F477853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 257 | 1458 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10006226|Ga0081455_100062267 |
| Length | 302 |
| Sequence | MRVFDTAVRVAIRRKTQEWGAVKPLLAVDGDSLAHRAFHALPRSIRDAEGRPGNMIVGFTNMLAFVWEAEQPRTVFVGFDTLTTPTYRHELLPQYQSGRDFPPELTFQLDRLPELVEALGFAWAKEAGYEADDFLAGAVRSEGERNGETLVLTSDRDLFQLVSKKTTVLVPRRGVSELDRVDPDGVRERYGVDPEQVPDFIALRGDSSDKIPGAKGIGPGRAATILGRHDTLDGAIEAGVFDAQADDLRTYLRIARLRHEAPVPELPDAEPQWERAAELVEGWGHNALGKRLRERAGPTGNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 40 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 100 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 101 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 103 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 104 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 105 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 106 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 110 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 117 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 126 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 127 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 128 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 129 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 130 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 131 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 132 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 133 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 134 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 135 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 136 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 139 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 140 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 141 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 142 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 205 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 206 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 207 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 253 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 257 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.9 |
| Metatranscriptomes | 1.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 6.58 |
| Rhizosphere | 93.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10006226 | 3300005937 | Bacteria | 12851 |
| 2 | JGI25407J50210_10005902 | 3300003373 | Bacteria | 3029 |
| 3 | JGI25407J50210_10053713 | 3300003373 | Bacteria | 1019 |
| 4 | JGI25407J50210_10056905 | 3300003373 | Bacteria | 985 |
| 5 | Ga0070658_10034810 | 3300005327 | Bacteria | 4053 |
| 6 | Ga0070658_10124607 | 3300005327 | Bacteria | 2144 |
| 7 | Ga0070658_10410511 | 3300005327 | Bacteria | 1164 |
| 8 | Ga0070683_100016823 | 3300005329 | Bacteria | 6452 |
| 9 | Ga0070683_100044654 | 3300005329 | Bacteria | 4087 |
| 10 | Ga0070683_100091904 | 3300005329 | Bacteria | 2850 |
| 11 | Ga0070683_100226245 | 3300005329 | Bacteria | 1778 |
| 12 | Ga0070680_100012860 | 3300005336 | Bacteria | 6511 |
| 13 | Ga0070680_100041925 | 3300005336 | Bacteria | 3712 |
| 14 | Ga0070680_100073056 | 3300005336 | Bacteria | 2820 |
| 15 | Ga0070680_100248010 | 3300005336 | Bacteria | 1505 |
| 16 | Ga0070682_100321681 | 3300005337 | Bacteria | 1143 |
| 17 | Ga0070660_100005006 | 3300005339 | Bacteria | 9162 |
| 18 | Ga0070660_100012974 | 3300005339 | Bacteria | 5963 |
| 19 | Ga0070660_100059187 | 3300005339 | Bacteria | 2971 |
| 20 | Ga0070660_100063175 | 3300005339 | Bacteria | 2878 |
| 21 | Ga0070660_100291890 | 3300005339 | Bacteria | 1335 |
| 22 | Ga0070661_100022800 | 3300005344 | Bacteria | 4483 |
| 23 | Ga0070671_100039747 | 3300005355 | Bacteria | 3905 |
| 24 | Ga0070671_100235863 | 3300005355 | Bacteria | 1552 |
| 25 | Ga0070659_100006234 | 3300005366 | Bacteria | 8616 |
| 26 | Ga0070659_100099419 | 3300005366 | Bacteria | 2340 |
| 27 | Ga0070709_10230710 | 3300005434 | Bacteria | 1324 |
| 28 | Ga0070709_10336035 | 3300005434 | Bacteria | 1112 |
| 29 | Ga0070714_100023746 | 3300005435 | Bacteria | 5041 |
| 30 | Ga0070714_100083604 | 3300005435 | Bacteria | 2784 |
| 31 | Ga0070714_100367419 | 3300005435 | Unclassified | 1354 |
| 32 | Ga0070714_100851771 | 3300005435 | Bacteria | 884 |
| 33 | Ga0070713_100047202 | 3300005436 | Bacteria | 3538 |
| 34 | Ga0070713_100362014 | 3300005436 | Bacteria | 1348 |
| 35 | Ga0070711_100025569 | 3300005439 | Bacteria | 3864 |
| 36 | Ga0070694_100016269 | 3300005444 | Bacteria | 4682 |
| 37 | Ga0070708_100001830 | 3300005445 | Bacteria | 16302 |
| 38 | Ga0070663_100053722 | 3300005455 | Bacteria | 2876 |
| 39 | Ga0070678_100230125 | 3300005456 | Bacteria | 1545 |
| 40 | Ga0070662_100190380 | 3300005457 | Unclassified | 1622 |
| 41 | Ga0070681_10003807 | 3300005458 | Bacteria | 14180 |
| 42 | Ga0070681_10014174 | 3300005458 | Bacteria | 7935 |
| 43 | Ga0070681_10081371 | 3300005458 | Bacteria | 3194 |
| 44 | Ga0070681_10113464 | 3300005458 | Bacteria | 2649 |
| 45 | Ga0070681_10285511 | 3300005458 | Bacteria | 1561 |
| 46 | Ga0068867_100102929 | 3300005459 | Bacteria | 2183 |
| 47 | Ga0070707_100267612 | 3300005468 | Bacteria | 1662 |
| 48 | Ga0070698_100093850 | 3300005471 | Bacteria | 2980 |
| 49 | Ga0070679_100033402 | 3300005530 | Bacteria | 5094 |
| 50 | Ga0070679_100057441 | 3300005530 | Bacteria | 3879 |
| 51 | Ga0070679_100068650 | 3300005530 | Bacteria | 3535 |
| 52 | Ga0070679_100295952 | 3300005530 | Bacteria | 1570 |
| 53 | Ga0070684_100026109 | 3300005535 | Bacteria | 4917 |
| 54 | Ga0070684_100055328 | 3300005535 | Bacteria | 3458 |
| 55 | Ga0070684_100073756 | 3300005535 | Bacteria | 3008 |
| 56 | Ga0070684_100108875 | 3300005535 | Bacteria | 2483 |
| 57 | Ga0068853_100332617 | 3300005539 | Bacteria | 1410 |
| 58 | Ga0070695_100000363 | 3300005545 | Bacteria | 23281 |
| 59 | Ga0070665_100014812 | 3300005548 | Bacteria | 7829 |
| 60 | Ga0068855_100019656 | 3300005563 | Bacteria | 8112 |
| 61 | Ga0068855_100030292 | 3300005563 | Bacteria | 6473 |
| 62 | Ga0068855_100071652 | 3300005563 | Bacteria | 4029 |
| 63 | Ga0068855_100073087 | 3300005563 | Bacteria | 3985 |
| 64 | Ga0068855_100130956 | 3300005563 | Bacteria | 2865 |
| 65 | Ga0068855_100159773 | 3300005563 | Bacteria | 2559 |
| 66 | Ga0068855_100184069 | 3300005563 | Bacteria | 2361 |
| 67 | Ga0068855_100229603 | 3300005563 | Bacteria | 2079 |
| 68 | Ga0068855_100342657 | 3300005563 | Bacteria | 1648 |
| 69 | Ga0068855_100600840 | 3300005563 | Bacteria | 1186 |
| 70 | Ga0068857_100054962 | 3300005577 | Bacteria | 3533 |
| 71 | Ga0068857_100099263 | 3300005577 | Bacteria | 2612 |
| 72 | Ga0068856_100028282 | 3300005614 | Bacteria | 5473 |
| 73 | Ga0068856_100263649 | 3300005614 | Bacteria | 1739 |
| 74 | Ga0068856_100427890 | 3300005614 | Bacteria | 1344 |
| 75 | Ga0068852_100028464 | 3300005616 | Bacteria | 4574 |
| 76 | Ga0068852_100275707 | 3300005616 | Bacteria | 1620 |
| 77 | Ga0068861_100026725 | 3300005719 | Bacteria | 4198 |
| 78 | Ga0081538_10000422 | 3300005981 | Bacteria | 47666 |
| 79 | Ga0081538_10001675 | 3300005981 | Bacteria | 22591 |
| 80 | Ga0081538_10006022 | 3300005981 | Bacteria | 10778 |
| 81 | Ga0081538_10007727 | 3300005981 | Bacteria | 9259 |
| 82 | Ga0081538_10014034 | 3300005981 | Bacteria | 6298 |
| 83 | Ga0081538_10014948 | 3300005981 | Bacteria | 6043 |
