F477853

General Info

Members Datasets Scaffolds Average Seq Length
729 257 1458 267

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10006226|Ga0081455_100062267
Length 302
Sequence MRVFDTAVRVAIRRKTQEWGAVKPLLAVDGDSLAHRAFHALPRSIRDAEGRPGNMIVGFTNMLAFVWEAEQPRTVFVGFDTLTTPTYRHELLPQYQSGRDFPPELTFQLDRLPELVEALGFAWAKEAGYEADDFLAGAVRSEGERNGETLVLTSDRDLFQLVSKKTTVLVPRRGVSELDRVDPDGVRERYGVDPEQVPDFIALRGDSSDKIPGAKGIGPGRAATILGRHDTLDGAIEAGVFDAQADDLRTYLRIARLRHEAPVPELPDAEPQWERAAELVEGWGHNALGKRLRERAGPTGNA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
224 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
254 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 6.58
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10006226 3300005937 Bacteria 12851
2 JGI25407J50210_10005902 3300003373 Bacteria 3029
3 JGI25407J50210_10053713 3300003373 Bacteria 1019
4 JGI25407J50210_10056905 3300003373 Bacteria 985
5 Ga0070658_10034810 3300005327 Bacteria 4053
6 Ga0070658_10124607 3300005327 Bacteria 2144
7 Ga0070658_10410511 3300005327 Bacteria 1164
8 Ga0070683_100016823 3300005329 Bacteria 6452
9 Ga0070683_100044654 3300005329 Bacteria 4087
10 Ga0070683_100091904 3300005329 Bacteria 2850
11 Ga0070683_100226245 3300005329 Bacteria 1778
12 Ga0070680_100012860 3300005336 Bacteria 6511
13 Ga0070680_100041925 3300005336 Bacteria 3712
14 Ga0070680_100073056 3300005336 Bacteria 2820
15 Ga0070680_100248010 3300005336 Bacteria 1505
16 Ga0070682_100321681 3300005337 Bacteria 1143
17 Ga0070660_100005006 3300005339 Bacteria 9162
18 Ga0070660_100012974 3300005339 Bacteria 5963
19 Ga0070660_100059187 3300005339 Bacteria 2971
20 Ga0070660_100063175 3300005339 Bacteria 2878
21 Ga0070660_100291890 3300005339 Bacteria 1335
22 Ga0070661_100022800 3300005344 Bacteria 4483
23 Ga0070671_100039747 3300005355 Bacteria 3905
24 Ga0070671_100235863 3300005355 Bacteria 1552
25 Ga0070659_100006234 3300005366 Bacteria 8616
26 Ga0070659_100099419 3300005366 Bacteria 2340
27 Ga0070709_10230710 3300005434 Bacteria 1324
28 Ga0070709_10336035 3300005434 Bacteria 1112
29 Ga0070714_100023746 3300005435 Bacteria 5041
30 Ga0070714_100083604 3300005435 Bacteria 2784
31 Ga0070714_100367419 3300005435 Unclassified 1354
32 Ga0070714_100851771 3300005435 Bacteria 884
33 Ga0070713_100047202 3300005436 Bacteria 3538
34 Ga0070713_100362014 3300005436 Bacteria 1348
35 Ga0070711_100025569 3300005439 Bacteria 3864
36 Ga0070694_100016269 3300005444 Bacteria 4682
37 Ga0070708_100001830 3300005445 Bacteria 16302
38 Ga0070663_100053722 3300005455 Bacteria 2876
39 Ga0070678_100230125 3300005456 Bacteria 1545
40 Ga0070662_100190380 3300005457 Unclassified 1622
41 Ga0070681_10003807 3300005458 Bacteria 14180
42 Ga0070681_10014174 3300005458 Bacteria 7935
43 Ga0070681_10081371 3300005458 Bacteria 3194
44 Ga0070681_10113464 3300005458 Bacteria 2649
45 Ga0070681_10285511 3300005458 Bacteria 1561
46 Ga0068867_100102929 3300005459 Bacteria 2183
47 Ga0070707_100267612 3300005468 Bacteria 1662
48 Ga0070698_100093850 3300005471 Bacteria 2980
49 Ga0070679_100033402 3300005530 Bacteria 5094
50 Ga0070679_100057441 3300005530 Bacteria 3879
51 Ga0070679_100068650 3300005530 Bacteria 3535
52 Ga0070679_100295952 3300005530 Bacteria 1570
53 Ga0070684_100026109 3300005535 Bacteria 4917
54 Ga0070684_100055328 3300005535 Bacteria 3458
55 Ga0070684_100073756 3300005535 Bacteria 3008
56 Ga0070684_100108875 3300005535 Bacteria 2483
57 Ga0068853_100332617 3300005539 Bacteria 1410
58 Ga0070695_100000363 3300005545 Bacteria 23281
59 Ga0070665_100014812 3300005548 Bacteria 7829
60 Ga0068855_100019656 3300005563 Bacteria 8112
61 Ga0068855_100030292 3300005563 Bacteria 6473
62 Ga0068855_100071652 3300005563 Bacteria 4029
63 Ga0068855_100073087 3300005563 Bacteria 3985
64 Ga0068855_100130956 3300005563 Bacteria 2865
65 Ga0068855_100159773 3300005563 Bacteria 2559
66 Ga0068855_100184069 3300005563 Bacteria 2361
67 Ga0068855_100229603 3300005563 Bacteria 2079
68 Ga0068855_100342657 3300005563 Bacteria 1648
69 Ga0068855_100600840 3300005563 Bacteria 1186
70 Ga0068857_100054962 3300005577 Bacteria 3533
71 Ga0068857_100099263 3300005577 Bacteria 2612
72 Ga0068856_100028282 3300005614 Bacteria 5473
73 Ga0068856_100263649 3300005614 Bacteria 1739
74 Ga0068856_100427890 3300005614 Bacteria 1344
75 Ga0068852_100028464 3300005616 Bacteria 4574
76 Ga0068852_100275707 3300005616 Bacteria 1620
77 Ga0068861_100026725 3300005719 Bacteria 4198
78 Ga0081538_10000422 3300005981 Bacteria 47666
79 Ga0081538_10001675 3300005981 Bacteria 22591
80 Ga0081538_10006022 3300005981 Bacteria 10778
81 Ga0081538_10007727 3300005981 Bacteria 9259
82 Ga0081538_10014034 3300005981 Bacteria 6298
83 Ga0081538_10014948 3300005981 Bacteria 6043
84 Ga0081538_10019672 3300005981 Bacteria 5002
85 Ga0081538_10036896 3300005981 Bacteria 3181
86 Ga0081538_10083039 3300005981 Bacteria 1695
87 Ga0081538_10112506 3300005981 Bacteria 1332
88 Ga0081539_10030272 3300005985 Bacteria 3364
89 Ga0070715_10040843 3300006163 Bacteria 1941
90 Ga0070716_100330121 3300006173 Bacteria 1072
91 Ga0070712_100040232 3300006175 Bacteria 3204
92 Ga0070712_100303119 3300006175 Unclassified 1294
93 Ga0075428_100009740 3300006844 Bacteria 10674
94 Ga0075430_100029414 3300006846 Bacteria 4663
95 Ga0075430_100290084 3300006846 Unclassified 1353
96 Ga0075433_10130273 3300006852 Bacteria 2235
97 Ga0075433_10184140 3300006852 Bacteria 1858
98 Ga0075434_100026949 3300006871 Bacteria 5638
99 Ga0075434_100041074 3300006871 Bacteria 4581
100 Ga0075429_100002297 3300006880 Bacteria 16043
101 Ga0075435_100030491 3300007076 Bacteria 4242
102 Ga0075435_100036259 3300007076 Bacteria 3918
103 Ga0075435_100459600 3300007076 Bacteria 1098
104 Ga0105240_10090173 3300009093 Bacteria 3748
105 Ga0105240_10123419 3300009093 Bacteria 3116
106 Ga0105240_10131750 3300009093 Bacteria 2998
107 Ga0105240_10303356 3300009093 Bacteria 1826
108 Ga0105240_10553031 3300009093 Bacteria 1273
109 Ga0105245_10009806 3300009098 Bacteria 8345
110 Ga0105245_10952122 3300009098 Bacteria 902
111 Ga0114129_10025201 3300009147 Bacteria 8429
112 Ga0114129_10132686 3300009147 Bacteria 3419
113 Ga0114129_10448436 3300009147 Bacteria 1692
114 Ga0105243_10307113 3300009148 Bacteria 1440
115 Ga0105248_10055191 3300009177 Bacteria 4455
116 Ga0105237_10019269 3300009545 Bacteria 7048
117 Ga0105237_10034687 3300009545 Bacteria 5107
118 Ga0105249_10003773 3300009553 Bacteria 13079
119 Ga0105239_10142751 3300010375 Bacteria 2669
120 Ga0157371_10453006 3300013102 Bacteria 944
121 Ga0157370_10019774 3300013104 Bacteria 6741
122 Ga0157370_10026504 3300013104 Bacteria 5722
123 Ga0157370_10035304 3300013104 Bacteria 4862
124 Ga0157370_10046160 3300013104 Bacteria 4177
125 Ga0157370_10099117 3300013104 Bacteria 2731
126 Ga0157370_10112184 3300013104 Bacteria 2549
