga0207669_10032664 | |||
| 1090 | Ga0207669_10079274 | |||
| 1091 | Ga0207704_10065748 | |||
| 1092 | Ga0207665_10005865 | |||
| 1093 | Ga0207665_10038750 | |||
| 1094 | Ga0207691_10002719 | |||
| 1095 | Ga0207691_10013556 | |||
| 1096 | Ga0207691_10080853 | |||
| 1097 | Ga0207691_10145597 | |||
| 1098 | Ga0207691_10161006 | |||
| 1099 | Ga0207711_10011703 | |||
| 1100 | Ga0207711_10060016 | |||
| 1101 | Ga0207711_10064226 | |||
| 1102 | Ga0207689_10021839 | |||
| 1103 | Ga0207689_10038393 | |||
| 1104 | Ga0207661_10122512 | |||
| 1105 | Ga0207679_10059717 | |||
| 1106 | Ga0207651_10013019 | |||
| 1107 | Ga0207651_10013319 | |||
| 1108 | Ga0207651_10100460 | |||
| 1109 | Ga0207651_10109927 | |||
| 1110 | Ga0207651_10135376 | |||
| 1111 | Ga0207651_10251835 | |||
| 1112 | Ga0207651_10266581 | |||
| 1113 | Ga0207712_10007514 | |||
| 1114 | Ga0207668_10068810 | |||
| 1115 | Ga0207668_10102175 | |||
| 1116 | Ga0207658_10009391 | |||
| 1117 | Ga0207658_10121796 | |||
| 1118 | Ga0207677_10007106 | |||
| 1119 | Ga0207677_10174976 | |||
| 1120 | Ga0207677_10327824 | |||
| 1121 | Ga0207703_10010690 | |||
| 1122 | Ga0207703_10070430 | |||
| 1123 | Ga0207703_10332990 | |||
| 1124 | Ga0207678_10015702 | |||
| 1125 | Ga0207678_10099529 | |||
| 1126 | Ga0207708_10004051 | |||
| 1127 | Ga0207708_10004545 | |||
| 1128 | Ga0207708_10111665 | |||
| 1129 | Ga0207708_10285369 | |||
| 1130 | Ga0207702_10030813 | |||
| 1131 | Ga0207702_10179538 | |||
| 1132 | Ga0207641_10011065 | |||
| 1133 | Ga0207641_10086580 | |||
| 1134 | Ga0207648_10031557 | |||
| 1135 | Ga0207648_10048220 | |||
| 1136 | Ga0207676_10005605 | |||
| 1137 | Ga0207676_10008174 | |||
| 1138 | Ga0207676_10029341 | |||
| 1139 | Ga0207674_10010261 | |||
| 1140 | Ga0207674_10043527 | |||
| 1141 | Ga0207674_10374583 | |||
| 1142 | Ga0207675_100092741 | |||
| 1143 | Ga0207683_10001187 | |||
| 1144 | Ga0207683_10001573 | |||
| 1145 | Ga0207683_10022534 | |||
| 1146 | Ga0207683_10056244 | |||
| 1147 | Ga0207683_10084530 | |||
| 1148 | Ga0207683_10085445 | |||
| 1149 | Ga0207683_10086404 | |||
| 1150 | Ga0207683_10090880 | |||
| 1151 | Ga0207683_10108527 | |||
| 1152 | Ga0207698_10088047 | |||
| 1153 | Ga0209995_1005005 | |||
| 1154 | Ga0209982_1008525 | |||
| 1155 | Ga0209974_10006906 | |||
| 1156 | Ga0207428_10001083 | |||
| 1157 | Ga0207428_10002784 | |||
| 1158 | Ga0207428_10002888 | |||
| 1159 | Ga0207428_10009642 | |||
| 1160 | Ga0268266_10004945 | |||
| 1161 | Ga0268266_10269418 | |||
| 1162 | Ga0268264_10050989 | |||
| 1163 | Ga0268264_10058053 | |||
| 1164 | Ga0268264_10398261 | |||
| 1165 | Ga0265320_10096454 | |||
| 1166 | Ga0265325_10112626 | |||
| 1167 | Ga0265329_10008365 | |||
| 1168 | Ga0265340_10016163 | |||
| 1169 | Ga0265331_10003802 | |||