| 84 | Ga0081538_10019672 | 3300005981 | Bacteria | 5002 |
| 85 | Ga0081538_10036896 | 3300005981 | Bacteria | 3181 |
| 86 | Ga0081538_10083039 | 3300005981 | Bacteria | 1695 |
| 87 | Ga0081538_10112506 | 3300005981 | Bacteria | 1332 |
| 88 | Ga0081539_10030272 | 3300005985 | Bacteria | 3364 |
| 89 | Ga0070715_10040843 | 3300006163 | Bacteria | 1941 |
| 90 | Ga0070716_100330121 | 3300006173 | Bacteria | 1072 |
| 91 | Ga0070712_100040232 | 3300006175 | Bacteria | 3204 |
| 92 | Ga0070712_100303119 | 3300006175 | Unclassified | 1294 |
| 93 | Ga0075428_100009740 | 3300006844 | Bacteria | 10674 |
| 94 | Ga0075430_100029414 | 3300006846 | Bacteria | 4663 |
| 95 | Ga0075430_100290084 | 3300006846 | Unclassified | 1353 |
| 96 | Ga0075433_10130273 | 3300006852 | Bacteria | 2235 |
| 97 | Ga0075433_10184140 | 3300006852 | Bacteria | 1858 |
| 98 | Ga0075434_100026949 | 3300006871 | Bacteria | 5638 |
| 99 | Ga0075434_100041074 | 3300006871 | Bacteria | 4581 |
| 100 | Ga0075429_100002297 | 3300006880 | Bacteria | 16043 |
| 101 | Ga0075435_100030491 | 3300007076 | Bacteria | 4242 |
| 102 | Ga0075435_100036259 | 3300007076 | Bacteria | 3918 |
| 103 | Ga0075435_100459600 | 3300007076 | Bacteria | 1098 |
| 104 | Ga0105240_10090173 | 3300009093 | Bacteria | 3748 |
| 105 | Ga0105240_10123419 | 3300009093 | Bacteria | 3116 |
| 106 | Ga0105240_10131750 | 3300009093 | Bacteria | 2998 |
| 107 | Ga0105240_10303356 | 3300009093 | Bacteria | 1826 |
| 108 | Ga0105240_10553031 | 3300009093 | Bacteria | 1273 |
| 109 | Ga0105245_10009806 | 3300009098 | Bacteria | 8345 |
| 110 | Ga0105245_10952122 | 3300009098 | Bacteria | 902 |
| 111 | Ga0114129_10025201 | 3300009147 | Bacteria | 8429 |
| 112 | Ga0114129_10132686 | 3300009147 | Bacteria | 3419 |
| 113 | Ga0114129_10448436 | 3300009147 | Bacteria | 1692 |
| 114 | Ga0105243_10307113 | 3300009148 | Bacteria | 1440 |
| 115 | Ga0105248_10055191 | 3300009177 | Bacteria | 4455 |
| 116 | Ga0105237_10019269 | 3300009545 | Bacteria | 7048 |
| 117 | Ga0105237_10034687 | 3300009545 | Bacteria | 5107 |
| 118 | Ga0105249_10003773 | 3300009553 | Bacteria | 13079 |
| 119 | Ga0105239_10142751 | 3300010375 | Bacteria | 2669 |
| 120 | Ga0157371_10453006 | 3300013102 | Bacteria | 944 |
| 121 | Ga0157370_10019774 | 3300013104 | Bacteria | 6741 |
| 122 | Ga0157370_10026504 | 3300013104 | Bacteria | 5722 |
| 123 | Ga0157370_10035304 | 3300013104 | Bacteria | 4862 |
| 124 | Ga0157370_10046160 | 3300013104 | Bacteria | 4177 |
| 125 | Ga0157370_10099117 | 3300013104 | Bacteria | 2731 |
| 126 | Ga0157370_10112184 | 3300013104 | Bacteria | 2549 |
| 127 | Ga0157369_10001698 | 3300013105 | Bacteria | 26844 |
| 128 | Ga0157369_10007440 | 3300013105 | Bacteria | 12611 |
| 129 | Ga0157369_10008364 | 3300013105 | Bacteria | 11867 |
| 130 | Ga0157369_10016138 | 3300013105 | Bacteria | 8406 |
| 131 | Ga0157369_10022141 | 3300013105 | Bacteria | 7100 |
| 132 | Ga0157369_10112806 | 3300013105 | Bacteria | 2888 |
| 133 | Ga0157369_10298148 | 3300013105 | Bacteria | 1677 |
| 134 | Ga0157369_10775942 | 3300013105 | Bacteria | 985 |
| 135 | Ga0157374_10014229 | 3300013296 | Bacteria | 6958 |
| 136 | Ga0157374_10283589 | 3300013296 | Bacteria | 1636 |
| 137 | Ga0163162_10087531 | 3300013306 | Bacteria | 3193 |
| 138 | Ga0157372_10134907 | 3300013307 | Bacteria | 2842 |
| 139 | Ga0157372_10144880 | 3300013307 | Bacteria | 2739 |
| 140 | Ga0157372_10189655 | 3300013307 | Bacteria | 2381 |
| 141 | Ga0157376_10021202 | 3300014969 | Bacteria | 5045 |
| 142 | Ga0163161_10067961 | 3300017792 | Bacteria | 2603 |
| 143 | Ga0206356_10185080 | 3300020070 | Bacteria | 1296 |
| 144 | Ga0206354_11243756 | 3300020081 | Bacteria | 2703 |
| 145 | Ga0206354_11249356 | 3300020081 | Bacteria | 1553 |
| 146 | Ga0206353_10111715 | 3300020082 | Bacteria | 1036 |
| 147 | Ga0206353_10157841 | 3300020082 | Unclassified | 1243 |
| 148 | Ga0206353_10612681 | 3300020082 | Bacteria | 3918 |
| 149 | Ga0206353_10848156 | 3300020082 | Bacteria | 2041 |
| 150 | Ga0206353_11917284 | 3300020082 | Bacteria | 6374 |
| 151 | Ga0207692_10088088 | 3300025898 | Bacteria | 1677 |
| 152 | Ga0207685_10021829 | 3300025905 | Bacteria | 2152 |
| 153 | Ga0207705_10005302 | 3300025909 | Bacteria | 9646 |
| 154 | Ga0207705_10051193 | 3300025909 | Bacteria | 2973 |
| 155 | Ga0207705_10243173 | 3300025909 | Bacteria | 1371 |
| 156 | Ga0207707_10011640 | 3300025912 | Bacteria | 7656 |
| 157 | Ga0207707_10025091 | 3300025912 | Bacteria | 5214 |
| 158 | Ga0207707_10106801 | 3300025912 | Bacteria | 2447 |
| 159 | Ga0207707_10557395 | 3300025912 | Bacteria | 973 |
| 160 | Ga0207695_10095748 | 3300025913 | Bacteria | 2972 |
| 161 | Ga0207695_10096999 | 3300025913 | Bacteria | 2949 |
| 162 | Ga0207695_10122044 | 3300025913 | Bacteria | 2572 |
| 163 | Ga0207671_10031828 | 3300025914 | Bacteria | 3929 |
| 164 | Ga0207693_10014330 | 3300025915 | Bacteria | 6378 |
| 165 | Ga0207693_10285205 | 3300025915 | Unclassified | 1294 |
| 166 | Ga0207663_10012840 | 3300025916 | Bacteria | 4539 |
| 167 | Ga0207663_10236219 | 3300025916 | Bacteria | 1338 |
| 168 | Ga0207660_10124530 | 3300025917 | Bacteria | 1956 |
| 169 | Ga0207660_10135627 | 3300025917 | Bacteria | 1878 |
| 170 | Ga0207660_10440181 | 3300025917 | Bacteria | 1053 |
| 171 | Ga0207657_10000073 | 3300025919 | Bacteria | 93299 |
| 172 | Ga0207657_10010590 | 3300025919 | Bacteria | 9191 |
| 173 | Ga0207657_10010720 | 3300025919 | Bacteria | 9125 |
| 174 | Ga0207657_10015733 | 3300025919 | Bacteria | 7315 |
| 175 | Ga0207657_10016460 | 3300025919 | Bacteria | 7132 |
| 176 | Ga0207657_10169975 | 3300025919 | Bacteria | 1767 |
| 177 | Ga0207657_10217177 | 3300025919 | Bacteria | 1533 |
| 178 | Ga0207657_10267170 | 3300025919 | Bacteria | 1360 |
| 179 | Ga0207649_10087909 | 3300025920 | Bacteria | 2028 |
| 180 | Ga0207652_10006996 | 3300025921 | Bacteria | 9091 |
| 181 | Ga0207652_10014110 | 3300025921 | Bacteria | 6469 |
| 182 | Ga0207652_10043580 | 3300025921 | Bacteria | 3820 |
| 183 | Ga0207652_10066846 | 3300025921 | Bacteria | 3116 |
| 184 | Ga0207652_10125639 | 3300025921 | Bacteria | 2284 |
| 185 | Ga0207652_10155830 | 3300025921 | Bacteria | 2046 |
| 186 | Ga0207652_10301939 | 3300025921 | Bacteria | 1445 |
| 187 | Ga0207646_10522375 | 3300025922 | Bacteria | 1069 |
| 188 | Ga0207687_10030929 | 3300025927 | Bacteria | 3614 |
| 189 | Ga0207700_10346287 | 3300025928 | Bacteria | 1293 |
| 190 | Ga0207664_10050732 | 3300025929 | Bacteria | 3273 |
| 191 | Ga0207664_10212151 | 3300025929 | Bacteria | 1676 |
| 192 | Ga0207644_10024759 | 3300025931 | Bacteria | 4123 |
| 193 | Ga0207644_10066089 | 3300025931 | Bacteria | 2632 |
| 194 | Ga0207690_10090339 | 3300025932 | Bacteria | 2162 |
| 195 | Ga0207690_10126148 | 3300025932 | Bacteria | 1867 |
| 196 | Ga0207709_10298445 | 3300025935 | Bacteria | 1197 |
| 197 | Ga0207665_10101995 | 3300025939 | Bacteria | 2005 |
| 198 | Ga0207665_10447890 | 3300025939 | Unclassified | 990 |
| 199 | Ga0207711_10037463 | 3300025941 | Bacteria | 4119 |
| 200 | Ga0207661_10051814 | 3300025944 | Bacteria | 3276 |
| 201 | Ga0207661_10133412 | 3300025944 | Bacteria | 2130 |
| 202 | Ga0207661_10178672 | 3300025944 | Bacteria | 1852 |
| 203 | Ga0207661_10187210 | 3300025944 | Bacteria | 1813 |
| 204 | Ga0207661_10258791 | 3300025944 | Bacteria | 1549 |
| 205 | Ga0207667_10059057 | 3300025949 | Bacteria | 4019 |