127 Ga0157369_10001698 3300013105 Bacteria 26844
128 Ga0157369_10007440 3300013105 Bacteria 12611
129 Ga0157369_10008364 3300013105 Bacteria 11867
130 Ga0157369_10016138 3300013105 Bacteria 8406
131 Ga0157369_10022141 3300013105 Bacteria 7100
132 Ga0157369_10112806 3300013105 Bacteria 2888
133 Ga0157369_10298148 3300013105 Bacteria 1677
134 Ga0157369_10775942 3300013105 Bacteria 985
135 Ga0157374_10014229 3300013296 Bacteria 6958
136 Ga0157374_10283589 3300013296 Bacteria 1636
137 Ga0163162_10087531 3300013306 Bacteria 3193
138 Ga0157372_10134907 3300013307 Bacteria 2842
139 Ga0157372_10144880 3300013307 Bacteria 2739
140 Ga0157372_10189655 3300013307 Bacteria 2381
141 Ga0157376_10021202 3300014969 Bacteria 5045
142 Ga0163161_10067961 3300017792 Bacteria 2603
143 Ga0206356_10185080 3300020070 Bacteria 1296
144 Ga0206354_11243756 3300020081 Bacteria 2703
145 Ga0206354_11249356 3300020081 Bacteria 1553
146 Ga0206353_10111715 3300020082 Bacteria 1036
147 Ga0206353_10157841 3300020082 Unclassified 1243
148 Ga0206353_10612681 3300020082 Bacteria 3918
149 Ga0206353_10848156 3300020082 Bacteria 2041
150 Ga0206353_11917284 3300020082 Bacteria 6374
151 Ga0207692_10088088 3300025898 Bacteria 1677
152 Ga0207685_10021829 3300025905 Bacteria 2152
153 Ga0207705_10005302 3300025909 Bacteria 9646
154 Ga0207705_10051193 3300025909 Bacteria 2973
155 Ga0207705_10243173 3300025909 Bacteria 1371
156 Ga0207707_10011640 3300025912 Bacteria 7656
157 Ga0207707_10025091 3300025912 Bacteria 5214
158 Ga0207707_10106801 3300025912 Bacteria 2447
159 Ga0207707_10557395 3300025912 Bacteria 973
160 Ga0207695_10095748 3300025913 Bacteria 2972
161 Ga0207695_10096999 3300025913 Bacteria 2949
162 Ga0207695_10122044 3300025913 Bacteria 2572
163 Ga0207671_10031828 3300025914 Bacteria 3929
164 Ga0207693_10014330 3300025915 Bacteria 6378
165 Ga0207693_10285205 3300025915 Unclassified 1294
166 Ga0207663_10012840 3300025916 Bacteria 4539
167 Ga0207663_10236219 3300025916 Bacteria 1338
168 Ga0207660_10124530 3300025917 Bacteria 1956
169 Ga0207660_10135627 3300025917 Bacteria 1878
170 Ga0207660_10440181 3300025917 Bacteria 1053
171 Ga0207657_10000073 3300025919 Bacteria 93299
172 Ga0207657_10010590 3300025919 Bacteria 9191
173 Ga0207657_10010720 3300025919 Bacteria 9125
174 Ga0207657_10015733 3300025919 Bacteria 7315
175 Ga0207657_10016460 3300025919 Bacteria 7132
176 Ga0207657_10169975 3300025919 Bacteria 1767
177 Ga0207657_10217177 3300025919 Bacteria 1533
178 Ga0207657_10267170 3300025919 Bacteria 1360
179 Ga0207649_10087909 3300025920 Bacteria 2028
180 Ga0207652_10006996 3300025921 Bacteria 9091
181 Ga0207652_10014110 3300025921 Bacteria 6469
182 Ga0207652_10043580 3300025921 Bacteria 3820
183 Ga0207652_10066846 3300025921 Bacteria 3116
184 Ga0207652_10125639 3300025921 Bacteria 2284
185 Ga0207652_10155830 3300025921 Bacteria 2046
186 Ga0207652_10301939 3300025921 Bacteria 1445
187 Ga0207646_10522375 3300025922 Bacteria 1069
188 Ga0207687_10030929 3300025927 Bacteria 3614
189 Ga0207700_10346287 3300025928 Bacteria 1293
190 Ga0207664_10050732 3300025929 Bacteria 3273
191 Ga0207664_10212151 3300025929 Bacteria 1676
192 Ga0207644_10024759 3300025931 Bacteria 4123
193 Ga0207644_10066089 3300025931 Bacteria 2632
194 Ga0207690_10090339 3300025932 Bacteria 2162
195 Ga0207690_10126148 3300025932 Bacteria 1867
196 Ga0207709_10298445 3300025935 Bacteria 1197
197 Ga0207665_10101995 3300025939 Bacteria 2005
198 Ga0207665_10447890 3300025939 Unclassified 990
199 Ga0207711_10037463 3300025941 Bacteria 4119
200 Ga0207661_10051814 3300025944 Bacteria 3276
201 Ga0207661_10133412 3300025944 Bacteria 2130
202 Ga0207661_10178672 3300025944 Bacteria 1852
203 Ga0207661_10187210 3300025944 Bacteria 1813
204 Ga0207661_10258791 3300025944 Bacteria 1549
205 Ga0207667_10059057 3300025949 Bacteria 4019
206 Ga0207667_10092544 3300025949 Unclassified 3122
207 Ga0207667_10255067 3300025949 Bacteria 1794
208 Ga0207667_10269579 3300025949 Unclassified 1740
209 Ga0207667_10341448 3300025949 Bacteria 1528
210 Ga0207668_10035770 3300025972 Bacteria 3310
211 Ga0207678_10111461 3300026067 Bacteria 2334
212 Ga0207678_10171981 3300026067 Bacteria 1850
213 Ga0207702_10106132 3300026078 Bacteria 2489
214 Ga0207674_10018144 3300026116 Bacteria 7656
215 Ga0207674_10018333 3300026116 Bacteria 7611
216 Ga0207675_100010255 3300026118 Bacteria 8778
217 Ga0207698_10029502 3300026142 Bacteria 3930
218 Ga0268266_10328542 3300028379 Bacteria 1433
219 Ga0265334_10042567 3300028573 Bacteria 1769
220 Ga0265322_10015994 3300028654 Bacteria 2166
221 Ga0265338_10006961 3300028800 Bacteria 14215
222 Ga0265338_10009734 3300028800 Bacteria 11403
223 Ga0265338_10017960 3300028800 Bacteria 7595
224 Ga0265338_10052017 3300028800 Bacteria 3681
225 Ga0265330_10049513 3300031235 Bacteria 1845
226 Ga0265332_10053381 3300031238 Bacteria 1735
227 Ga0265329_10024609 3300031242 Bacteria 1997
228 Ga0265340_10046471 3300031247 Bacteria 2118
229 Ga0265340_10084745 3300031247 Bacteria 1488
230 Ga0265339_10032722 3300031249 Bacteria 2932
231 Ga0265331_10026530 3300031250 Bacteria 2911
232 Ga0265327_10075855 3300031251 Bacteria 1672
233 Ga0265316_10031076 3300031344 Bacteria 4370
234 Ga0265313_10005968 3300031595 Bacteria 8803
235 Ga0265313_10013854 3300031595 Bacteria 4805
236 Ga0265314_10004242 3300031711 Bacteria 13437
237 Ga0265314_10061767 3300031711 Bacteria 2549
238 Ga0307416_100001175 3300032002 Bacteria 14020
239 Ga0307416_100208088 3300032002 Bacteria 1863
240 Ga0307411_10194302 3300032005 Bacteria 1552
241 Ga0373926_0037279 3300035083 Bacteria 1729
242 Ga0373926_0047112 3300035083 Bacteria 1548
243 Ga0373936_0201590 3300035113 Bacteria 878
244 Ga0373945_0081499 3300035116 Bacteria 1240
245 Ga0373943_0000966 3300035170 Bacteria 12768
246 Ga0373943_0002489 3300035170 Bacteria 8372
247 Ga0373946_0001677 3300035171 Bacteria 7717
248 Ga0373946_0006830 3300035171 Bacteria 4152
249 Ga0373955_0062400 3300035172 Bacteria 2061
250 Ga0373935_0054731 3300035692 Bacteria 2542
251 Ga0373927_0069903 3300035695 Bacteria 2273
252 Ga0373933_0048104 3300035724 Bacteria 2539
253 Ga0373933_0212166 3300035724 Bacteria 1241
254 Ga0373947_0003172 3300035725 Bacteria 9784
255 Ga0373947_0013716 3300035725 Bacteria 4643
256 Ga0373947_0085098 3300035725 Bacteria 1963
257 Ga0373937_0106697 3300036401 Bacteria 2604
258 Ga0373925_0003039 3300037068 Bacteria 13201
259 Ga0373925_0003069 3300037068 Bacteria 13129
260 Ga0373925_0045015 3300037068 Bacteria 3277
261 Ga0373925_0046324 3300037068 Bacteria 3233
262 Ga0395899_0005600 3300037312 Bacteria 9741
263 Ga0395899_0008184 3300037312 Bacteria 8057
264 Ga0395899_0018953 3300037312 Bacteria 5228
265 Ga0395899_0202562 3300037312 Bacteria 1383
266 Ga0395899_0255097 3300037312 Bacteria 1202