| 1170 | Ga0265331_10027506 | |||
| 1171 | Ga0265331_10072894 | |||
| 1172 | Ga0265316_10026251 | |||
| 1173 | Ga0265316_10244851 | |||
| 1174 | Ga0265313_10010130 | |||
| 1175 | Ga0265314_10000394 | |||
| 1176 | Ga0265314_10007419 | |||
| 1177 | Ga0265342_10030198 | |||
| 1178 | Ga0307410_10355220 | |||
| 1179 | Ga0307409_100219389 | |||
| 1180 | Ga0307416_100063889 | |||
| 1181 | Ga0307416_100510525 | |||
| 1182 | Ga0307416_100603984 | |||
| 1183 | Ga0307411_10023471 | |||
| 1184 | Ga0307415_100099696 | |||
| 1185 | Ga0373948_0003259 | |||
| 1186 | Ga0373938_0007363 | |||
| 1187 | Ga0373926_0050968 | |||
| 1188 | Ga0373928_0007096 | |||
| 1189 | Ga0373928_0009350 | |||
| 1190 | Ga0373944_0011279 | |||
| 1191 | Ga0373936_0033702 | |||
| 1192 | Ga0373936_0083966 | |||
| 1193 | Ga0373936_0097073 | |||
| 1194 | Ga0373939_0002202 | |||
| 1195 | Ga0373954_0016722 | |||
| 1196 | Ga0373957_0086636 | |||
| 1197 | Ga0373960_0014091 | |||
| 1198 | Ga0373943_0002844 | |||
| 1199 | Ga0373955_0003402 | |||
| 1200 | Ga0373955_0005412 | |||
| 1201 | Ga0373955_0031245 | |||
| 1202 | Ga0373962_0001159 | |||
| 1203 | Ga0373924_0126168 | |||
| 1204 | Ga0373931_0000377 | |||
| 1205 | Ga0373931_0001635 | |||
| 1206 | Ga0373931_0005853 | |||
| 1207 | Ga0373935_0020879 | |||
| 1208 | Ga0373935_0036203 | |||
| 1209 | Ga0373937_0023451 | |||
| 1210 | Ga0373937_0076963 | |||
| 1211 | Ga0373937_0186509 | |||
| 1212 | Ga0373925_0070220 | |||
| 1213 | Ga0373925_0321645 | |||
| 1214 | Ga0451807_2464558 | |||
| 1215 | Ga0439441_005885 | |||
| 1216 | Ga0439460_0047779 | |||
| 1217 | Ga0450916_010742 | |||
| 1218 | Ga0466969_0087749 | |||
| 1219 | Ga0451576_0041505 | |||
| 1220 | Ga0495592_0001183 | |||
| 1221 | Ga0495592_0010278 | |||
| 1222 | Ga0495592_0013701 | |||
| 1223 | Ga0495592_0059898 | |||
| 1224 | Ga0495603_0003568 | |||
| 1225 | Ga0495591_063947 | |||
| 1226 | Ga0495629_0000026 | |||
| 1227 | Ga0495641_0017257 | |||
| 1228 | Ga0495651_0006473 | |||
| 1229 | Ga0495653_0006528 | |||
| 1230 | Ga0495653_0084360 | |||
| 1231 | Ga0495653_0088061 | |||
| 1232 | Ga0495580_0099536 | |||
| 1233 | Ga0495582_0010491 | |||
| 1234 | Ga0495639_0000829 | |||
| 1235 | Ga0495639_0043613 | |||
| 1236 | Ga0495664_0016991 | |||
| 1237 | Ga0495664_0017341 | |||
| 1238 | Ga0495664_0062951 | |||
| 1239 | Ga0495594_0013609 | |||
| 1240 | Ga0495596_0114757 | |||
| 1241 | Ga0495608_0015339 | |||
| 1242 | Ga0495608_0031115 | |||
| 1243 | Ga0495608_0065655 | |||
| 1244 | Ga0495618_0004629 | |||
| 1245 | Ga0495628_0012354 | |||
| 1246 | Ga0495628_0048949 | |||
| 1247 | Ga0495630_0022981 | |||
| 1248 | Ga0495630_0099406 | |||
| 1249 | Ga0495643_0025697 | |||
| 1250 | Ga0495642_0026902 | |||
| 1251 | Ga0495652_0013358 | |||