| 206 | Ga0207667_10092544 | 3300025949 | Unclassified | 3122 |
| 207 | Ga0207667_10255067 | 3300025949 | Bacteria | 1794 |
| 208 | Ga0207667_10269579 | 3300025949 | Unclassified | 1740 |
| 209 | Ga0207667_10341448 | 3300025949 | Bacteria | 1528 |
| 210 | Ga0207668_10035770 | 3300025972 | Bacteria | 3310 |
| 211 | Ga0207678_10111461 | 3300026067 | Bacteria | 2334 |
| 212 | Ga0207678_10171981 | 3300026067 | Bacteria | 1850 |
| 213 | Ga0207702_10106132 | 3300026078 | Bacteria | 2489 |
| 214 | Ga0207674_10018144 | 3300026116 | Bacteria | 7656 |
| 215 | Ga0207674_10018333 | 3300026116 | Bacteria | 7611 |
| 216 | Ga0207675_100010255 | 3300026118 | Bacteria | 8778 |
| 217 | Ga0207698_10029502 | 3300026142 | Bacteria | 3930 |
| 218 | Ga0268266_10328542 | 3300028379 | Bacteria | 1433 |
| 219 | Ga0265334_10042567 | 3300028573 | Bacteria | 1769 |
| 220 | Ga0265322_10015994 | 3300028654 | Bacteria | 2166 |
| 221 | Ga0265338_10006961 | 3300028800 | Bacteria | 14215 |
| 222 | Ga0265338_10009734 | 3300028800 | Bacteria | 11403 |
| 223 | Ga0265338_10017960 | 3300028800 | Bacteria | 7595 |
| 224 | Ga0265338_10052017 | 3300028800 | Bacteria | 3681 |
| 225 | Ga0265330_10049513 | 3300031235 | Bacteria | 1845 |
| 226 | Ga0265332_10053381 | 3300031238 | Bacteria | 1735 |
| 227 | Ga0265329_10024609 | 3300031242 | Bacteria | 1997 |
| 228 | Ga0265340_10046471 | 3300031247 | Bacteria | 2118 |
| 229 | Ga0265340_10084745 | 3300031247 | Bacteria | 1488 |
| 230 | Ga0265339_10032722 | 3300031249 | Bacteria | 2932 |
| 231 | Ga0265331_10026530 | 3300031250 | Bacteria | 2911 |
| 232 | Ga0265327_10075855 | 3300031251 | Bacteria | 1672 |
| 233 | Ga0265316_10031076 | 3300031344 | Bacteria | 4370 |
| 234 | Ga0265313_10005968 | 3300031595 | Bacteria | 8803 |
| 235 | Ga0265313_10013854 | 3300031595 | Bacteria | 4805 |
| 236 | Ga0265314_10004242 | 3300031711 | Bacteria | 13437 |
| 237 | Ga0265314_10061767 | 3300031711 | Bacteria | 2549 |
| 238 | Ga0307416_100001175 | 3300032002 | Bacteria | 14020 |
| 239 | Ga0307416_100208088 | 3300032002 | Bacteria | 1863 |
| 240 | Ga0307411_10194302 | 3300032005 | Bacteria | 1552 |
| 241 | Ga0373926_0037279 | 3300035083 | Bacteria | 1729 |
| 242 | Ga0373926_0047112 | 3300035083 | Bacteria | 1548 |
| 243 | Ga0373936_0201590 | 3300035113 | Bacteria | 878 |
| 244 | Ga0373945_0081499 | 3300035116 | Bacteria | 1240 |
| 245 | Ga0373943_0000966 | 3300035170 | Bacteria | 12768 |
| 246 | Ga0373943_0002489 | 3300035170 | Bacteria | 8372 |
| 247 | Ga0373946_0001677 | 3300035171 | Bacteria | 7717 |
| 248 | Ga0373946_0006830 | 3300035171 | Bacteria | 4152 |
| 249 | Ga0373955_0062400 | 3300035172 | Bacteria | 2061 |
| 250 | Ga0373935_0054731 | 3300035692 | Bacteria | 2542 |
| 251 | Ga0373927_0069903 | 3300035695 | Bacteria | 2273 |
| 252 | Ga0373933_0048104 | 3300035724 | Bacteria | 2539 |
| 253 | Ga0373933_0212166 | 3300035724 | Bacteria | 1241 |
| 254 | Ga0373947_0003172 | 3300035725 | Bacteria | 9784 |
| 255 | Ga0373947_0013716 | 3300035725 | Bacteria | 4643 |
| 256 | Ga0373947_0085098 | 3300035725 | Bacteria | 1963 |
| 257 | Ga0373937_0106697 | 3300036401 | Bacteria | 2604 |
| 258 | Ga0373925_0003039 | 3300037068 | Bacteria | 13201 |
| 259 | Ga0373925_0003069 | 3300037068 | Bacteria | 13129 |
| 260 | Ga0373925_0045015 | 3300037068 | Bacteria | 3277 |
| 261 | Ga0373925_0046324 | 3300037068 | Bacteria | 3233 |
| 262 | Ga0395899_0005600 | 3300037312 | Bacteria | 9741 |
| 263 | Ga0395899_0008184 | 3300037312 | Bacteria | 8057 |
| 264 | Ga0395899_0018953 | 3300037312 | Bacteria | 5228 |
| 265 | Ga0395899_0202562 | 3300037312 | Bacteria | 1383 |
| 266 | Ga0395899_0255097 | 3300037312 | Bacteria | 1202 |
| 267 | Ga0395900_0024282 | 3300037418 | Bacteria | 6207 |
| 268 | Ga0395900_0053817 | 3300037418 | Bacteria | 4143 |
| 269 | Ga0395900_0066345 | 3300037418 | Bacteria | 3708 |
| 270 | Ga0395900_0068803 | 3300037418 | Bacteria | 3638 |
| 271 | Ga0395900_0711476 | 3300037418 | Bacteria | 937 |
| 272 | Ga0395898_0005945 | 3300037466 | Bacteria | 13105 |
| 273 | Ga0395898_0017263 | 3300037466 | Bacteria | 7371 |
| 274 | Ga0395898_0024048 | 3300037466 | Bacteria | 6148 |
| 275 | Ga0395898_0034147 | 3300037466 | Bacteria | 5071 |
| 276 | Ga0395898_0036588 | 3300037466 | Bacteria | 4874 |
| 277 | Ga0395898_0043991 | 3300037466 | Bacteria | 4398 |
| 278 | Ga0395898_0056155 | 3300037466 | Bacteria | 3839 |
| 279 | Ga0395898_0109580 | 3300037466 | Bacteria | 2647 |
| 280 | Ga0395898_0110163 | 3300037466 | Bacteria | 2639 |
| 281 | Ga0395898_0154040 | 3300037466 | Bacteria | 2199 |
| 282 | Ga0395898_0174641 | 3300037466 | Bacteria | 2054 |
| 283 | Ga0395898_0295888 | 3300037466 | Unclassified | 1544 |
| 284 | Ga0395898_0307813 | 3300037466 | Bacteria | 1511 |
| 285 | Ga0395898_0552035 | 3300037466 | Bacteria | 1094 |
| 286 | Ga0395898_0573064 | 3300037466 | Bacteria | 1071 |
| 287 | Ga0395905_0014380 | 3300037471 | Bacteria | 7560 |
| 288 | Ga0395905_0026654 | 3300037471 | Bacteria | 5449 |
| 289 | Ga0395905_0041194 | 3300037471 | Bacteria | 4334 |
| 290 | Ga0395905_0056928 | 3300037471 | Bacteria | 3656 |
| 291 | Ga0395905_0162872 | 3300037471 | Bacteria | 2096 |
| 292 | Ga0395905_0187114 | 3300037471 | Bacteria | 1943 |
| 293 | Ga0395905_0219814 | 3300037471 | Bacteria | 1778 |
| 294 | Ga0395901_0005220 | 3300038443 | Bacteria | 13111 |
| 295 | Ga0395901_0005275 | 3300038443 | Bacteria | 13054 |
| 296 | Ga0395901_0006754 | 3300038443 | Bacteria | 11586 |
| 297 | Ga0395901_0024891 | 3300038443 | Bacteria | 6144 |
| 298 | Ga0395901_0029426 | 3300038443 | Bacteria | 5656 |
| 299 | Ga0395901_0037137 | 3300038443 | Bacteria | 5039 |
| 300 | Ga0395901_0048751 | 3300038443 | Bacteria | 4399 |
| 301 | Ga0395901_0051850 | 3300038443 | Bacteria | 4265 |
| 302 | Ga0395901_0088596 | 3300038443 | Bacteria | 3237 |
| 303 | Ga0395901_0097615 | 3300038443 | Bacteria | 3080 |
| 304 | Ga0395901_0235105 | 3300038443 | Bacteria | 1912 |
| 305 | Ga0395901_0249891 | 3300038443 | Bacteria | 1848 |
| 306 | Ga0395901_0346299 | 3300038443 | Unclassified | 1534 |
| 307 | Ga0395901_0592839 | 3300038443 | Bacteria | 1118 |
| 308 | Ga0436363_1428459 | 3300039450 | Bacteria | 1150 |
| 309 | Ga0466969_0025421 | 3300044656 | Bacteria | 3045 |
| 310 | Ga0466969_0170813 | 3300044656 | Bacteria | 997 |
| 311 | Ga0466972_0022919 | 3300044658 | Bacteria | 3107 |
| 312 | Ga0466972_0081011 | 3300044658 | Bacteria | 1546 |
| 313 | Ga0466965_0043907 | 3300044683 | Bacteria | 2208 |
| 314 | Ga0466965_0044369 | 3300044683 | Bacteria | 2197 |
| 315 | Ga0466966_0023608 | 3300044684 | Bacteria | 4025 |
| 316 | Ga0466966_0035285 | 3300044684 | Bacteria | 3231 |
| 317 | Ga0466961_0002101 | 3300044693 | Bacteria | 12397 |
| 318 | Ga0466961_0033677 | 3300044693 | Bacteria | 3291 |
| 319 | Ga0466963_0001185 | 3300044694 | Bacteria | 13711 |
| 320 | Ga0466963_0004849 | 3300044694 | Bacteria | 7838 |
| 321 | Ga0466963_0010507 | 3300044694 | Bacteria | 5606 |
| 322 | Ga0466963_0035695 | 3300044694 | Bacteria | 3240 |
| 323 | Ga0466963_0042576 | 3300044694 | Bacteria | 2982 |
| 324 | Ga0466963_0043814 | 3300044694 | Bacteria | 2944 |
| 325 | Ga0466963_0050080 | 3300044694 | Bacteria | 2764 |
| 326 | Ga0466963_0110937 | 3300044694 | Bacteria | 1883 |
| 327 | Ga0466963_0120260 | 3300044694 | Bacteria | 1807 |
| 328 | Ga0466963_0160044 | 3300044694 | Bacteria | 1567 |