267 Ga0395900_0024282 3300037418 Bacteria 6207
268 Ga0395900_0053817 3300037418 Bacteria 4143
269 Ga0395900_0066345 3300037418 Bacteria 3708
270 Ga0395900_0068803 3300037418 Bacteria 3638
271 Ga0395900_0711476 3300037418 Bacteria 937
272 Ga0395898_0005945 3300037466 Bacteria 13105
273 Ga0395898_0017263 3300037466 Bacteria 7371
274 Ga0395898_0024048 3300037466 Bacteria 6148
275 Ga0395898_0034147 3300037466 Bacteria 5071
276 Ga0395898_0036588 3300037466 Bacteria 4874
277 Ga0395898_0043991 3300037466 Bacteria 4398
278 Ga0395898_0056155 3300037466 Bacteria 3839
279 Ga0395898_0109580 3300037466 Bacteria 2647
280 Ga0395898_0110163 3300037466 Bacteria 2639
281 Ga0395898_0154040 3300037466 Bacteria 2199
282 Ga0395898_0174641 3300037466 Bacteria 2054
283 Ga0395898_0295888 3300037466 Unclassified 1544
284 Ga0395898_0307813 3300037466 Bacteria 1511
285 Ga0395898_0552035 3300037466 Bacteria 1094
286 Ga0395898_0573064 3300037466 Bacteria 1071
287 Ga0395905_0014380 3300037471 Bacteria 7560
288 Ga0395905_0026654 3300037471 Bacteria 5449
289 Ga0395905_0041194 3300037471 Bacteria 4334
290 Ga0395905_0056928 3300037471 Bacteria 3656
291 Ga0395905_0162872 3300037471 Bacteria 2096
292 Ga0395905_0187114 3300037471 Bacteria 1943
293 Ga0395905_0219814 3300037471 Bacteria 1778
294 Ga0395901_0005220 3300038443 Bacteria 13111
295 Ga0395901_0005275 3300038443 Bacteria 13054
296 Ga0395901_0006754 3300038443 Bacteria 11586
297 Ga0395901_0024891 3300038443 Bacteria 6144
298 Ga0395901_0029426 3300038443 Bacteria 5656
299 Ga0395901_0037137 3300038443 Bacteria 5039
300 Ga0395901_0048751 3300038443 Bacteria 4399
301 Ga0395901_0051850 3300038443 Bacteria 4265
302 Ga0395901_0088596 3300038443 Bacteria 3237
303 Ga0395901_0097615 3300038443 Bacteria 3080
304 Ga0395901_0235105 3300038443 Bacteria 1912
305 Ga0395901_0249891 3300038443 Bacteria 1848
306 Ga0395901_0346299 3300038443 Unclassified 1534
307 Ga0395901_0592839 3300038443 Bacteria 1118
308 Ga0436363_1428459 3300039450 Bacteria 1150
309 Ga0466969_0025421 3300044656 Bacteria 3045
310 Ga0466969_0170813 3300044656 Bacteria 997
311 Ga0466972_0022919 3300044658 Bacteria 3107
312 Ga0466972_0081011 3300044658 Bacteria 1546
313 Ga0466965_0043907 3300044683 Bacteria 2208
314 Ga0466965_0044369 3300044683 Bacteria 2197
315 Ga0466966_0023608 3300044684 Bacteria 4025
316 Ga0466966_0035285 3300044684 Bacteria 3231
317 Ga0466961_0002101 3300044693 Bacteria 12397
318 Ga0466961_0033677 3300044693 Bacteria 3291
319 Ga0466963_0001185 3300044694 Bacteria 13711
320 Ga0466963_0004849 3300044694 Bacteria 7838
321 Ga0466963_0010507 3300044694 Bacteria 5606
322 Ga0466963_0035695 3300044694 Bacteria 3240
323 Ga0466963_0042576 3300044694 Bacteria 2982
324 Ga0466963_0043814 3300044694 Bacteria 2944
325 Ga0466963_0050080 3300044694 Bacteria 2764
326 Ga0466963_0110937 3300044694 Bacteria 1883
327 Ga0466963_0120260 3300044694 Bacteria 1807
328 Ga0466963_0160044 3300044694 Bacteria 1567
329 Ga0466963_0274073 3300044694 Unclassified 1185
330 Ga0466963_0340883 3300044694 Bacteria 1055
331 Ga0466964_0004052 3300044706 Bacteria 5389
332 Ga0466964_0016147 3300044706 Bacteria 2847
333 Ga0466964_0019747 3300044706 Bacteria 2592
334 Ga0466964_0021696 3300044706 Bacteria 2485
335 Ga0466964_0022222 3300044706 Bacteria 2459
336 Ga0466964_0023337 3300044706 Bacteria 2405
337 Ga0466964_0031058 3300044706 Bacteria 2117
338 Ga0466971_0001723 3300044719 Bacteria 9261
339 Ga0466971_0003499 3300044719 Bacteria 6706
340 Ga0466971_0016779 3300044719 Bacteria 3234
341 Ga0466971_0021582 3300044719 Bacteria 2865
342 Ga0466971_0066059 3300044719 Unclassified 1638
343 Ga0466968_0026460 3300044735 Bacteria 2381
344 Ga0466970_0052543 3300044765 Bacteria 2175
345 Ga0466970_0120385 3300044765 Unclassified 1437
346 Ga0466957_0006882 3300044842 Bacteria 6425
347 Ga0466957_0022489 3300044842 Bacteria 3721
348 Ga0466957_0033404 3300044842 Bacteria 3087
349 Ga0466957_0063724 3300044842 Bacteria 2267
350 Ga0466957_0094230 3300044842 Bacteria 1880
351 Ga0466957_0299980 3300044842 Bacteria 1079
352 Ga0466957_0456537 3300044842 Bacteria 881
353 Ga0466960_0014414 3300044901 Bacteria 3383
354 Ga0466960_0053235 3300044901 Bacteria 1961
355 Ga0466959_0010640 3300045049 Bacteria 6588
356 Ga0466959_0017968 3300045049 Bacteria 5189
357 Ga0466959_0019604 3300045049 Bacteria 4975
358 Ga0466959_0020216 3300045049 Bacteria 4902
359 Ga0466959_0020559 3300045049 Bacteria 4864
360 Ga0466959_0140308 3300045049 Bacteria 1708
361 Ga0466959_0216741 3300045049 Bacteria 1328
362 Ga0466959_0289857 3300045049 Bacteria 1122
363 Ga0466958_0000907 3300045836 Bacteria 13298
364 Ga0466958_0003727 3300045836 Bacteria 7955
365 Ga0466958_0045620 3300045836 Bacteria 2644
366 Ga0466958_0055448 3300045836 Bacteria 2405
367 Ga0466958_0076592 3300045836 Bacteria 2053
368 Ga0466958_0104318 3300045836 Bacteria 1766
369 Ga0466958_0122288 3300045836 Bacteria 1630
370 Ga0466958_0207522 3300045836 Bacteria 1248
371 Ga0466958_0265700 3300045836 Bacteria 1098
372 Ga0466967_0002594 3300045976 Bacteria 11356
373 Ga0466967_0003450 3300045976 Bacteria 10321
374 Ga0466967_0005793 3300045976 Bacteria 8641
375 Ga0466967_0006378 3300045976 Bacteria 8337
376 Ga0466967_0013745 3300045976 Bacteria 6271
377 Ga0466967_0014667 3300045976 Bacteria 6116
378 Ga0466967_0014982 3300045976 Bacteria 6063
379 Ga0466967_0027979 3300045976 Bacteria 4698
380 Ga0466967_0051199 3300045976 Bacteria 3618
381 Ga0466967_0060994 3300045976 Bacteria 3344
382 Ga0466967_0082130 3300045976 Bacteria 2911
383 Ga0466967_0083765 3300045976 Bacteria 2884
384 Ga0466967_0103941 3300045976 Bacteria 2599
385 Ga0466967_0138716 3300045976 Bacteria 2263
386 Ga0466967_0149895 3300045976 Bacteria 2179
387 Ga0466967_0169476 3300045976 Bacteria 2053
388 Ga0466967_0241284 3300045976 Bacteria 1724
389 Ga0466967_0248550 3300045976 Bacteria 1698
390 Ga0466967_0313141 3300045976 Bacteria 1512
391 Ga0466967_0366104 3300045976 Bacteria 1397
392 Ga0495592_0004301 3300046454 Bacteria 10412
393 Ga0495592_0058302 3300046454 Bacteria 2848
394 Ga0495592_0084790 3300046454 Bacteria 2285
395 Ga0495592_0132050 3300046454 Bacteria 1746
396 Ga0495603_0026451 3300046455 Bacteria 3505
397 Ga0495603_0047464 3300046455 Bacteria 2557
398 Ga0495629_0000349 3300046459 Bacteria 39311
399 Ga0495629_0021069 3300046459 Bacteria 4651
400 Ga0495629_0142323 3300046459 Bacteria 1668
401 Ga0495641_0000494 3300046461 Bacteria 33001
402 Ga0495641_0004048 3300046461 Bacteria 10615
403 Ga0495641_0035070 3300046461 Bacteria 2368
404 Ga0495651_0056790 3300046462 Bacteria 3006
405 Ga0495651_0072909 3300046462 Bacteria 2607
406 Ga0495651_0089901 3300046462 Bacteria 2304
407 Ga0495651_0225973 3300046462 Bacteria 1292
408 Ga0495651_0275279 3300046462 Bacteria 1139
409 Ga0495653_0003625 3300046463 Bacteria 12451