| 1252 | Ga0495652_0019752 | |||
| 1253 | Ga0495652_0173519 | |||
| 1254 | Ga0495640_0011653 | |||
| 1255 | Ga0495640_0069472 | |||
| 1256 | Ga0495640_0200287 | |||
| 1257 | Ga0495587_0002158 | |||
| 1258 | Ga0495587_0079341 | |||
| 1259 | Ga0495598_0014852 | |||
| 1260 | Ga0495645_0004873 | |||
| 1261 | Ga0495645_0005953 | |||
| 1262 | Ga0495645_0182553 | |||
| 1263 | Ga0495667_0004643 | |||
| 1264 | Ga0495667_0006737 | |||
| 1265 | Ga0495667_0052211 | |||
| 1266 | Ga0495667_0080018 | |||
| 1267 | Ga0495656_0058592 | |||
| 1268 | Ga0495634_0055792 | |||
| 1269 | Ga0495634_0080755 | |||
| 1270 | Ga0495634_0110840 | |||
| 1271 | Ga0495634_0123256 | |||
| 1272 | Ga0495634_0218201 | |||
| 1273 | Ga0495635_0011540 | |||
| 1274 | Ga0495635_0014610 | |||
| 1275 | Ga0495635_0036043 | |||
| 1276 | Ga0495635_0043829 | |||
| 1277 | Ga0495635_0231116 | |||
| 1278 | Ga0495588_0037337 | |||
| 1279 | Ga0495657_0004096 | |||
| 1280 | Ga0495657_0021580 | |||
| 1281 | Ga0495599_0008501 | |||
| 1282 | Ga0495623_0002369 | |||
| 1283 | Ga0495623_0002592 | |||
| 1284 | Ga0495623_0005955 | |||
| 1285 | Ga0495646_0001551 | |||
| 1286 | Ga0495658_0001832 | |||
| 1287 | Ga0495658_0033104 | |||
| 1288 | Ga0495658_0043316 | |||
| 1289 | Ga0495669_0029785 | |||
| 1290 | Ga0495600_0080564 | |||
| 1291 | Ga0495581_0020165 | |||
| 1292 | Ga0495604_0012226 | |||
| 1293 | Ga0495604_0027565 | |||
| 1294 | Ga0495604_0202525 | |||
| 1295 | Ga0495674_0018822 | |||
| 1296 | Ga0495674_0032302 | |||
| 1297 | Ga0495676_0023279 | |||
| 1298 | Ga0495676_0073019 | |||
| 1299 | Ga0495676_0105554 | |||
| 1300 | Ga0495680_0001148 | |||
| 1301 | Ga0495680_0002496 | |||
| 1302 | Ga0495680_0002890 | |||
| 1303 | Ga0495680_0061591 | |||
| 1304 | Ga0495680_0293825 | |||
| 1305 | Ga0495675_0000903 | |||
| 1306 | Ga0495675_0020171 | |||
| 1307 | Ga0495684_0055037 | |||
| 1308 | Ga0495593_0024539 | |||
| 1309 | Ga0495593_0119719 | |||
| 1310 | Ga0495602_0007794 | |||
| 1311 | Ga0495602_0015488 | |||
| 1312 | Ga0495602_0154194 | |||
| 1313 | Ga0495602_0190573 | |||
| 1314 | Ga0496100_0055293 | |||
| 1315 | Ga0496100_0071984 | |||
| 1316 | Ga0496101_0018322 | |||
| 1317 | Ga0496101_0085666 | |||
| 1318 | Ga0496101_0087092 | |||
| 1319 | Ga0496101_0456998 | |||
| 1320 | Ga0496102_0001102 | |||
| 1321 | Ga0496102_0015478 | |||
| 1322 | Ga0496102_0029922 | |||
| 1323 | Ga0496102_0083858 | |||
| 1324 | Ga0496102_0134912 | |||
| 1325 | Ga0496103_0001332 | |||
| 1326 | Ga0496103_0015537 | |||
| 1327 | Ga0496104_0000524 | |||
| 1328 | Ga0496104_0191591 | |||
| 1329 | Ga0496104_0236525 | |||
| 1330 | Ga0496104_0336372 | |||
| 1331 | Ga0496104_0432225 | |||
| 1332 | Ga0496104_0455154 | |||
| 1333 | Ga0496105_0010077 | |||
| 1334 | Ga0496105_0012640 | |||