| 329 | Ga0466963_0274073 | 3300044694 | Unclassified | 1185 |
| 330 | Ga0466963_0340883 | 3300044694 | Bacteria | 1055 |
| 331 | Ga0466964_0004052 | 3300044706 | Bacteria | 5389 |
| 332 | Ga0466964_0016147 | 3300044706 | Bacteria | 2847 |
| 333 | Ga0466964_0019747 | 3300044706 | Bacteria | 2592 |
| 334 | Ga0466964_0021696 | 3300044706 | Bacteria | 2485 |
| 335 | Ga0466964_0022222 | 3300044706 | Bacteria | 2459 |
| 336 | Ga0466964_0023337 | 3300044706 | Bacteria | 2405 |
| 337 | Ga0466964_0031058 | 3300044706 | Bacteria | 2117 |
| 338 | Ga0466971_0001723 | 3300044719 | Bacteria | 9261 |
| 339 | Ga0466971_0003499 | 3300044719 | Bacteria | 6706 |
| 340 | Ga0466971_0016779 | 3300044719 | Bacteria | 3234 |
| 341 | Ga0466971_0021582 | 3300044719 | Bacteria | 2865 |
| 342 | Ga0466971_0066059 | 3300044719 | Unclassified | 1638 |
| 343 | Ga0466968_0026460 | 3300044735 | Bacteria | 2381 |
| 344 | Ga0466970_0052543 | 3300044765 | Bacteria | 2175 |
| 345 | Ga0466970_0120385 | 3300044765 | Unclassified | 1437 |
| 346 | Ga0466957_0006882 | 3300044842 | Bacteria | 6425 |
| 347 | Ga0466957_0022489 | 3300044842 | Bacteria | 3721 |
| 348 | Ga0466957_0033404 | 3300044842 | Bacteria | 3087 |
| 349 | Ga0466957_0063724 | 3300044842 | Bacteria | 2267 |
| 350 | Ga0466957_0094230 | 3300044842 | Bacteria | 1880 |
| 351 | Ga0466957_0299980 | 3300044842 | Bacteria | 1079 |
| 352 | Ga0466957_0456537 | 3300044842 | Bacteria | 881 |
| 353 | Ga0466960_0014414 | 3300044901 | Bacteria | 3383 |
| 354 | Ga0466960_0053235 | 3300044901 | Bacteria | 1961 |
| 355 | Ga0466959_0010640 | 3300045049 | Bacteria | 6588 |
| 356 | Ga0466959_0017968 | 3300045049 | Bacteria | 5189 |
| 357 | Ga0466959_0019604 | 3300045049 | Bacteria | 4975 |
| 358 | Ga0466959_0020216 | 3300045049 | Bacteria | 4902 |
| 359 | Ga0466959_0020559 | 3300045049 | Bacteria | 4864 |
| 360 | Ga0466959_0140308 | 3300045049 | Bacteria | 1708 |
| 361 | Ga0466959_0216741 | 3300045049 | Bacteria | 1328 |
| 362 | Ga0466959_0289857 | 3300045049 | Bacteria | 1122 |
| 363 | Ga0466958_0000907 | 3300045836 | Bacteria | 13298 |
| 364 | Ga0466958_0003727 | 3300045836 | Bacteria | 7955 |
| 365 | Ga0466958_0045620 | 3300045836 | Bacteria | 2644 |
| 366 | Ga0466958_0055448 | 3300045836 | Bacteria | 2405 |
| 367 | Ga0466958_0076592 | 3300045836 | Bacteria | 2053 |
| 368 | Ga0466958_0104318 | 3300045836 | Bacteria | 1766 |
| 369 | Ga0466958_0122288 | 3300045836 | Bacteria | 1630 |
| 370 | Ga0466958_0207522 | 3300045836 | Bacteria | 1248 |
| 371 | Ga0466958_0265700 | 3300045836 | Bacteria | 1098 |
| 372 | Ga0466967_0002594 | 3300045976 | Bacteria | 11356 |
| 373 | Ga0466967_0003450 | 3300045976 | Bacteria | 10321 |
| 374 | Ga0466967_0005793 | 3300045976 | Bacteria | 8641 |
| 375 | Ga0466967_0006378 | 3300045976 | Bacteria | 8337 |
| 376 | Ga0466967_0013745 | 3300045976 | Bacteria | 6271 |
| 377 | Ga0466967_0014667 | 3300045976 | Bacteria | 6116 |
| 378 | Ga0466967_0014982 | 3300045976 | Bacteria | 6063 |
| 379 | Ga0466967_0027979 | 3300045976 | Bacteria | 4698 |
| 380 | Ga0466967_0051199 | 3300045976 | Bacteria | 3618 |
| 381 | Ga0466967_0060994 | 3300045976 | Bacteria | 3344 |
| 382 | Ga0466967_0082130 | 3300045976 | Bacteria | 2911 |
| 383 | Ga0466967_0083765 | 3300045976 | Bacteria | 2884 |
| 384 | Ga0466967_0103941 | 3300045976 | Bacteria | 2599 |
| 385 | Ga0466967_0138716 | 3300045976 | Bacteria | 2263 |
| 386 | Ga0466967_0149895 | 3300045976 | Bacteria | 2179 |
| 387 | Ga0466967_0169476 | 3300045976 | Bacteria | 2053 |
| 388 | Ga0466967_0241284 | 3300045976 | Bacteria | 1724 |
| 389 | Ga0466967_0248550 | 3300045976 | Bacteria | 1698 |
| 390 | Ga0466967_0313141 | 3300045976 | Bacteria | 1512 |
| 391 | Ga0466967_0366104 | 3300045976 | Bacteria | 1397 |
| 392 | Ga0495592_0004301 | 3300046454 | Bacteria | 10412 |
| 393 | Ga0495592_0058302 | 3300046454 | Bacteria | 2848 |
| 394 | Ga0495592_0084790 | 3300046454 | Bacteria | 2285 |
| 395 | Ga0495592_0132050 | 3300046454 | Bacteria | 1746 |
| 396 | Ga0495603_0026451 | 3300046455 | Bacteria | 3505 |
| 397 | Ga0495603_0047464 | 3300046455 | Bacteria | 2557 |
| 398 | Ga0495629_0000349 | 3300046459 | Bacteria | 39311 |
| 399 | Ga0495629_0021069 | 3300046459 | Bacteria | 4651 |
| 400 | Ga0495629_0142323 | 3300046459 | Bacteria | 1668 |
| 401 | Ga0495641_0000494 | 3300046461 | Bacteria | 33001 |
| 402 | Ga0495641_0004048 | 3300046461 | Bacteria | 10615 |
| 403 | Ga0495641_0035070 | 3300046461 | Bacteria | 2368 |
| 404 | Ga0495651_0056790 | 3300046462 | Bacteria | 3006 |
| 405 | Ga0495651_0072909 | 3300046462 | Bacteria | 2607 |
| 406 | Ga0495651_0089901 | 3300046462 | Bacteria | 2304 |
| 407 | Ga0495651_0225973 | 3300046462 | Bacteria | 1292 |
| 408 | Ga0495651_0275279 | 3300046462 | Bacteria | 1139 |
| 409 | Ga0495653_0003625 | 3300046463 | Bacteria | 12451 |
| 410 | Ga0495653_0031880 | 3300046463 | Bacteria | 4187 |
| 411 | Ga0495653_0072984 | 3300046463 | Bacteria | 2562 |
| 412 | Ga0495653_0085368 | 3300046463 | Bacteria | 2322 |
| 413 | Ga0495653_0097829 | 3300046463 | Bacteria | 2131 |
| 414 | Ga0495580_0203470 | 3300046472 | Bacteria | 1364 |
| 415 | Ga0495582_0004719 | 3300046473 | Bacteria | 7659 |
| 416 | Ga0495605_0112792 | 3300046474 | Unclassified | 1239 |
| 417 | Ga0495639_0000386 | 3300046475 | Bacteria | 21052 |
| 418 | Ga0495639_0004618 | 3300046475 | Bacteria | 5910 |
| 419 | Ga0495662_0000205 | 3300046476 | Bacteria | 24502 |
| 420 | Ga0495662_0000943 | 3300046476 | Bacteria | 14253 |
| 421 | Ga0495662_0060272 | 3300046476 | Bacteria | 1833 |
| 422 | Ga0495662_0132262 | 3300046476 | Bacteria | 1227 |
| 423 | Ga0495585_0087799 | 3300046492 | Bacteria | 1678 |
| 424 | Ga0495607_0028837 | 3300046501 | Bacteria | 3419 |
| 425 | Ga0495608_0009205 | 3300046511 | Bacteria | 6907 |
| 426 | Ga0495608_0049889 | 3300046511 | Bacteria | 2777 |
| 427 | Ga0495608_0071856 | 3300046511 | Bacteria | 2257 |
| 428 | Ga0495618_0012134 | 3300046514 | Bacteria | 5230 |
| 429 | Ga0495618_0017488 | 3300046514 | Bacteria | 4396 |
| 430 | Ga0495628_0009377 | 3300046516 | Bacteria | 8354 |
| 431 | Ga0495628_0011556 | 3300046516 | Bacteria | 7465 |
| 432 | Ga0495630_0011615 | 3300046517 | Bacteria | 6380 |
| 433 | Ga0495630_0016892 | 3300046517 | Bacteria | 5340 |
| 434 | Ga0495630_0022376 | 3300046517 | Bacteria | 4667 |
| 435 | Ga0495630_0042674 | 3300046517 | Bacteria | 3387 |
| 436 | Ga0495630_0042844 | 3300046517 | Bacteria | 3380 |
| 437 | Ga0495630_0093917 | 3300046517 | Bacteria | 2267 |
| 438 | Ga0495663_0036520 | 3300046525 | Bacteria | 1479 |
| 439 | Ga0495666_0000241 | 3300046526 | Bacteria | 23544 |
| 440 | Ga0495666_0055663 | 3300046526 | Bacteria | 1895 |
| 441 | Ga0495652_0009902 | 3300046529 | Bacteria | 8643 |
| 442 | Ga0495652_0115326 | 3300046529 | Bacteria | 2152 |
| 443 | Ga0495652_0171163 | 3300046529 | Bacteria | 1676 |
| 444 | Ga0495652_0186166 | 3300046529 | Bacteria | 1588 |
| 445 | Ga0495665_0000739 | 3300046531 | Bacteria | 16923 |
| 446 | Ga0495665_0001708 | 3300046531 | Bacteria | 11768 |
| 447 | Ga0495665_0186750 | 3300046531 | Bacteria | 1076 |
| 448 | Ga0495640_0013233 | 3300046533 | Bacteria | 6274 |
| 449 | Ga0495640_0055929 | 3300046533 | Bacteria | 2698 |
| 450 | Ga0495640_0061391 | 3300046533 | Bacteria | 2553 |
| 451 | Ga0495640_0263778 | 3300046533 | Bacteria | 1076 |
| 452 | Ga0495640_0278491 | 3300046533 | Bacteria | 1042 |