410 Ga0495653_0031880 3300046463 Bacteria 4187
411 Ga0495653_0072984 3300046463 Bacteria 2562
412 Ga0495653_0085368 3300046463 Bacteria 2322
413 Ga0495653_0097829 3300046463 Bacteria 2131
414 Ga0495580_0203470 3300046472 Bacteria 1364
415 Ga0495582_0004719 3300046473 Bacteria 7659
416 Ga0495605_0112792 3300046474 Unclassified 1239
417 Ga0495639_0000386 3300046475 Bacteria 21052
418 Ga0495639_0004618 3300046475 Bacteria 5910
419 Ga0495662_0000205 3300046476 Bacteria 24502
420 Ga0495662_0000943 3300046476 Bacteria 14253
421 Ga0495662_0060272 3300046476 Bacteria 1833
422 Ga0495662_0132262 3300046476 Bacteria 1227
423 Ga0495585_0087799 3300046492 Bacteria 1678
424 Ga0495607_0028837 3300046501 Bacteria 3419
425 Ga0495608_0009205 3300046511 Bacteria 6907
426 Ga0495608_0049889 3300046511 Bacteria 2777
427 Ga0495608_0071856 3300046511 Bacteria 2257
428 Ga0495618_0012134 3300046514 Bacteria 5230
429 Ga0495618_0017488 3300046514 Bacteria 4396
430 Ga0495628_0009377 3300046516 Bacteria 8354
431 Ga0495628_0011556 3300046516 Bacteria 7465
432 Ga0495630_0011615 3300046517 Bacteria 6380
433 Ga0495630_0016892 3300046517 Bacteria 5340
434 Ga0495630_0022376 3300046517 Bacteria 4667
435 Ga0495630_0042674 3300046517 Bacteria 3387
436 Ga0495630_0042844 3300046517 Bacteria 3380
437 Ga0495630_0093917 3300046517 Bacteria 2267
438 Ga0495663_0036520 3300046525 Bacteria 1479
439 Ga0495666_0000241 3300046526 Bacteria 23544
440 Ga0495666_0055663 3300046526 Bacteria 1895
441 Ga0495652_0009902 3300046529 Bacteria 8643
442 Ga0495652_0115326 3300046529 Bacteria 2152
443 Ga0495652_0171163 3300046529 Bacteria 1676
444 Ga0495652_0186166 3300046529 Bacteria 1588
445 Ga0495665_0000739 3300046531 Bacteria 16923
446 Ga0495665_0001708 3300046531 Bacteria 11768
447 Ga0495665_0186750 3300046531 Bacteria 1076
448 Ga0495640_0013233 3300046533 Bacteria 6274
449 Ga0495640_0055929 3300046533 Bacteria 2698
450 Ga0495640_0061391 3300046533 Bacteria 2553
451 Ga0495640_0263778 3300046533 Bacteria 1076
452 Ga0495640_0278491 3300046533 Bacteria 1042
453 Ga0495586_0173936 3300046535 Bacteria 1217
454 Ga0495587_0044904 3300046536 Bacteria 2627
455 Ga0495587_0164439 3300046536 Bacteria 1262
456 Ga0495645_0045918 3300046543 Bacteria 3185
457 Ga0495645_0099848 3300046543 Bacteria 2065
458 Ga0495645_0179068 3300046543 Bacteria 1454
459 Ga0495667_0019097 3300046559 Bacteria 4626
460 Ga0495667_0021551 3300046559 Bacteria 4348
461 Ga0495667_0046978 3300046559 Bacteria 2853
462 Ga0495667_0143691 3300046559 Bacteria 1537
463 Ga0495656_0008016 3300046615 Bacteria 3758
464 Ga0495634_0007732 3300046642 Bacteria 8042
465 Ga0495634_0029774 3300046642 Bacteria 3778
466 Ga0495634_0082043 3300046642 Bacteria 2108
467 Ga0495611_0068859 3300046648 Bacteria 1616
468 Ga0495635_0005865 3300046663 Bacteria 8559
469 Ga0495635_0073794 3300046663 Bacteria 2337
470 Ga0495635_0119252 3300046663 Bacteria 1800
471 Ga0495635_0125474 3300046663 Bacteria 1751
472 Ga0495635_0246302 3300046663 Bacteria 1205
473 Ga0495635_0249661 3300046663 Bacteria 1196
474 Ga0495588_0233226 3300046674 Bacteria 971
475 Ga0495657_0009030 3300046675 Bacteria 7582
476 Ga0495657_0053354 3300046675 Bacteria 2706
477 Ga0495657_0086442 3300046675 Bacteria 2020
478 Ga0495657_0211263 3300046675 Bacteria 1180
479 Ga0495657_0393566 3300046675 Unclassified 816
480 Ga0495599_0001915 3300046678 Bacteria 12048
481 Ga0495599_0017772 3300046678 Bacteria 4426
482 Ga0495599_0042291 3300046678 Bacteria 2859
483 Ga0495599_0069593 3300046678 Bacteria 2196
484 Ga0495646_0030954 3300046680 Bacteria 3339
485 Ga0495646_0160342 3300046680 Bacteria 1246
486 Ga0495646_0166094 3300046680 Bacteria 1219
487 Ga0495647_0000459 3300046681 Bacteria 11746
488 Ga0495647_0007052 3300046681 Bacteria 3748
489 Ga0495658_0001095 3300046683 Bacteria 14299
490 Ga0495658_0008072 3300046683 Bacteria 5211
491 Ga0495658_0117402 3300046683 Bacteria 1606
492 Ga0495658_0263397 3300046683 Bacteria 1085
493 Ga0495613_0001699 3300046689 Bacteria 16771
494 Ga0495613_0027945 3300046689 Bacteria 4199
495 Ga0495613_0153353 3300046689 Bacteria 1642
496 Ga0495624_0005284 3300046690 Bacteria 9326
497 Ga0495624_0188865 3300046690 Bacteria 1253
498 Ga0495600_0005713 3300046809 Bacteria 7516
499 Ga0495581_0001329 3300047315 Bacteria 13641
500 Ga0495581_0005659 3300047315 Bacteria 7246
501 Ga0495604_0112412 3300047317 Bacteria 1984
502 Ga0495674_0002551 3300047319 Bacteria 17744
503 Ga0495674_0019005 3300047319 Bacteria 6389
504 Ga0495674_0021561 3300047319 Bacteria 5956
505 Ga0495674_0140253 3300047319 Bacteria 2032
506 Ga0495674_0157406 3300047319 Bacteria 1902
507 Ga0495676_0000940 3300047321 Bacteria 24451
508 Ga0495676_0033863 3300047321 Bacteria 4294
509 Ga0495676_0073667 3300047321 Bacteria 2617
510 Ga0495676_0126034 3300047321 Bacteria 1856
511 Ga0495680_0000259 3300047322 Bacteria 58560
512 Ga0495680_0002170 3300047322 Bacteria 20303
513 Ga0495680_0011371 3300047322 Bacteria 7880
514 Ga0495680_0024798 3300047322 Bacteria 4968
515 Ga0495680_0037514 3300047322 Bacteria 3881
516 Ga0495680_0045562 3300047322 Bacteria 3462
517 Ga0495675_0097220 3300047444 Bacteria 1845
518 Ga0495679_033584 3300047446 Bacteria 1638
519 Ga0495684_0014086 3300047471 Bacteria 6151
520 Ga0495684_0028838 3300047471 Bacteria 4261
521 Ga0495684_0043156 3300047471 Bacteria 3452
522 Ga0495684_0154365 3300047471 Bacteria 1715
523 Ga0495593_0000440 3300047673 Bacteria 23230
524 Ga0495593_0039074 3300047673 Bacteria 2561
525 Ga0495602_0026925 3300048088 Bacteria 5537
526 Ga0495602_0077527 3300048088 Bacteria 2811
527 Ga0495602_0292973 3300048088 Bacteria 1194
528 Ga0495614_0002534 3300048089 Bacteria 8119
529 Ga0495614_0032077 3300048089 Bacteria 2261
530 Ga0496101_0014092 3300048904 Bacteria 5370
531 Ga0496101_0024371 3300048904 Bacteria 4187
532 Ga0496101_0070701 3300048904 Bacteria 2556
533 Ga0496101_0224564 3300048904 Bacteria 1458
534 Ga0496102_0036246 3300048905 Bacteria 4443
535 Ga0496102_0083206 3300048905 Bacteria 2953
536 Ga0496102_0205274 3300048905 Bacteria 1858
537 Ga0496103_0336741 3300048906 Bacteria 970
538 Ga0496104_0007409 3300048907 Bacteria 9695
539 Ga0496104_0027315 3300048907 Bacteria 5281
540 Ga0496104_0081598 3300048907 Bacteria 3084
541 Ga0496104_0088514 3300048907 Bacteria 2958
542 Ga0496105_0006640 3300048908 Bacteria 8906
543 Ga0496105_0006934 3300048908 Bacteria 8725
544 Ga0496105_0019785 3300048908 Bacteria 5432
545 Ga0496105_0158681 3300048908 Bacteria 1857
546 Ga0496106_0010226 3300048909 Bacteria 6935
547 Ga0496106_0011970 3300048909 Bacteria 6403
548 Ga0496106_0043931 3300048909 Bacteria 3354
549 Ga0496106_0244966 3300048909 Bacteria 1432
550 Ga0496107_0002153 3300048910 Bacteria 12650
551 Ga0496107_0008025 3300048910 Bacteria 7288
552 Ga0496107_0131203 3300048910 Bacteria 1850