| 1335 | Ga0496105_0053793 | |||
| 1336 | Ga0496105_0054998 | |||
| 1337 | Ga0496105_0059853 | |||
| 1338 | Ga0496105_0093825 | |||
| 1339 | Ga0496105_0293877 | |||
| 1340 | Ga0496106_0003107 | |||
| 1341 | Ga0496106_0012080 | |||
| 1342 | Ga0496106_0139832 | |||
| 1343 | Ga0496107_0009585 | |||
| 1344 | Ga0496107_0107906 | |||
| 1345 | Ga0496107_0145808 | |||
| 1346 | Ga0496108_0017206 | |||
| 1347 | Ga0496108_0037054 | |||
| 1348 | Ga0496108_0335004 | |||
| 1349 | Ga0496109_0059151 | |||
| 1350 | Ga0496109_0114840 | |||
| 1351 | Ga0496109_0132993 | |||
| 1352 | Ga0496110_0161010 | |||
| 1353 | Ga0496110_0247023 | |||
| 1354 | Ga0496111_0209899 | |||
| 1355 | Ga0496112_0033457 | |||
| 1356 | Ga0496112_0047201 | |||
| 1357 | Ga0496112_0053373 | |||
| 1358 | Ga0496112_0139851 | |||
| 1359 | Ga0496112_0216879 | |||
| 1360 | Ga0496113_0008910 | |||
| 1361 | Ga0496113_0182873 | |||
| 1362 | Ga0496113_0252081 | |||
| 1363 | Ga0496113_0284091 | |||
| 1364 | Ga0496114_0019963 | |||
| 1365 | Ga0496114_0022262 | |||
| 1366 | Ga0496114_0027029 | |||
| 1367 | Ga0496114_0035489 | |||
| 1368 | Ga0496114_0068999 | |||
| 1369 | Ga0496114_0083183 | |||
| 1370 | Ga0496114_0100880 | |||
| 1371 | Ga0496114_0139189 | |||
| 1372 | Ga0496114_0192872 | |||
| 1373 | Ga0496115_0009667 | |||
| 1374 | Ga0496115_0010728 | |||
| 1375 | Ga0496115_0022114 | |||
| 1376 | Ga0496115_0078506 | |||
| 1377 | Ga0496115_0130574 | |||
| 1378 | Ga0496115_0157288 | |||
| 1379 | Ga0501033_0016371 | |||
| 1380 | Ga0501033_0170345 | |||
| 1381 | Ga0501034_0158652 | |||
| 1382 | Ga0501036_0032020 | |||
| 1383 | Ga0501036_0137875 | |||
| 1384 | Ga0501039_0005613 | |||
| 1385 | Ga0501039_0092121 | |||
| 1386 | Ga0501039_0239389 | |||
| 1387 | Ga0501040_0013209 | |||
| 1388 | Ga0501041_0013321 | |||
| 1389 | Ga0501042_0023571 | |||
| 1390 | Ga0501047_0018304 | |||
| 1391 | Ga0501071_0012299 | |||
| 1392 | Ga0501074_0036521 | |||
| 1393 | Ga0501075_0000850 | |||
| 1394 | Ga0501076_0091753 | |||
| 1395 | Ga0501079_0019291 | |||
| 1396 | Ga0501080_0004907 | |||
| 1397 | Ga0501080_0128181 | |||
| 1398 | Ga0501080_0307959 | |||
| 1399 | Ga0501081_0000396 | |||
| 1400 | Ga0501083_0306561 | |||
| 1401 | Ga0501035_0016853 | |||
| 1402 | Ga0501044_0014976 | |||
| 1403 | Ga0501045_0023162 | |||
| 1404 | nmdc:mga0yw44_38355_c1 | |||
| 1405 | nmdc:mga06z11_23048_c1 | |||
| 1406 | nmdc:mga05p37_129_c2 | |||
| 1407 | nmdc:mga05p37_229923_c1 | |||
| 1408 | nmdc:mga09592_4060_c1 | |||
| 1409 | nmdc:mga09592_4639_c1 | |||
| 1410 | nmdc:mga09592_90509_c1 | |||
| 1411 | nmdc:mga09592_9848_c1 | |||
| 1412 | nmdc:mga0qj67_252132_c1 | |||
| 1413 | nmdc:mga0qj67_258548_c1 | |||
| 1414 | nmdc:mga0qj67_426099_c1 | |||
| 1415 | nmdc:mga08y16_1682_c1 | |||
| 1416 | nmdc:mga08y16_33305_c1 | |||