| 453 | Ga0495586_0173936 | 3300046535 | Bacteria | 1217 |
| 454 | Ga0495587_0044904 | 3300046536 | Bacteria | 2627 |
| 455 | Ga0495587_0164439 | 3300046536 | Bacteria | 1262 |
| 456 | Ga0495645_0045918 | 3300046543 | Bacteria | 3185 |
| 457 | Ga0495645_0099848 | 3300046543 | Bacteria | 2065 |
| 458 | Ga0495645_0179068 | 3300046543 | Bacteria | 1454 |
| 459 | Ga0495667_0019097 | 3300046559 | Bacteria | 4626 |
| 460 | Ga0495667_0021551 | 3300046559 | Bacteria | 4348 |
| 461 | Ga0495667_0046978 | 3300046559 | Bacteria | 2853 |
| 462 | Ga0495667_0143691 | 3300046559 | Bacteria | 1537 |
| 463 | Ga0495656_0008016 | 3300046615 | Bacteria | 3758 |
| 464 | Ga0495634_0007732 | 3300046642 | Bacteria | 8042 |
| 465 | Ga0495634_0029774 | 3300046642 | Bacteria | 3778 |
| 466 | Ga0495634_0082043 | 3300046642 | Bacteria | 2108 |
| 467 | Ga0495611_0068859 | 3300046648 | Bacteria | 1616 |
| 468 | Ga0495635_0005865 | 3300046663 | Bacteria | 8559 |
| 469 | Ga0495635_0073794 | 3300046663 | Bacteria | 2337 |
| 470 | Ga0495635_0119252 | 3300046663 | Bacteria | 1800 |
| 471 | Ga0495635_0125474 | 3300046663 | Bacteria | 1751 |
| 472 | Ga0495635_0246302 | 3300046663 | Bacteria | 1205 |
| 473 | Ga0495635_0249661 | 3300046663 | Bacteria | 1196 |
| 474 | Ga0495588_0233226 | 3300046674 | Bacteria | 971 |
| 475 | Ga0495657_0009030 | 3300046675 | Bacteria | 7582 |
| 476 | Ga0495657_0053354 | 3300046675 | Bacteria | 2706 |
| 477 | Ga0495657_0086442 | 3300046675 | Bacteria | 2020 |
| 478 | Ga0495657_0211263 | 3300046675 | Bacteria | 1180 |
| 479 | Ga0495657_0393566 | 3300046675 | Unclassified | 816 |
| 480 | Ga0495599_0001915 | 3300046678 | Bacteria | 12048 |
| 481 | Ga0495599_0017772 | 3300046678 | Bacteria | 4426 |
| 482 | Ga0495599_0042291 | 3300046678 | Bacteria | 2859 |
| 483 | Ga0495599_0069593 | 3300046678 | Bacteria | 2196 |
| 484 | Ga0495646_0030954 | 3300046680 | Bacteria | 3339 |
| 485 | Ga0495646_0160342 | 3300046680 | Bacteria | 1246 |
| 486 | Ga0495646_0166094 | 3300046680 | Bacteria | 1219 |
| 487 | Ga0495647_0000459 | 3300046681 | Bacteria | 11746 |
| 488 | Ga0495647_0007052 | 3300046681 | Bacteria | 3748 |
| 489 | Ga0495658_0001095 | 3300046683 | Bacteria | 14299 |
| 490 | Ga0495658_0008072 | 3300046683 | Bacteria | 5211 |
| 491 | Ga0495658_0117402 | 3300046683 | Bacteria | 1606 |
| 492 | Ga0495658_0263397 | 3300046683 | Bacteria | 1085 |
| 493 | Ga0495613_0001699 | 3300046689 | Bacteria | 16771 |
| 494 | Ga0495613_0027945 | 3300046689 | Bacteria | 4199 |
| 495 | Ga0495613_0153353 | 3300046689 | Bacteria | 1642 |
| 496 | Ga0495624_0005284 | 3300046690 | Bacteria | 9326 |
| 497 | Ga0495624_0188865 | 3300046690 | Bacteria | 1253 |
| 498 | Ga0495600_0005713 | 3300046809 | Bacteria | 7516 |
| 499 | Ga0495581_0001329 | 3300047315 | Bacteria | 13641 |
| 500 | Ga0495581_0005659 | 3300047315 | Bacteria | 7246 |
| 501 | Ga0495604_0112412 | 3300047317 | Bacteria | 1984 |
| 502 | Ga0495674_0002551 | 3300047319 | Bacteria | 17744 |
| 503 | Ga0495674_0019005 | 3300047319 | Bacteria | 6389 |
| 504 | Ga0495674_0021561 | 3300047319 | Bacteria | 5956 |
| 505 | Ga0495674_0140253 | 3300047319 | Bacteria | 2032 |
| 506 | Ga0495674_0157406 | 3300047319 | Bacteria | 1902 |
| 507 | Ga0495676_0000940 | 3300047321 | Bacteria | 24451 |
| 508 | Ga0495676_0033863 | 3300047321 | Bacteria | 4294 |
| 509 | Ga0495676_0073667 | 3300047321 | Bacteria | 2617 |
| 510 | Ga0495676_0126034 | 3300047321 | Bacteria | 1856 |
| 511 | Ga0495680_0000259 | 3300047322 | Bacteria | 58560 |
| 512 | Ga0495680_0002170 | 3300047322 | Bacteria | 20303 |
| 513 | Ga0495680_0011371 | 3300047322 | Bacteria | 7880 |
| 514 | Ga0495680_0024798 | 3300047322 | Bacteria | 4968 |
| 515 | Ga0495680_0037514 | 3300047322 | Bacteria | 3881 |
| 516 | Ga0495680_0045562 | 3300047322 | Bacteria | 3462 |
| 517 | Ga0495675_0097220 | 3300047444 | Bacteria | 1845 |
| 518 | Ga0495679_033584 | 3300047446 | Bacteria | 1638 |
| 519 | Ga0495684_0014086 | 3300047471 | Bacteria | 6151 |
| 520 | Ga0495684_0028838 | 3300047471 | Bacteria | 4261 |
| 521 | Ga0495684_0043156 | 3300047471 | Bacteria | 3452 |
| 522 | Ga0495684_0154365 | 3300047471 | Bacteria | 1715 |
| 523 | Ga0495593_0000440 | 3300047673 | Bacteria | 23230 |
| 524 | Ga0495593_0039074 | 3300047673 | Bacteria | 2561 |
| 525 | Ga0495602_0026925 | 3300048088 | Bacteria | 5537 |
| 526 | Ga0495602_0077527 | 3300048088 | Bacteria | 2811 |
| 527 | Ga0495602_0292973 | 3300048088 | Bacteria | 1194 |
| 528 | Ga0495614_0002534 | 3300048089 | Bacteria | 8119 |
| 529 | Ga0495614_0032077 | 3300048089 | Bacteria | 2261 |
| 530 | Ga0496101_0014092 | 3300048904 | Bacteria | 5370 |
| 531 | Ga0496101_0024371 | 3300048904 | Bacteria | 4187 |
| 532 | Ga0496101_0070701 | 3300048904 | Bacteria | 2556 |
| 533 | Ga0496101_0224564 | 3300048904 | Bacteria | 1458 |
| 534 | Ga0496102_0036246 | 3300048905 | Bacteria | 4443 |
| 535 | Ga0496102_0083206 | 3300048905 | Bacteria | 2953 |
| 536 | Ga0496102_0205274 | 3300048905 | Bacteria | 1858 |
| 537 | Ga0496103_0336741 | 3300048906 | Bacteria | 970 |
| 538 | Ga0496104_0007409 | 3300048907 | Bacteria | 9695 |
| 539 | Ga0496104_0027315 | 3300048907 | Bacteria | 5281 |
| 540 | Ga0496104_0081598 | 3300048907 | Bacteria | 3084 |
| 541 | Ga0496104_0088514 | 3300048907 | Bacteria | 2958 |
| 542 | Ga0496105_0006640 | 3300048908 | Bacteria | 8906 |
| 543 | Ga0496105_0006934 | 3300048908 | Bacteria | 8725 |
| 544 | Ga0496105_0019785 | 3300048908 | Bacteria | 5432 |
| 545 | Ga0496105_0158681 | 3300048908 | Bacteria | 1857 |
| 546 | Ga0496106_0010226 | 3300048909 | Bacteria | 6935 |
| 547 | Ga0496106_0011970 | 3300048909 | Bacteria | 6403 |
| 548 | Ga0496106_0043931 | 3300048909 | Bacteria | 3354 |
| 549 | Ga0496106_0244966 | 3300048909 | Bacteria | 1432 |
| 550 | Ga0496107_0002153 | 3300048910 | Bacteria | 12650 |
| 551 | Ga0496107_0008025 | 3300048910 | Bacteria | 7288 |
| 552 | Ga0496107_0131203 | 3300048910 | Bacteria | 1850 |
| 553 | Ga0496108_0011999 | 3300048911 | Bacteria | 7050 |
| 554 | Ga0496109_0135115 | 3300048912 | Bacteria | 2304 |
| 555 | Ga0496109_0183940 | 3300048912 | Unclassified | 1963 |
| 556 | Ga0496110_0014342 | 3300048913 | Bacteria | 6576 |
| 557 | Ga0496110_0018539 | 3300048913 | Bacteria | 5836 |
| 558 | Ga0496110_0045677 | 3300048913 | Bacteria | 3830 |
| 559 | Ga0496111_0009438 | 3300048914 | Bacteria | 6512 |
| 560 | Ga0496111_0044345 | 3300048914 | Bacteria | 3197 |
| 561 | Ga0496111_0153292 | 3300048914 | Bacteria | 1710 |
| 562 | Ga0496112_0013497 | 3300048915 | Bacteria | 7545 |
| 563 | Ga0496112_0095006 | 3300048915 | Bacteria | 2952 |
| 564 | Ga0496112_0144500 | 3300048915 | Bacteria | 2347 |
| 565 | Ga0496112_0212742 | 3300048915 | Bacteria | 1890 |
| 566 | Ga0496113_0491176 | 3300048916 | Bacteria | 986 |
| 567 | Ga0496114_0014192 | 3300048917 | Bacteria | 6391 |
| 568 | Ga0496114_0021457 | 3300048917 | Bacteria | 5257 |
| 569 | Ga0496114_0036020 | 3300048917 | Bacteria | 4089 |
| 570 | Ga0496114_0038988 | 3300048917 | Bacteria | 3932 |
| 571 | Ga0496114_0152148 | 3300048917 | Bacteria | 2007 |
| 572 | Ga0496115_0001532 | 3300048918 | Bacteria | 16585 |
| 573 | Ga0496115_0014019 | 3300048918 | Bacteria | 6067 |
| 574 | Ga0496115_0039715 | 3300048918 | Bacteria | 3738 |
| 575 | Ga0496115_0048042 | 3300048918 | Bacteria | 3413 |
| 576 | Ga0496115_0116268 | 3300048918 | Unclassified | 2200 |