553 Ga0496108_0011999 3300048911 Bacteria 7050
554 Ga0496109_0135115 3300048912 Bacteria 2304
555 Ga0496109_0183940 3300048912 Unclassified 1963
556 Ga0496110_0014342 3300048913 Bacteria 6576
557 Ga0496110_0018539 3300048913 Bacteria 5836
558 Ga0496110_0045677 3300048913 Bacteria 3830
559 Ga0496111_0009438 3300048914 Bacteria 6512
560 Ga0496111_0044345 3300048914 Bacteria 3197
561 Ga0496111_0153292 3300048914 Bacteria 1710
562 Ga0496112_0013497 3300048915 Bacteria 7545
563 Ga0496112_0095006 3300048915 Bacteria 2952
564 Ga0496112_0144500 3300048915 Bacteria 2347
565 Ga0496112_0212742 3300048915 Bacteria 1890
566 Ga0496113_0491176 3300048916 Bacteria 986
567 Ga0496114_0014192 3300048917 Bacteria 6391
568 Ga0496114_0021457 3300048917 Bacteria 5257
569 Ga0496114_0036020 3300048917 Bacteria 4089
570 Ga0496114_0038988 3300048917 Bacteria 3932
571 Ga0496114_0152148 3300048917 Bacteria 2007
572 Ga0496115_0001532 3300048918 Bacteria 16585
573 Ga0496115_0014019 3300048918 Bacteria 6067
574 Ga0496115_0039715 3300048918 Bacteria 3738
575 Ga0496115_0048042 3300048918 Bacteria 3413
576 Ga0496115_0116268 3300048918 Unclassified 2200
577 Ga0496115_0505550 3300048918 Bacteria 971
578 Ga0501031_0000335 3300049568 Bacteria 27232
579 Ga0501031_0100056 3300049568 Bacteria 1892
580 Ga0501031_0120302 3300049568 Bacteria 1715
581 Ga0501032_0000618 3300049569 Bacteria 28827
582 Ga0501033_0000542 3300049570 Bacteria 35034
583 Ga0501034_0014073 3300049571 Bacteria 8242
584 Ga0501034_0041313 3300049571 Bacteria 4666
585 Ga0501036_0007246 3300049572 Bacteria 9031
586 Ga0501036_0072632 3300049572 Bacteria 2908
587 Ga0501036_0149298 3300049572 Bacteria 1971
588 Ga0501037_0001374 3300049573 Bacteria 17840
589 Ga0501037_0013620 3300049573 Bacteria 5990
590 Ga0501037_0392988 3300049573 Bacteria 952
591 Ga0501038_0032152 3300049574 Bacteria 4630
592 Ga0501039_0004107 3300049575 Bacteria 10960
593 Ga0501040_0000758 3300049576 Bacteria 20022
594 Ga0501040_0001041 3300049576 Bacteria 17542
595 Ga0501040_0014563 3300049576 Bacteria 5185
596 Ga0501040_0127111 3300049576 Bacteria 1791
597 Ga0501041_0000503 3300049577 Bacteria 20099
598 Ga0501041_0013083 3300049577 Bacteria 4917
599 Ga0501041_0080792 3300049577 Bacteria 2001
600 Ga0501042_0019548 3300049578 Bacteria 4705
601 Ga0501042_0020233 3300049578 Bacteria 4630
602 Ga0501043_0030842 3300049579 Bacteria 4215
603 Ga0501043_0198589 3300049579 Unclassified 1558
604 Ga0501046_0005878 3300049580 Bacteria 10935
605 Ga0501046_0111014 3300049580 Bacteria 2094
606 Ga0501046_0124035 3300049580 Bacteria 1963
607 Ga0501047_0009196 3300049581 Bacteria 9328
608 Ga0501047_0279482 3300049581 Bacteria 1514
609 Ga0501047_0406814 3300049581 Bacteria 1193
610 Ga0501048_0002721 3300049582 Bacteria 13487
611 Ga0501048_0036864 3300049582 Bacteria 3513
612 Ga0501067_0000386 3300049583 Bacteria 23987
613 Ga0501067_0006875 3300049583 Bacteria 6310
614 Ga0501067_0040068 3300049583 Bacteria 2602
615 Ga0501067_0124121 3300049583 Bacteria 1437
616 Ga0501067_0133837 3300049583 Unclassified 1380
617 Ga0501068_0000640 3300049584 Bacteria 17868
618 Ga0501068_0006989 3300049584 Bacteria 6243
619 Ga0501068_0038749 3300049584 Bacteria 2856
620 Ga0501068_0049580 3300049584 Bacteria 2536
621 Ga0501068_0133074 3300049584 Bacteria 1556
622 Ga0501069_0000218 3300049585 Bacteria 25595
623 Ga0501069_0000488 3300049585 Bacteria 18095
624 Ga0501069_0001705 3300049585 Bacteria 10928
625 Ga0501070_0004939 3300049586 Bacteria 11380
626 Ga0501070_0033214 3300049586 Bacteria 4317
627 Ga0501070_0069699 3300049586 Bacteria 2911
628 Ga0501070_0157854 3300049586 Bacteria 1870
629 Ga0501070_0162693 3300049586 Bacteria 1840
630 Ga0501071_0019297 3300049587 Bacteria 4731
631 Ga0501071_0032131 3300049587 Bacteria 3725
632 Ga0501071_0058820 3300049587 Bacteria 2779
633 Ga0501071_0083896 3300049587 Bacteria 2334
634 Ga0501071_0104098 3300049587 Bacteria 2094
635 Ga0501071_0124444 3300049587 Bacteria 1913
636 Ga0501072_0002729 3300049588 Bacteria 13253
637 Ga0501072_0006126 3300049588 Bacteria 9173
638 Ga0501072_0038840 3300049588 Bacteria 3736
639 Ga0501072_0207637 3300049588 Bacteria 1561
640 Ga0501072_0287060 3300049588 Bacteria 1308
641 Ga0501073_0000709 3300049589 Bacteria 23548
642 Ga0501073_0020416 3300049589 Bacteria 4778
643 Ga0501073_0022563 3300049589 Bacteria 4531
644 Ga0501074_0000853 3300049590 Bacteria 19386
645 Ga0501074_0016209 3300049590 Bacteria 5413
646 Ga0501074_0056442 3300049590 Bacteria 2830
647 Ga0501074_0086091 3300049590 Bacteria 2251
648 Ga0501074_0117463 3300049590 Bacteria 1903
649 Ga0501074_0325325 3300049590 Bacteria 1092
650 Ga0501075_0002836 3300049591 Bacteria 11621
651 Ga0501075_0005127 3300049591 Bacteria 8957
652 Ga0501075_0037076 3300049591 Bacteria 3641
653 Ga0501075_0038822 3300049591 Bacteria 3560
654 Ga0501075_0434779 3300049591 Bacteria 1001
655 Ga0501076_0001525 3300049592 Bacteria 15519
656 Ga0501076_0026020 3300049592 Bacteria 4528
657 Ga0501076_0215336 3300049592 Bacteria 1570
658 Ga0501077_0002103 3300049593 Bacteria 12004
659 Ga0501077_0005718 3300049593 Bacteria 7570
660 Ga0501077_0013512 3300049593 Bacteria 5120
661 Ga0501077_0074979 3300049593 Bacteria 2142
662 Ga0501077_0107371 3300049593 Bacteria 1769
663 Ga0501079_0005920 3300049741 Bacteria 9162
664 Ga0501079_0006056 3300049741 Bacteria 9064
665 Ga0501080_0002094 3300049742 Bacteria 17315
666 Ga0501080_0021337 3300049742 Bacteria 5995
667 Ga0501080_0077511 3300049742 Bacteria 3091
668 Ga0501080_0092696 3300049742 Bacteria 2805
669 Ga0501080_0154737 3300049742 Bacteria 2118
670 Ga0501081_0017744 3300049743 Bacteria 4716
671 Ga0501081_0018741 3300049743 Bacteria 4597
672 Ga0501081_0128605 3300049743 Bacteria 1808
673 Ga0501081_0203639 3300049743 Bacteria 1436
674 Ga0501083_0000599 3300049744 Bacteria 23173
675 Ga0501083_0138160 3300049744 Bacteria 1596
676 Ga0501035_0010818 3300049822 Bacteria 8448
677 Ga0501035_0030086 3300049822 Bacteria 4951
678 Ga0501035_0078247 3300049822 Bacteria 2922
679 Ga0501035_0115310 3300049822 Bacteria 2351
680 Ga0501044_0022645 3300049823 Bacteria 6691
681 Ga0501044_0220563 3300049823 Bacteria 1847
682 Ga0501044_0368360 3300049823 Bacteria 1354
683 Ga0501045_0000562 3300049824 Bacteria 23326
684 Ga0501045_0186067 3300049824 Unclassified 1547
685 Ga0501045_0204766 3300049824 Bacteria 1470
686 nmdc:mga05p37_12539_c1 3300050507 Bacteria 10121
687 nmdc:mga05p37_401517_c1 3300050507 Bacteria 1600
688 nmdc:mga09592_5866_c1 3300050508 Bacteria 10023
689 nmdc:mga0qj67_129545_c1 3300050509 Bacteria 2043
690 nmdc:mga0qj67_81483_c1 3300050509 Bacteria 2595
691 nmdc:mga06r32_215352_c1 3300050510 Bacteria 1908
692 nmdc:mga08y16_345326_c1 3300050511 Bacteria 1529
693 nmdc:mga0n895_111674_c1 3300050512 Bacteria 2750
694 nmdc:mga0n895_14170_c1 3300050512 Bacteria 7230