| 1417 | nmdc:mga08y16_39116_c1 | |||
| 1418 | nmdc:mga08y16_5239_c1 | |||
| 1419 | nmdc:mga08y16_7844_c1 | |||
| 1420 | nmdc:mga0n895_142806_c1 | |||
| 1421 | nmdc:mga0n895_1756_c1 | |||
| 1422 | nmdc:mga0n895_531143_c1 | |||
| 1423 | nmdc:mga0rr50_15183_c1 | |||
| 1424 | nmdc:mga0rr50_427239_c1 | |||
| 1425 | nmdc:mga0rr50_6737_c1 | |||
| 1426 | nmdc:mga0a205_24558_c1 | |||
| 1427 | nmdc:mga0a205_6374_c1 | |||
| 1428 | Ga0495601_0000152 | |||
| 1429 | Ga0495601_0001120 | |||
| 1430 | Ga0495601_0004716 | |||
| 1431 | Ga0495601_0005030 | |||
| 1432 | Ga0495601_0023714 | |||
| 1433 | Ga0495612_0002232 | |||
| 1434 | Ga0495612_0020911 | |||
| 1435 | Ga0495612_0021545 | |||
| 1436 | Ga0495612_0022824 | |||
| 1437 | Ga0495655_0050225 | |||
| 1438 | Ga0495595_0001962 | |||
| 1439 | Ga0495595_0002054 | |||
| 1440 | Ga0495595_0006148 | |||
| 1441 | Ga0495595_0017630 | |||
| 1442 | Ga0495595_0059800 | |||
| 1443 | Ga0495619_0000115 | |||
| 1444 | Ga0495619_0000544 | |||
| 1445 | Ga0495619_0003936 | |||
| 1446 | Ga0495619_0005898 | |||
| 1447 | Ga0495619_0043196 | |||
| 1448 | Ga0495619_0078026 | |||
| 1449 | Ga0495619_0105453 | |||
| 1450 | Ga0500634_0013616 | |||
| 1451 | Ga0501084_0208465 | |||
| 1452 | Ga0590077_020703 | |||
| 1453 | Ga0501082_0004834 | |||
| 1454 | Ga0530510_0087209 | |||
| 1455 | Ga0530510_0316801 | |||
| 1456 | 2513693615 | |||
| 1457 | 2739249413 | |||
| 1458 | 2922362915 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9573 | 27 | 323 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9551 | 26 | 323 |
| 2qpq-assembly3.cif.gz_C | structure of bug27 from bordetella pertussis | 0.9542 | 27 | 323 |
| 2qpq-assembly2.cif.gz_B | structure of bug27 from bordetella pertussis | 0.9519 | 26 | 323 |
| 8hk9-assembly2.cif.gz_A | apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis | 0.942 | 29 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9547 | 125 | 239 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9361 | 125 | 246 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9179 | 125 | 247 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9142 | 125 | 246 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9068 | 25 | 323 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127F4N8-F1-model_v4 | DHA2 family major facilitator superfamily protein | 0.9752 | 21 | 323 |
|
| AF-A0A1H7LIE8-F1-model_v4 | Tripartite-type tricarboxylate transporter, receptor component TctC | 0.9706 | 20 | 323 |
|
| AF-A0A7H0GIP4-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9693 | 51 | 323 |
|
| AF-T1XJ04-F1-model_v4 | Putative Bug-like extra-cytoplasmic solute receptor, TTT-family | 0.9692 | 53 | 323 |
|
| AF-A0A5F0THJ9-F1-model_v4 | deleted | 0.9692 | 117 | 273 |
|