| 577 | Ga0496115_0505550 | 3300048918 | Bacteria | 971 |
| 578 | Ga0501031_0000335 | 3300049568 | Bacteria | 27232 |
| 579 | Ga0501031_0100056 | 3300049568 | Bacteria | 1892 |
| 580 | Ga0501031_0120302 | 3300049568 | Bacteria | 1715 |
| 581 | Ga0501032_0000618 | 3300049569 | Bacteria | 28827 |
| 582 | Ga0501033_0000542 | 3300049570 | Bacteria | 35034 |
| 583 | Ga0501034_0014073 | 3300049571 | Bacteria | 8242 |
| 584 | Ga0501034_0041313 | 3300049571 | Bacteria | 4666 |
| 585 | Ga0501036_0007246 | 3300049572 | Bacteria | 9031 |
| 586 | Ga0501036_0072632 | 3300049572 | Bacteria | 2908 |
| 587 | Ga0501036_0149298 | 3300049572 | Bacteria | 1971 |
| 588 | Ga0501037_0001374 | 3300049573 | Bacteria | 17840 |
| 589 | Ga0501037_0013620 | 3300049573 | Bacteria | 5990 |
| 590 | Ga0501037_0392988 | 3300049573 | Bacteria | 952 |
| 591 | Ga0501038_0032152 | 3300049574 | Bacteria | 4630 |
| 592 | Ga0501039_0004107 | 3300049575 | Bacteria | 10960 |
| 593 | Ga0501040_0000758 | 3300049576 | Bacteria | 20022 |
| 594 | Ga0501040_0001041 | 3300049576 | Bacteria | 17542 |
| 595 | Ga0501040_0014563 | 3300049576 | Bacteria | 5185 |
| 596 | Ga0501040_0127111 | 3300049576 | Bacteria | 1791 |
| 597 | Ga0501041_0000503 | 3300049577 | Bacteria | 20099 |
| 598 | Ga0501041_0013083 | 3300049577 | Bacteria | 4917 |
| 599 | Ga0501041_0080792 | 3300049577 | Bacteria | 2001 |
| 600 | Ga0501042_0019548 | 3300049578 | Bacteria | 4705 |
| 601 | Ga0501042_0020233 | 3300049578 | Bacteria | 4630 |
| 602 | Ga0501043_0030842 | 3300049579 | Bacteria | 4215 |
| 603 | Ga0501043_0198589 | 3300049579 | Unclassified | 1558 |
| 604 | Ga0501046_0005878 | 3300049580 | Bacteria | 10935 |
| 605 | Ga0501046_0111014 | 3300049580 | Bacteria | 2094 |
| 606 | Ga0501046_0124035 | 3300049580 | Bacteria | 1963 |
| 607 | Ga0501047_0009196 | 3300049581 | Bacteria | 9328 |
| 608 | Ga0501047_0279482 | 3300049581 | Bacteria | 1514 |
| 609 | Ga0501047_0406814 | 3300049581 | Bacteria | 1193 |
| 610 | Ga0501048_0002721 | 3300049582 | Bacteria | 13487 |
| 611 | Ga0501048_0036864 | 3300049582 | Bacteria | 3513 |
| 612 | Ga0501067_0000386 | 3300049583 | Bacteria | 23987 |
| 613 | Ga0501067_0006875 | 3300049583 | Bacteria | 6310 |
| 614 | Ga0501067_0040068 | 3300049583 | Bacteria | 2602 |
| 615 | Ga0501067_0124121 | 3300049583 | Bacteria | 1437 |
| 616 | Ga0501067_0133837 | 3300049583 | Unclassified | 1380 |
| 617 | Ga0501068_0000640 | 3300049584 | Bacteria | 17868 |
| 618 | Ga0501068_0006989 | 3300049584 | Bacteria | 6243 |
| 619 | Ga0501068_0038749 | 3300049584 | Bacteria | 2856 |
| 620 | Ga0501068_0049580 | 3300049584 | Bacteria | 2536 |
| 621 | Ga0501068_0133074 | 3300049584 | Bacteria | 1556 |
| 622 | Ga0501069_0000218 | 3300049585 | Bacteria | 25595 |
| 623 | Ga0501069_0000488 | 3300049585 | Bacteria | 18095 |
| 624 | Ga0501069_0001705 | 3300049585 | Bacteria | 10928 |
| 625 | Ga0501070_0004939 | 3300049586 | Bacteria | 11380 |
| 626 | Ga0501070_0033214 | 3300049586 | Bacteria | 4317 |
| 627 | Ga0501070_0069699 | 3300049586 | Bacteria | 2911 |
| 628 | Ga0501070_0157854 | 3300049586 | Bacteria | 1870 |
| 629 | Ga0501070_0162693 | 3300049586 | Bacteria | 1840 |
| 630 | Ga0501071_0019297 | 3300049587 | Bacteria | 4731 |
| 631 | Ga0501071_0032131 | 3300049587 | Bacteria | 3725 |
| 632 | Ga0501071_0058820 | 3300049587 | Bacteria | 2779 |
| 633 | Ga0501071_0083896 | 3300049587 | Bacteria | 2334 |
| 634 | Ga0501071_0104098 | 3300049587 | Bacteria | 2094 |
| 635 | Ga0501071_0124444 | 3300049587 | Bacteria | 1913 |
| 636 | Ga0501072_0002729 | 3300049588 | Bacteria | 13253 |
| 637 | Ga0501072_0006126 | 3300049588 | Bacteria | 9173 |
| 638 | Ga0501072_0038840 | 3300049588 | Bacteria | 3736 |
| 639 | Ga0501072_0207637 | 3300049588 | Bacteria | 1561 |
| 640 | Ga0501072_0287060 | 3300049588 | Bacteria | 1308 |
| 641 | Ga0501073_0000709 | 3300049589 | Bacteria | 23548 |
| 642 | Ga0501073_0020416 | 3300049589 | Bacteria | 4778 |
| 643 | Ga0501073_0022563 | 3300049589 | Bacteria | 4531 |
| 644 | Ga0501074_0000853 | 3300049590 | Bacteria | 19386 |
| 645 | Ga0501074_0016209 | 3300049590 | Bacteria | 5413 |
| 646 | Ga0501074_0056442 | 3300049590 | Bacteria | 2830 |
| 647 | Ga0501074_0086091 | 3300049590 | Bacteria | 2251 |
| 648 | Ga0501074_0117463 | 3300049590 | Bacteria | 1903 |
| 649 | Ga0501074_0325325 | 3300049590 | Bacteria | 1092 |
| 650 | Ga0501075_0002836 | 3300049591 | Bacteria | 11621 |
| 651 | Ga0501075_0005127 | 3300049591 | Bacteria | 8957 |
| 652 | Ga0501075_0037076 | 3300049591 | Bacteria | 3641 |
| 653 | Ga0501075_0038822 | 3300049591 | Bacteria | 3560 |
| 654 | Ga0501075_0434779 | 3300049591 | Bacteria | 1001 |
| 655 | Ga0501076_0001525 | 3300049592 | Bacteria | 15519 |
| 656 | Ga0501076_0026020 | 3300049592 | Bacteria | 4528 |
| 657 | Ga0501076_0215336 | 3300049592 | Bacteria | 1570 |
| 658 | Ga0501077_0002103 | 3300049593 | Bacteria | 12004 |
| 659 | Ga0501077_0005718 | 3300049593 | Bacteria | 7570 |
| 660 | Ga0501077_0013512 | 3300049593 | Bacteria | 5120 |
| 661 | Ga0501077_0074979 | 3300049593 | Bacteria | 2142 |
| 662 | Ga0501077_0107371 | 3300049593 | Bacteria | 1769 |
| 663 | Ga0501079_0005920 | 3300049741 | Bacteria | 9162 |
| 664 | Ga0501079_0006056 | 3300049741 | Bacteria | 9064 |
| 665 | Ga0501080_0002094 | 3300049742 | Bacteria | 17315 |
| 666 | Ga0501080_0021337 | 3300049742 | Bacteria | 5995 |
| 667 | Ga0501080_0077511 | 3300049742 | Bacteria | 3091 |
| 668 | Ga0501080_0092696 | 3300049742 | Bacteria | 2805 |
| 669 | Ga0501080_0154737 | 3300049742 | Bacteria | 2118 |
| 670 | Ga0501081_0017744 | 3300049743 | Bacteria | 4716 |
| 671 | Ga0501081_0018741 | 3300049743 | Bacteria | 4597 |
| 672 | Ga0501081_0128605 | 3300049743 | Bacteria | 1808 |
| 673 | Ga0501081_0203639 | 3300049743 | Bacteria | 1436 |
| 674 | Ga0501083_0000599 | 3300049744 | Bacteria | 23173 |
| 675 | Ga0501083_0138160 | 3300049744 | Bacteria | 1596 |
| 676 | Ga0501035_0010818 | 3300049822 | Bacteria | 8448 |
| 677 | Ga0501035_0030086 | 3300049822 | Bacteria | 4951 |
| 678 | Ga0501035_0078247 | 3300049822 | Bacteria | 2922 |
| 679 | Ga0501035_0115310 | 3300049822 | Bacteria | 2351 |
| 680 | Ga0501044_0022645 | 3300049823 | Bacteria | 6691 |
| 681 | Ga0501044_0220563 | 3300049823 | Bacteria | 1847 |
| 682 | Ga0501044_0368360 | 3300049823 | Bacteria | 1354 |
| 683 | Ga0501045_0000562 | 3300049824 | Bacteria | 23326 |
| 684 | Ga0501045_0186067 | 3300049824 | Unclassified | 1547 |
| 685 | Ga0501045_0204766 | 3300049824 | Bacteria | 1470 |
| 686 | nmdc:mga05p37_12539_c1 | 3300050507 | Bacteria | 10121 |
| 687 | nmdc:mga05p37_401517_c1 | 3300050507 | Bacteria | 1600 |
| 688 | nmdc:mga09592_5866_c1 | 3300050508 | Bacteria | 10023 |
| 689 | nmdc:mga0qj67_129545_c1 | 3300050509 | Bacteria | 2043 |
| 690 | nmdc:mga0qj67_81483_c1 | 3300050509 | Bacteria | 2595 |
| 691 | nmdc:mga06r32_215352_c1 | 3300050510 | Bacteria | 1908 |
| 692 | nmdc:mga08y16_345326_c1 | 3300050511 | Bacteria | 1529 |
| 693 | nmdc:mga0n895_111674_c1 | 3300050512 | Bacteria | 2750 |
| 694 | nmdc:mga0n895_14170_c1 | 3300050512 | Bacteria | 7230 |
| 695 | nmdc:mga0rr50_40206_c1 | 3300050513 | Bacteria | 3399 |
| 696 | Ga0495601_0014262 | 3300053077 | Bacteria | 4787 |
| 697 | Ga0495601_0022152 | 3300053077 | Bacteria | 3899 |
| 698 | Ga0495601_0073904 | 3300053077 | Bacteria | 2180 |
| 699 | Ga0495601_0100678 | 3300053077 | Bacteria | 1866 |