695 nmdc:mga0rr50_40206_c1 3300050513 Bacteria 3399
696 Ga0495601_0014262 3300053077 Bacteria 4787
697 Ga0495601_0022152 3300053077 Bacteria 3899
698 Ga0495601_0073904 3300053077 Bacteria 2180
699 Ga0495601_0100678 3300053077 Bacteria 1866
700 Ga0495601_0365717 3300053077 Bacteria 937
701 Ga0495601_0399366 3300053077 Bacteria 891
702 Ga0495612_0053676 3300053078 Bacteria 1659
703 Ga0495655_0057009 3300053083 Unclassified 1053
704 Ga0495595_0016912 3300053084 Bacteria 3128
705 Ga0495595_0035231 3300053084 Bacteria 2267
706 Ga0495595_0050064 3300053084 Bacteria 1934
707 Ga0495619_0003134 3300053085 Bacteria 10722
708 Ga0495619_0008408 3300053085 Bacteria 6528
709 Ga0495619_0048145 3300053085 Bacteria 2809
710 Ga0495619_0096300 3300053085 Bacteria 2009
711 Ga0495619_0181197 3300053085 Bacteria 1457
712 Ga0500566_0074789 3300053094 Bacteria 1896
713 Ga0501084_0001256 3300054114 Bacteria 19957
714 Ga0501084_0005567 3300054114 Bacteria 10340
715 Ga0501084_0037145 3300054114 Bacteria 4069
716 Ga0501084_0234628 3300054114 Bacteria 1549
717 Ga0590075_045323 3300059424 Unclassified 1126
718 Ga0501082_0030718 3300060353 Bacteria 4630
719 Ga0501082_0034896 3300060353 Bacteria 4335
720 Ga0501082_0083898 3300060353 Bacteria 2748
721 Ga0501082_0404688 3300060353 Bacteria 1191
722 Ga0466962_0002439 3300061719 Bacteria 8813
723 Ga0466962_0002534 3300061719 Bacteria 8678
724 Ga0466962_0007231 3300061719 Bacteria 5319
725 Ga0466962_0017272 3300061719 Bacteria 3476
726 Ga0530510_0005431 3300061734 Bacteria 8819
727 Ga0530510_0050453 3300061734 Bacteria 3006
728 Ga0530510_0124645 3300061734 Bacteria 1893
729 Ga0530510_0327122 3300061734 Bacteria 1149
730 Ga0081455_10006226
731 JGI25407J50210_10005902
732 JGI25407J50210_10053713
733 JGI25407J50210_10056905
734 Ga0070658_10034810
735 Ga0070658_10124607
736 Ga0070658_10410511
737 Ga0070683_100016823
738 Ga0070683_100044654
739 Ga0070683_100091904
740 Ga0070683_100226245
741 Ga0070680_100012860
742 Ga0070680_100041925
743 Ga0070680_100073056
744 Ga0070680_100248010
745 Ga0070682_100321681
746 Ga0070660_100005006
747 Ga0070660_100012974
748 Ga0070660_100059187
749 Ga0070660_100063175
750 Ga0070660_100291890
751 Ga0070661_100022800
752 Ga0070671_100039747
753 Ga0070671_100235863
754 Ga0070659_100006234
755 Ga0070659_100099419
756 Ga0070709_10230710
757 Ga0070709_10336035
758 Ga0070714_100023746
759 Ga0070714_100083604
760 Ga0070714_100367419
761 Ga0070714_100851771
762 Ga0070713_100047202
763 Ga0070713_100362014
764 Ga0070711_100025569
765 Ga0070694_100016269
766 Ga0070708_100001830
767 Ga0070663_100053722
768 Ga0070678_100230125
769 Ga0070662_100190380
770 Ga0070681_10003807
771 Ga0070681_10014174
772 Ga0070681_10081371
773 Ga0070681_10113464
774 Ga0070681_10285511
775 Ga0068867_100102929
776 Ga0070707_100267612
777 Ga0070698_100093850
778 Ga0070679_100033402
779 Ga0070679_100057441
780 Ga0070679_100068650
781 Ga0070679_100295952
782 Ga0070684_100026109
783 Ga0070684_100055328
784 Ga0070684_100073756
785 Ga0070684_100108875
786 Ga0068853_100332617
787 Ga0070695_100000363
788 Ga0070665_100014812
789 Ga0068855_100019656
790 Ga0068855_100030292
791 Ga0068855_100071652
792 Ga0068855_100073087
793 Ga0068855_100130956
794 Ga0068855_100159773
795 Ga0068855_100184069
796 Ga0068855_100229603
797 Ga0068855_100342657
798 Ga0068855_100600840
799 Ga0068857_100054962
800 Ga0068857_100099263
801 Ga0068856_100028282
802 Ga0068856_100263649
803 Ga0068856_100427890
804 Ga0068852_100028464
805 Ga0068852_100275707
806 Ga0068861_100026725
807 Ga0081538_10000422
808 Ga0081538_10001675
809 Ga0081538_10006022
810 Ga0081538_10007727
811 Ga0081538_10014034
812 Ga0081538_10014948
813 Ga0081538_10019672
814 Ga0081538_10036896
815 Ga0081538_10083039
816 Ga0081538_10112506
817 Ga0081539_10030272
818 Ga0070715_10040843
819 Ga0070716_100330121
820 Ga0070712_100040232
821 Ga0070712_100303119
822 Ga0075428_100009740
823 Ga0075430_100029414
824 Ga0075430_100290084
825 Ga0075433_10130273
826 Ga0075433_10184140
827 Ga0075434_100026949
828 Ga0075434_100041074
829 Ga0075429_100002297
830 Ga0075435_100030491
831 Ga0075435_100036259
832 Ga0075435_100459600
833 Ga0105240_10090173
834 Ga0105240_10123419
835 Ga0105240_10131750
836 Ga0105240_10303356
837 Ga0105240_10553031
838 Ga0105245_10009806
839 Ga0105245_10952122
840 Ga0114129_10025201
841 Ga0114129_10132686
842 Ga0114129_10448436
843 Ga0105243_10307113
844 Ga0105248_10055191
845 Ga0105237_10019269
846 Ga0105237_10034687
847 Ga0105249_10003773
848 Ga0105239_10142751
849 Ga0157371_10453006
850 Ga0157370_10019774
851 Ga0157370_10026504
852 Ga0157370_10035304
853 Ga0157370_10046160
854 Ga0157370_10099117
855 Ga0157370_10112184
856 Ga0157369_10001698
857 Ga0157369_10007440
858 Ga0157369_10008364
859 Ga0157369_10016138
860 Ga0157369_10022141
861 Ga0157369_10112806
862 Ga0157369_10298148
863 Ga0157369_10775942
864 Ga0157374_10014229
865 Ga0157374_10283589
866 Ga0163162_10087531
867 Ga0157372_10134907
868 Ga0157372_10144880
869 Ga0157372_10189655
870 Ga0157376_10021202
871 Ga0163161_10067961
872 Ga0206356_10185080
873 Ga0206354_11243756
874 Ga0206354_11249356
875 Ga0206353_10111715
876 Ga0206353_10157841
877 Ga0206353_10612681
878 Ga0206353_10848156
879 Ga0206353_11917284
880 Ga0207692_10088088
881 Ga0207685_10021829
882 Ga0207705_10005302
883 Ga0207705_10051193
884 Ga0207705_10243173
885 Ga0207707_10011640
886 Ga0207707_10025091
887 Ga0207707_10106801
888 Ga0207707_10557395
889 Ga0207695_10095748
890 Ga0207695_10096999
891 Ga0207695_10122044
892 Ga0207671_10031828
893 Ga0207693_10014330
894 Ga0207693_10285205
895 Ga0207663_10012840
896 Ga0207663_10236219
897 Ga0207660_10124530
898 Ga0207660_10135627
899 Ga0207660_10440181
900 Ga0207657_10000073
901 Ga0207657_10010590
902 Ga0207657_10010720
903 Ga0207657_10015733
904 Ga0207657_10016460
905 Ga0207657_10169975
906 Ga0207657_10217177
907 Ga0207657_10267170
908 Ga0207649_10087909
909 Ga0207652_10006996
910 Ga0207652_10014110
911 Ga0207652_10043580
912 Ga0207652_10066846
913 Ga0207652_10125639
914 Ga0207652_10155830
915 Ga0207652_10301939
916 Ga0207646_10522375
917 Ga0207687_10030929
918 Ga0207700_10346287
919 Ga0207664_10050732
920 Ga0207664_10212151
921 Ga0207644_10024759
922 Ga0207644_10066089
923 Ga0207690_10090339
924 Ga0207690_10126148
925 Ga0207709_10298445
926 Ga0207665_10101995
927 Ga0207665_10447890
928 Ga0207711_10037463
929 Ga0207661_10051814
930 Ga0207661_10133412
931 Ga0207661_10178672
932 Ga0207661_10187210
933 Ga0207661_10258791
934 Ga0207667_10059057
935 Ga0207667_10092544
936 Ga0207667_10255067
937 Ga0207667_10269579
938 Ga0207667_10341448
939 Ga0207668_10035770
940 Ga0207678_10111461
941 Ga0207678_10171981
942 Ga0207702_10106132
943 Ga0207674_10018144
944 Ga0207674_10018333
945 Ga0207675_100010255