| 700 | Ga0495601_0365717 | 3300053077 | Bacteria | 937 |
| 701 | Ga0495601_0399366 | 3300053077 | Bacteria | 891 |
| 702 | Ga0495612_0053676 | 3300053078 | Bacteria | 1659 |
| 703 | Ga0495655_0057009 | 3300053083 | Unclassified | 1053 |
| 704 | Ga0495595_0016912 | 3300053084 | Bacteria | 3128 |
| 705 | Ga0495595_0035231 | 3300053084 | Bacteria | 2267 |
| 706 | Ga0495595_0050064 | 3300053084 | Bacteria | 1934 |
| 707 | Ga0495619_0003134 | 3300053085 | Bacteria | 10722 |
| 708 | Ga0495619_0008408 | 3300053085 | Bacteria | 6528 |
| 709 | Ga0495619_0048145 | 3300053085 | Bacteria | 2809 |
| 710 | Ga0495619_0096300 | 3300053085 | Bacteria | 2009 |
| 711 | Ga0495619_0181197 | 3300053085 | Bacteria | 1457 |
| 712 | Ga0500566_0074789 | 3300053094 | Bacteria | 1896 |
| 713 | Ga0501084_0001256 | 3300054114 | Bacteria | 19957 |
| 714 | Ga0501084_0005567 | 3300054114 | Bacteria | 10340 |
| 715 | Ga0501084_0037145 | 3300054114 | Bacteria | 4069 |
| 716 | Ga0501084_0234628 | 3300054114 | Bacteria | 1549 |
| 717 | Ga0590075_045323 | 3300059424 | Unclassified | 1126 |
| 718 | Ga0501082_0030718 | 3300060353 | Bacteria | 4630 |
| 719 | Ga0501082_0034896 | 3300060353 | Bacteria | 4335 |
| 720 | Ga0501082_0083898 | 3300060353 | Bacteria | 2748 |
| 721 | Ga0501082_0404688 | 3300060353 | Bacteria | 1191 |
| 722 | Ga0466962_0002439 | 3300061719 | Bacteria | 8813 |
| 723 | Ga0466962_0002534 | 3300061719 | Bacteria | 8678 |
| 724 | Ga0466962_0007231 | 3300061719 | Bacteria | 5319 |
| 725 | Ga0466962_0017272 | 3300061719 | Bacteria | 3476 |
| 726 | Ga0530510_0005431 | 3300061734 | Bacteria | 8819 |
| 727 | Ga0530510_0050453 | 3300061734 | Bacteria | 3006 |
| 728 | Ga0530510_0124645 | 3300061734 | Bacteria | 1893 |
| 729 | Ga0530510_0327122 | 3300061734 | Bacteria | 1149 |
| 730 | Ga0081455_10006226 | |||
| 731 | JGI25407J50210_10005902 | |||
| 732 | JGI25407J50210_10053713 | |||
| 733 | JGI25407J50210_10056905 | |||
| 734 | Ga0070658_10034810 | |||
| 735 | Ga0070658_10124607 | |||
| 736 | Ga0070658_10410511 | |||
| 737 | Ga0070683_100016823 | |||
| 738 | Ga0070683_100044654 | |||
| 739 | Ga0070683_100091904 | |||
| 740 | Ga0070683_100226245 | |||
| 741 | Ga0070680_100012860 | |||
| 742 | Ga0070680_100041925 | |||
| 743 | Ga0070680_100073056 | |||
| 744 | Ga0070680_100248010 | |||
| 745 | Ga0070682_100321681 | |||
| 746 | Ga0070660_100005006 | |||
| 747 | Ga0070660_100012974 | |||
| 748 | Ga0070660_100059187 | |||
| 749 | Ga0070660_100063175 | |||
| 750 | Ga0070660_100291890 | |||
| 751 | Ga0070661_100022800 | |||
| 752 | Ga0070671_100039747 | |||
| 753 | Ga0070671_100235863 | |||
| 754 | Ga0070659_100006234 | |||
| 755 | Ga0070659_100099419 | |||
| 756 | Ga0070709_10230710 | |||
| 757 | Ga0070709_10336035 | |||
| 758 | Ga0070714_100023746 | |||
| 759 | Ga0070714_100083604 | |||
| 760 | Ga0070714_100367419 | |||
| 761 | Ga0070714_100851771 | |||
| 762 | Ga0070713_100047202 | |||
| 763 | Ga0070713_100362014 | |||
| 764 | Ga0070711_100025569 | |||
| 765 | Ga0070694_100016269 | |||
| 766 | Ga0070708_100001830 | |||
| 767 | Ga0070663_100053722 | |||
| 768 | Ga0070678_100230125 | |||
| 769 | Ga0070662_100190380 | |||
| 770 | Ga0070681_10003807 | |||
| 771 | Ga0070681_10014174 | |||
| 772 | Ga0070681_10081371 | |||
| 773 | Ga0070681_10113464 | |||
| 774 | Ga0070681_10285511 | |||
| 775 | Ga0068867_100102929 | |||
| 776 | Ga0070707_100267612 | |||
| 777 | Ga0070698_100093850 | |||
| 778 | Ga0070679_100033402 | |||
| 779 | Ga0070679_100057441 | |||
| 780 | Ga0070679_100068650 | |||
| 781 | Ga0070679_100295952 | |||
| 782 | Ga0070684_100026109 | |||
| 783 | Ga0070684_100055328 | |||
| 784 | Ga0070684_100073756 | |||
| 785 | Ga0070684_100108875 | |||
| 786 | Ga0068853_100332617 | |||
| 787 | Ga0070695_100000363 | |||
| 788 | Ga0070665_100014812 | |||
| 789 | Ga0068855_100019656 | |||
| 790 | Ga0068855_100030292 | |||
| 791 | Ga0068855_100071652 | |||
| 792 | Ga0068855_100073087 | |||
| 793 | Ga0068855_100130956 | |||
| 794 | Ga0068855_100159773 | |||
| 795 | Ga0068855_100184069 | |||
| 796 | Ga0068855_100229603 | |||
| 797 | Ga0068855_100342657 | |||
| 798 | Ga0068855_100600840 | |||
| 799 | Ga0068857_100054962 | |||
| 800 | Ga0068857_100099263 | |||
| 801 | Ga0068856_100028282 | |||
| 802 | Ga0068856_100263649 | |||
| 803 | Ga0068856_100427890 | |||
| 804 | Ga0068852_100028464 | |||
| 805 | Ga0068852_100275707 | |||
| 806 | Ga0068861_100026725 | |||
| 807 | Ga0081538_10000422 | |||
| 808 | Ga0081538_10001675 | |||
| 809 | Ga0081538_10006022 | |||
| 810 | Ga0081538_10007727 | |||
| 811 | Ga0081538_10014034 | |||
| 812 | Ga0081538_10014948 | |||
| 813 | Ga0081538_10019672 | |||
| 814 | Ga0081538_10036896 | |||
| 815 | Ga0081538_10083039 | |||
| 816 | Ga0081538_10112506 | |||
| 817 | Ga0081539_10030272 | |||
| 818 | Ga0070715_10040843 | |||
| 819 | Ga0070716_100330121 | |||
| 820 | Ga0070712_100040232 | |||
| 821 | Ga0070712_100303119 | |||
| 822 | Ga0075428_100009740 | |||
| 823 | Ga0075430_100029414 | |||
| 824 | Ga0075430_100290084 | |||
| 825 | Ga0075433_10130273 | |||
| 826 | Ga0075433_10184140 | |||
| 827 | Ga0075434_100026949 | |||
| 828 | Ga0075434_100041074 | |||
| 829 | Ga0075429_100002297 | |||
| 830 | Ga0075435_100030491 | |||
| 831 | Ga0075435_100036259 | |||
| 832 | Ga0075435_100459600 | |||
| 833 | Ga0105240_10090173 | |||
| 834 | Ga0105240_10123419 | |||
| 835 | Ga0105240_10131750 | |||
| 836 | Ga0105240_10303356 | |||
| 837 | Ga0105240_10553031 | |||
| 838 | Ga0105245_10009806 | |||
| 839 | Ga0105245_10952122 | |||
| 840 | Ga0114129_10025201 | |||
| 841 | Ga0114129_10132686 | |||
| 842 | Ga0114129_10448436 | |||
| 843 | Ga0105243_10307113 | |||
| 844 | Ga0105248_10055191 | |||
| 845 | Ga0105237_10019269 | |||
| 846 | Ga0105237_10034687 | |||
| 847 | Ga0105249_10003773 | |||
| 848 | Ga0105239_10142751 | |||
| 849 | Ga0157371_10453006 | |||
| 850 | Ga0157370_10019774 | |||
| 851 | Ga0157370_10026504 | |||
| 852 | Ga0157370_10035304 | |||
| 853 | Ga0157370_10046160 | |||
| 854 | Ga0157370_10099117 | |||
| 855 | Ga0157370_10112184 | |||
| 856 | Ga0157369_10001698 | |||
| 857 | Ga0157369_10007440 | |||
| 858 | Ga0157369_10008364 | |||
| 859 | Ga0157369_10016138 | |||
| 860 | Ga0157369_10022141 | |||
| 861 | Ga0157369_10112806 | |||
| 862 | Ga0157369_10298148 | |||
| 863 | Ga0157369_10775942 | |||
| 864 | Ga0157374_10014229 | |||
| 865 | Ga0157374_10283589 | |||
| 866 | Ga0163162_10087531 | |||
| 867 | Ga0157372_10134907 | |||
| 868 | Ga0157372_10144880 | |||
| 869 | Ga0157372_10189655 | |||
| 870 | Ga0157376_10021202 | |||
| 871 | Ga0163161_10067961 | |||
| 872 | Ga0206356_10185080 | |||
| 873 | Ga0206354_11243756 | |||
| 874 | Ga0206354_11249356 | |||
| 875 | Ga0206353_10111715 | |||
| 876 | Ga0206353_10157841 | |||
| 877 | Ga0206353_10612681 | |||
| 878 | Ga0206353_10848156 | |||
| 879 | Ga0206353_11917284 | |||
| 880 | Ga0207692_10088088 | |||
| 881 | Ga0207685_10021829 | |||
| 882 | Ga0207705_10005302 | |||
| 883 | Ga0207705_10051193 | |||
| 884 | Ga0207705_10243173 | |||
| 885 | Ga0207707_10011640 | |||
| 886 | Ga0207707_10025091 | |||
| 887 | Ga0207707_10106801 | |||
| 888 | Ga0207707_10557395 | |||
| 889 | Ga0207695_10095748 | |||
| 890 | Ga0207695_10096999 | |||
| 891 | Ga0207695_10122044 | |||
| 892 | Ga0207671_10031828 | |||
| 893 | Ga0207693_10014330 | |||
| 894 | Ga0207693_10285205 | |||
| 895 | Ga0207663_10012840 | |||