946 Ga0207698_10029502
947 Ga0268266_10328542
948 Ga0265334_10042567
949 Ga0265322_10015994
950 Ga0265338_10006961
951 Ga0265338_10009734
952 Ga0265338_10017960
953 Ga0265338_10052017
954 Ga0265330_10049513
955 Ga0265332_10053381
956 Ga0265329_10024609
957 Ga0265340_10046471
958 Ga0265340_10084745
959 Ga0265339_10032722
960 Ga0265331_10026530
961 Ga0265327_10075855
962 Ga0265316_10031076
963 Ga0265313_10005968
964 Ga0265313_10013854
965 Ga0265314_10004242
966 Ga0265314_10061767
967 Ga0307416_100001175
968 Ga0307416_100208088
969 Ga0307411_10194302
970 Ga0373926_0037279
971 Ga0373926_0047112
972 Ga0373936_0201590
973 Ga0373945_0081499
974 Ga0373943_0000966
975 Ga0373943_0002489
976 Ga0373946_0001677
977 Ga0373946_0006830
978 Ga0373955_0062400
979 Ga0373935_0054731
980 Ga0373927_0069903
981 Ga0373933_0048104
982 Ga0373933_0212166
983 Ga0373947_0003172
984 Ga0373947_0013716
985 Ga0373947_0085098
986 Ga0373937_0106697
987 Ga0373925_0003039
988 Ga0373925_0003069
989 Ga0373925_0045015
990 Ga0373925_0046324
991 Ga0395899_0005600
992 Ga0395899_0008184
993 Ga0395899_0018953
994 Ga0395899_0202562
995 Ga0395899_0255097
996 Ga0395900_0024282
997 Ga0395900_0053817
998 Ga0395900_0066345
999 Ga0395900_0068803
1000 Ga0395900_0711476
1001 Ga0395898_0005945
1002 Ga0395898_0017263
1003 Ga0395898_0024048
1004 Ga0395898_0034147
1005 Ga0395898_0036588
1006 Ga0395898_0043991
1007 Ga0395898_0056155
1008 Ga0395898_0109580
1009 Ga0395898_0110163
1010 Ga0395898_0154040
1011 Ga0395898_0174641
1012 Ga0395898_0295888
1013 Ga0395898_0307813
1014 Ga0395898_0552035
1015 Ga0395898_0573064
1016 Ga0395905_0014380
1017 Ga0395905_0026654
1018 Ga0395905_0041194
1019 Ga0395905_0056928
1020 Ga0395905_0162872
1021 Ga0395905_0187114
1022 Ga0395905_0219814
1023 Ga0395901_0005220
1024 Ga0395901_0005275
1025 Ga0395901_0006754
1026 Ga0395901_0024891
1027 Ga0395901_0029426
1028 Ga0395901_0037137
1029 Ga0395901_0048751
1030 Ga0395901_0051850
1031 Ga0395901_0088596
1032 Ga0395901_0097615
1033 Ga0395901_0235105
1034 Ga0395901_0249891
1035 Ga0395901_0346299
1036 Ga0395901_0592839
1037 Ga0436363_1428459
1038 Ga0466969_0025421
1039 Ga0466969_0170813
1040 Ga0466972_0022919
1041 Ga0466972_0081011
1042 Ga0466965_0043907
1043 Ga0466965_0044369
1044 Ga0466966_0023608
1045 Ga0466966_0035285
1046 Ga0466961_0002101
1047 Ga0466961_0033677
1048 Ga0466963_0001185
1049 Ga0466963_0004849
1050 Ga0466963_0010507
1051 Ga0466963_0035695
1052 Ga0466963_0042576
1053 Ga0466963_0043814
1054 Ga0466963_0050080
1055 Ga0466963_0110937
1056 Ga0466963_0120260
1057 Ga0466963_0160044
1058 Ga0466963_0274073
1059 Ga0466963_0340883
1060 Ga0466964_0004052
1061 Ga0466964_0016147
1062 Ga0466964_0019747
1063 Ga0466964_0021696
1064 Ga0466964_0022222
1065 Ga0466964_0023337
1066 Ga0466964_0031058
1067 Ga0466971_0001723
1068 Ga0466971_0003499
1069 Ga0466971_0016779
1070 Ga0466971_0021582
1071 Ga0466971_0066059
1072 Ga0466968_0026460
1073 Ga0466970_0052543
1074 Ga0466970_0120385
1075 Ga0466957_0006882
1076 Ga0466957_0022489
1077 Ga0466957_0033404
1078 Ga0466957_0063724
1079 Ga0466957_0094230
1080 Ga0466957_0299980
1081 Ga0466957_0456537
1082 Ga0466960_0014414
1083 Ga0466960_0053235
1084 Ga0466959_0010640
1085 Ga0466959_0017968
1086 Ga0466959_0019604
1087 Ga0466959_0020216
1088 Ga0466959_0020559
1089 Ga0466959_0140308
1090 Ga0466959_0216741
1091 Ga0466959_0289857
1092 Ga0466958_0000907
1093 Ga0466958_0003727
1094 Ga0466958_0045620
1095 Ga0466958_0055448
1096 Ga0466958_0076592
1097 Ga0466958_0104318
1098 Ga0466958_0122288
1099 Ga0466958_0207522
1100 Ga0466958_0265700
1101 Ga0466967_0002594
1102 Ga0466967_0003450
1103 Ga0466967_0005793
1104 Ga0466967_0006378
1105 Ga0466967_0013745
1106 Ga0466967_0014667
1107 Ga0466967_0014982
1108 Ga0466967_0027979
1109 Ga0466967_0051199
1110 Ga0466967_0060994
1111 Ga0466967_0082130
1112 Ga0466967_0083765
1113 Ga0466967_0103941
1114 Ga0466967_0138716
1115 Ga0466967_0149895
1116 Ga0466967_0169476
1117 Ga0466967_0241284
1118 Ga0466967_0248550
1119 Ga0466967_0313141
1120 Ga0466967_0366104
1121 Ga0495592_0004301
1122 Ga0495592_0058302
1123 Ga0495592_0084790
1124 Ga0495592_0132050
1125 Ga0495603_0026451
1126 Ga0495603_0047464
1127 Ga0495629_0000349
1128 Ga0495629_0021069
1129 Ga0495629_0142323
1130 Ga0495641_0000494
1131 Ga0495641_0004048
1132 Ga0495641_0035070
1133 Ga0495651_0056790
1134 Ga0495651_0072909
1135 Ga0495651_0089901
1136 Ga0495651_0225973
1137 Ga0495651_0275279
1138 Ga0495653_0003625
1139 Ga0495653_0031880
1140 Ga0495653_0072984
1141 Ga0495653_0085368
1142 Ga0495653_0097829
1143 Ga0495580_0203470
1144 Ga0495582_0004719
1145 Ga0495605_0112792
1146 Ga0495639_0000386
1147 Ga0495639_0004618
1148 Ga0495662_0000205
1149 Ga0495662_0000943
1150 Ga0495662_0060272
1151 Ga0495662_0132262
1152 Ga0495585_0087799
1153 Ga0495607_0028837
1154 Ga0495608_0009205
1155 Ga0495608_0049889
1156 Ga0495608_0071856
1157 Ga0495618_0012134
1158 Ga0495618_0017488
1159 Ga0495628_0009377
1160 Ga0495628_0011556
1161 Ga0495630_0011615
1162 Ga0495630_0016892
1163 Ga0495630_0022376
1164 Ga0495630_0042674
1165 Ga0495630_0042844
1166 Ga0495630_0093917
1167 Ga0495663_0036520
1168 Ga0495666_0000241
1169 Ga0495666_0055663
1170 Ga0495652_0009902
1171 Ga0495652_0115326
1172 Ga0495652_0171163
1173 Ga0495652_0186166
1174 Ga0495665_0000739
1175 Ga0495665_0001708
1176 Ga0495665_0186750
1177 Ga0495640_0013233
1178 Ga0495640_0055929
1179 Ga0495640_0061391
1180 Ga0495640_0263778
1181 Ga0495640_0278491
1182 Ga0495586_0173936
1183 Ga0495587_0044904
1184 Ga0495587_0164439
1185 Ga0495645_0045918
1186 Ga0495645_0099848
1187 Ga0495645_0179068
1188 Ga0495667_0019097
1189 Ga0495667_0021551
1190 Ga0495667_0046978
1191 Ga0495667_0143691
1192 Ga0495656_0008016
1193 Ga0495634_0007732
1194 Ga0495634_0029774
1195 Ga0495634_0082043
1196 Ga0495611_0068859
1197 Ga0495635_0005865
1198 Ga0495635_0073794
1199 Ga0495635_0119252
1200 Ga0495635_0125474
1201 Ga0495635_0246302
1202 Ga0495635_0249661
1203 Ga0495588_0233226
1204 Ga0495657_0009030
1205 Ga0495657_0053354
1206 Ga0495657_0086442
1207 Ga0495657_0211263
1208 Ga0495657_0393566
1209 Ga0495599_0001915
1210 Ga0495599_0017772
1211 Ga0495599_0042291
1212 Ga0495599_0069593
1213 Ga0495646_0030954
1214 Ga0495646_0160342
1215 Ga0495646_0166094
1216 Ga0495647_0000459
1217 Ga0495647_0007052
1218 Ga0495658_0001095
1219 Ga0495658_0008072
1220 Ga0495658_0117402
1221 Ga0495658_0263397
1222 Ga0495613_0001699
1223 Ga0495613_0027945
1224 Ga0495613_0153353
1225 Ga0495624_0005284
1226 Ga0495624_0188865
1227 Ga0495600_0005713
1228 Ga0495581_0001329
1229 Ga0495581_0005659
1230 Ga0495604_0112412
1231 Ga0495674_0002551
1232 Ga0495674_0019005
1233 Ga0495674_0021561
1234 Ga0495674_0140253
1235 Ga0495674_0157406
1236 Ga0495676_0000940
1237 Ga0495676_0033863
1238 Ga0495676_0073667
1239 Ga0495676_0126034
1240 Ga0495680_0000259
1241 Ga0495680_0002170
1242 Ga0495680_0011371
1243 Ga0495680_0024798
1244 Ga0495680_0037514
1245 Ga0495680_0045562
1246 Ga0495675_0097220
1247 Ga0495679_033584
1248 Ga0495684_0014086
1249 Ga0495684_0028838
1250 Ga0495684_0043156
1251 Ga0495684_0154365
1252 Ga0495593_0000440
1253 Ga0495593_0039074
1254 Ga0495602_0026925
1255 Ga0495602_0077527
1256 Ga0495602_0292973
1257 Ga0495614_0002534
1258 Ga0495614_0032077
1259 Ga0496101_0014092
1260 Ga0496101_0024371
1261 Ga0496101_0070701
1262 Ga0496101_0224564
1263 Ga0496102_0036246
1264 Ga0496102_0083206
1265 Ga0496102_0205274
1266 Ga0496103_0336741
1267 Ga0496104_0007409
1268 Ga0496104_0027315
1269 Ga0496104_0081598
1270 Ga0496104_0088514
1271 Ga0496105_0006640
1272 Ga0496105_0006934
1273 Ga0496105_0019785
1274 Ga0496105_0158681
1275 Ga0496106_0010226
1276 Ga0496106_0011970
1277 Ga0496106_0043931
1278 Ga0496106_0244966
1279 Ga0496107_0002153
1280 Ga0496107_0008025
1281 Ga0496107_0131203
1282 Ga0496108_0011999
1283 Ga0496109_0135115
1284 Ga0496109_0183940
1285 Ga0496110_0014342
1286 Ga0496110_0018539
1287 Ga0496110_0045677
1288 Ga0496111_0009438
1289 Ga0496111_0044345
1290 Ga0496111_0153292
1291 Ga0496112_0013497
1292 Ga0496112_0095006
1293 Ga0496112_0144500
1294 Ga0496112_0212742
1295 Ga0496113_0491176
1296 Ga0496114_0014192
1297 Ga0496114_0021457
1298 Ga0496114_0036020
1299 Ga0496114_0038988
1300 Ga0496114_0152148
1301 Ga0496115_0001532
1302 Ga0496115_0014019
1303 Ga0496115_0039715
1304 Ga0496115_0048042
1305 Ga0496115_0116268
1306 Ga0496115_0505550
1307 Ga0501031_0000335
1308 Ga0501031_0100056
1309 Ga0501031_0120302
1310 Ga0501032_0000618
1311 Ga0501033_0000542
1312 Ga0501034_0014073
1313 Ga0501034_0041313
1314 Ga0501036_0007246
1315 Ga0501036_0072632
1316 Ga0501036_0149298
1317 Ga0501037_0001374
1318 Ga0501037_0013620
1319 Ga0501037_0392988
1320 Ga0501038_0032152
1321 Ga0501039_0004107
1322 Ga0501040_0000758
1323 Ga0501040_0001041
1324 Ga0501040_0014563
1325 Ga0501040_0127111
1326 Ga0501041_0000503
1327 Ga0501041_0013083
1328 Ga0501041_0080792
1329 Ga0501042_0019548
1330 Ga0501042_0020233
1331 Ga0501043_0030842
1332 Ga0501043_0198589
1333 Ga0501046_0005878
1334 Ga0501046_0111014
1335 Ga0501046_0124035
1336 Ga0501047_0009196
1337 Ga0501047_0279482
1338 Ga0501047_0406814
1339 Ga0501048_0002721
1340 Ga0501048_0036864
1341 Ga0501067_0000386
1342 Ga0501067_0006875
1343 Ga0501067_0040068
1344 Ga0501067_0124121
1345 Ga0501067_0133837
1346 Ga0501068_0000640
1347 Ga0501068_0006989
1348 Ga0501068_0038749
1349 Ga0501068_0049580
1350 Ga0501068_0133074
1351 Ga0501069_0000218
1352 Ga0501069_0000488
1353 Ga0501069_0001705
1354 Ga0501070_0004939
1355 Ga0501070_0033214
1356 Ga0501070_0069699
1357 Ga0501070_0157854
1358 Ga0501070_0162693
1359 Ga0501071_0019297
1360 Ga0501071_0032131
1361 Ga0501071_0058820
1362 Ga0501071_0083896
1363 Ga0501071_0104098
1364 Ga0501071_0124444
1365 Ga0501072_0002729
1366 Ga0501072_0006126
1367 Ga0501072_0038840
1368 Ga0501072_0207637
1369 Ga0501072_0287060
1370 Ga0501073_0000709
1371 Ga0501073_0020416
1372 Ga0501073_0022563
1373 Ga0501074_0000853
1374 Ga0501074_0016209
1375 Ga0501074_0056442
1376 Ga0501074_0086091
1377 Ga0501074_0117463
1378 Ga0501074_0325325
1379 Ga0501075_0002836
1380 Ga0501075_0005127
1381 Ga0501075_0037076
1382 Ga0501075_0038822
1383 Ga0501075_0434779
1384 Ga0501076_0001525
1385 Ga0501076_0026020
1386 Ga0501076_0215336
1387 Ga0501077_0002103
1388 Ga0501077_0005718
1389 Ga0501077_0013512
1390 Ga0501077_0074979
1391 Ga0501077_0107371
1392 Ga0501079_0005920
1393 Ga0501079_0006056
1394 Ga0501080_0002094
1395 Ga0501080_0021337
1396 Ga0501080_0077511
1397 Ga0501080_0092696
1398 Ga0501080_0154737
1399 Ga0501081_0017744
1400 Ga0501081_0018741
1401 Ga0501081_0128605
1402 Ga0501081_0203639
1403 Ga0501083_0000599
1404 Ga0501083_0138160
1405 Ga0501035_0010818
1406 Ga0501035_0030086
1407 Ga0501035_0078247
1408 Ga0501035_0115310
1409 Ga0501044_0022645
1410 Ga0501044_0220563
1411 Ga0501044_0368360
1412 Ga0501045_0000562
1413 Ga0501045_0186067
1414 Ga0501045_0204766
1415 nmdc:mga05p37_12539_c1
1416 nmdc:mga05p37_401517_c1
1417 nmdc:mga09592_5866_c1
1418 nmdc:mga0qj67_129545_c1
1419 nmdc:mga0qj67_81483_c1
1420 nmdc:mga06r32_215352_c1
1421 nmdc:mga08y16_345326_c1
1422 nmdc:mga0n895_111674_c1
1423 nmdc:mga0n895_14170_c1
1424 nmdc:mga0rr50_40206_c1
1425 Ga0495601_0014262
1426 Ga0495601_0022152
1427 Ga0495601_0073904
1428 Ga0495601_0100678
1429 Ga0495601_0365717
1430 Ga0495601_0399366
1431 Ga0495612_0053676
1432 Ga0495655_0057009
1433 Ga0495595_0016912
1434 Ga0495595_0035231
1435 Ga0495595_0050064
1436 Ga0495619_0003134
1437 Ga0495619_0008408
1438 Ga0495619_0048145
1439 Ga0495619_0096300
1440 Ga0495619_0181197
1441 Ga0500566_0074789
1442 Ga0501084_0001256
1443 Ga0501084_0005567
1444 Ga0501084_0037145
1445 Ga0501084_0234628
1446 Ga0590075_045323
1447 Ga0501082_0030718
1448 Ga0501082_0034896
1449 Ga0501082_0083898
1450 Ga0501082_0404688
1451 Ga0466962_0002439
1452 Ga0466962_0002534
1453 Ga0466962_0007231
1454 Ga0466962_0017272
1455 Ga0530510_0005431
1456 Ga0530510_0050453
1457 Ga0530510_0124645
1458 Ga0530510_0327122

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

24

191

0.95

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

192

273

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zdd-assembly1.cif.gz_A-2 structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium 0.8598 1 249
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.8573 1 273
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.8571 1 273
3zdc-assembly1.cif.gz_A structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium 0.8541 1 249
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.8538 1 273
ID Description Score Start End Superfamily
af_P00582_2_172_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9198 2 172 3.40.50.1010
af_A8MQG8_313_403_1.10.150.20 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9166 177 241 1.10.150.20
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9154 1 171 3.40.50.1010
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9073 1 169 3.40.50.1010
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8973 1 169 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A537NAG0-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9688 2 174 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7W1BQ95-F1-model_v4 5'-3' exonuclease domain-containing protein 0.9616 1 275 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537TLQ8-F1-model_v4 5'-3' exonuclease 0.9614 2 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A537TLQ8-F1-model_v4 5'-3' exonuclease 0.9547 2 276 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7Y5XXC8-F1-model_v4 DNA polymerase I 0.954 2 230 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map