| 896 | Ga0207663_10236219 | |||
| 897 | Ga0207660_10124530 | |||
| 898 | Ga0207660_10135627 | |||
| 899 | Ga0207660_10440181 | |||
| 900 | Ga0207657_10000073 | |||
| 901 | Ga0207657_10010590 | |||
| 902 | Ga0207657_10010720 | |||
| 903 | Ga0207657_10015733 | |||
| 904 | Ga0207657_10016460 | |||
| 905 | Ga0207657_10169975 | |||
| 906 | Ga0207657_10217177 | |||
| 907 | Ga0207657_10267170 | |||
| 908 | Ga0207649_10087909 | |||
| 909 | Ga0207652_10006996 | |||
| 910 | Ga0207652_10014110 | |||
| 911 | Ga0207652_10043580 | |||
| 912 | Ga0207652_10066846 | |||
| 913 | Ga0207652_10125639 | |||
| 914 | Ga0207652_10155830 | |||
| 915 | Ga0207652_10301939 | |||
| 916 | Ga0207646_10522375 | |||
| 917 | Ga0207687_10030929 | |||
| 918 | Ga0207700_10346287 | |||
| 919 | Ga0207664_10050732 | |||
| 920 | Ga0207664_10212151 | |||
| 921 | Ga0207644_10024759 | |||
| 922 | Ga0207644_10066089 | |||
| 923 | Ga0207690_10090339 | |||
| 924 | Ga0207690_10126148 | |||
| 925 | Ga0207709_10298445 | |||
| 926 | Ga0207665_10101995 | |||
| 927 | Ga0207665_10447890 | |||
| 928 | Ga0207711_10037463 | |||
| 929 | Ga0207661_10051814 | |||
| 930 | Ga0207661_10133412 | |||
| 931 | Ga0207661_10178672 | |||
| 932 | Ga0207661_10187210 | |||
| 933 | Ga0207661_10258791 | |||
| 934 | Ga0207667_10059057 | |||
| 935 | Ga0207667_10092544 | |||
| 936 | Ga0207667_10255067 | |||
| 937 | Ga0207667_10269579 | |||
| 938 | Ga0207667_10341448 | |||
| 939 | Ga0207668_10035770 | |||
| 940 | Ga0207678_10111461 | |||
| 941 | Ga0207678_10171981 | |||
| 942 | Ga0207702_10106132 | |||
| 943 | Ga0207674_10018144 | |||
| 944 | Ga0207674_10018333 | |||
| 945 | Ga0207675_100010255 | |||
| 946 | Ga0207698_10029502 | |||
| 947 | Ga0268266_10328542 | |||
| 948 | Ga0265334_10042567 | |||
| 949 | Ga0265322_10015994 | |||
| 950 | Ga0265338_10006961 | |||
| 951 | Ga0265338_10009734 | |||
| 952 | Ga0265338_10017960 | |||
| 953 | Ga0265338_10052017 | |||
| 954 | Ga0265330_10049513 | |||
| 955 | Ga0265332_10053381 | |||
| 956 | Ga0265329_10024609 | |||
| 957 | Ga0265340_10046471 | |||
| 958 | Ga0265340_10084745 | |||
| 959 | Ga0265339_10032722 | |||
| 960 | Ga0265331_10026530 | |||
| 961 | Ga0265327_10075855 | |||
| 962 | Ga0265316_10031076 | |||
| 963 | Ga0265313_10005968 | |||
| 964 | Ga0265313_10013854 | |||
| 965 | Ga0265314_10004242 | |||
| 966 | Ga0265314_10061767 | |||
| 967 | Ga0307416_100001175 | |||
| 968 | Ga0307416_100208088 | |||
| 969 | Ga0307411_10194302 | |||
| 970 | Ga0373926_0037279 | |||
| 971 | Ga0373926_0047112 | |||
| 972 | Ga0373936_0201590 | |||
| 973 | Ga0373945_0081499 | |||
| 974 | Ga0373943_0000966 | |||
| 975 | Ga0373943_0002489 | |||
| 976 | Ga0373946_0001677 | |||
| 977 | Ga0373946_0006830 | |||
| 978 | Ga0373955_0062400 | |||
| 979 | Ga0373935_0054731 | |||
| 980 | Ga0373927_0069903 | |||
| 981 | Ga0373933_0048104 | |||
| 982 | Ga0373933_0212166 | |||
| 983 | Ga0373947_0003172 | |||
| 984 | Ga0373947_0013716 | |||
| 985 | Ga0373947_0085098 | |||
| 986 | Ga0373937_0106697 | |||
| 987 | Ga0373925_0003039 | |||
| 988 | Ga0373925_0003069 | |||
| 989 | Ga0373925_0045015 | |||
| 990 | Ga0373925_0046324 | |||
| 991 | Ga0395899_0005600 | |||
| 992 | Ga0395899_0008184 | |||
| 993 | Ga0395899_0018953 | |||
| 994 | Ga0395899_0202562 | |||
| 995 | Ga0395899_0255097 | |||
| 996 | Ga0395900_0024282 | |||
| 997 | Ga0395900_0053817 | |||
| 998 | Ga0395900_0066345 | |||
| 999 | Ga0395900_0068803 | |||
| 1000 | Ga0395900_0711476 | |||
| 1001 | Ga0395898_0005945 | |||
| 1002 | Ga0395898_0017263 | |||
| 1003 | Ga0395898_0024048 | |||
| 1004 | Ga0395898_0034147 | |||
| 1005 | Ga0395898_0036588 | |||
| 1006 | Ga0395898_0043991 | |||
| 1007 | Ga0395898_0056155 | |||
| 1008 | Ga0395898_0109580 | |||
| 1009 | Ga0395898_0110163 | |||
| 1010 | Ga0395898_0154040 | |||
| 1011 | Ga0395898_0174641 | |||
| 1012 | Ga0395898_0295888 | |||
| 1013 | Ga0395898_0307813 | |||
| 1014 | Ga0395898_0552035 | |||
| 1015 | Ga0395898_0573064 | |||
| 1016 | Ga0395905_0014380 | |||
| 1017 | Ga0395905_0026654 | |||
| 1018 | Ga0395905_0041194 | |||
| 1019 | Ga0395905_0056928 | |||
| 1020 | Ga0395905_0162872 | |||
| 1021 | Ga0395905_0187114 | |||
| 1022 | Ga0395905_0219814 | |||
| 1023 | Ga0395901_0005220 | |||
| 1024 | Ga0395901_0005275 | |||
| 1025 | Ga0395901_0006754 | |||
| 1026 | Ga0395901_0024891 | |||
| 1027 | Ga0395901_0029426 | |||
| 1028 | Ga0395901_0037137 | |||
| 1029 | Ga0395901_0048751 | |||
| 1030 | Ga0395901_0051850 | |||
| 1031 | Ga0395901_0088596 | |||
| 1032 | Ga0395901_0097615 | |||
| 1033 | Ga0395901_0235105 | |||
| 1034 | Ga0395901_0249891 | |||
| 1035 | Ga0395901_0346299 | |||
| 1036 | Ga0395901_0592839 | |||
| 1037 | Ga0436363_1428459 | |||
| 1038 | Ga0466969_0025421 | |||
| 1039 | Ga0466969_0170813 | |||
| 1040 | Ga0466972_0022919 | |||
| 1041 | Ga0466972_0081011 | |||
| 1042 | Ga0466965_0043907 | |||
| 1043 | Ga0466965_0044369 | |||
| 1044 | Ga0466966_0023608 | |||
| 1045 | Ga0466966_0035285 | |||
| 1046 | Ga0466961_0002101 | |||
| 1047 | Ga0466961_0033677 | |||
| 1048 | Ga0466963_0001185 | |||
| 1049 | Ga0466963_0004849 | |||
| 1050 | Ga0466963_0010507 | |||
| 1051 | Ga0466963_0035695 | |||
| 1052 | Ga0466963_0042576 | |||
| 1053 | Ga0466963_0043814 | |||
| 1054 | Ga0466963_0050080 | |||
| 1055 | Ga0466963_0110937 | |||
| 1056 | Ga0466963_0120260 | |||
| 1057 | Ga0466963_0160044 | |||
| 1058 | Ga0466963_0274073 | |||
| 1059 | Ga0466963_0340883 | |||
| 1060 | Ga0466964_0004052 | |||
| 1061 | Ga0466964_0016147 | |||
| 1062 | Ga0466964_0019747 | |||
| 1063 | Ga0466964_0021696 | |||
| 1064 | Ga0466964_0022222 | |||
| 1065 | Ga0466964_0023337 | |||
| 1066 | Ga0466964_0031058 | |||
| 1067 | Ga0466971_0001723 | |||
| 1068 | Ga0466971_0003499 | |||
| 1069 | Ga0466971_0016779 | |||
| 1070 | Ga0466971_0021582 | |||
| 1071 | Ga0466971_0066059 | |||
| 1072 | Ga0466968_0026460 | |||
| 1073 | Ga0466970_0052543 | |||
| 1074 | Ga0466970_0120385 | |||
| 1075 | Ga0466957_0006882 | |||
| 1076 | Ga0466957_0022489 | |||
| 1077 | Ga0466957_0033404 | |||
| 1078 | Ga0466957_0063724 | |||
| 1079 | Ga0466957_0094230 | |||
| 1080 | Ga0466957_0299980 | |||
| 1081 | Ga0466957_0456537 | |||
| 1082 | Ga0466960_0014414 | |||
| 1083 | Ga0466960_0053235 | |||
| 1084 | Ga0466959_0010640 | |||
| 1085 | Ga0466959_0017968 | |||
| 1086 | Ga0466959_0019604 | |||
| 1087 | Ga0466959_0020216 | |||
| 1088 | Ga0466959_0020559 | |||
| 1089 | Ga0466959_0140308 | |||
| 1090 | Ga0466959_0216741 | |||
| 1091 | Ga0466959_0289857 | |||
| 1092 | Ga0466958_0000907 | |||
| 1093 | Ga0466958_0003727 | |||
| 1094 | Ga0466958_0045620 | |||
| 1095 | Ga0466958_0055448 | |||
| 1096 | Ga0466958_0076592 | |||
| 1097 | Ga0466958_0104318 | |||
| 1098 | Ga0466958_0122288 | |||
| 1099 | Ga0466958_0207522 | |||
| 1100 | Ga0466958_0265700 | |||
| 1101 | Ga0466967_0002594 | |||
| 1102 | Ga0466967_0003450 | |||
| 1103 | Ga0466967_0005793 | |||
| 1104 | Ga0466967_0006378 | |||
| 1105 | Ga0466967_0013745 | |||
| 1106 | Ga0466967_0014667 | |||
| 1107 | Ga0466967_0014982 | |||
| 1108 | Ga0466967_0027979 | |||
| 1109 | Ga0466967_0051199 | |||
| 1110 | Ga0466967_0060994 | |||
| 1111 | Ga0466967_0082130 | |||
| 1112 | Ga0466967_0083765 | |||
| 1113 | Ga0466967_0103941 | |||
| 1114 | Ga0466967_0138716 | |||
| 1115 | Ga0466967_0149895 | |||
| 1116 | Ga0466967_0169476 | |||
| 1117 | Ga0466967_0241284 | |||
| 1118 | Ga0466967_0248550 | |||
| 1119 | Ga0466967_0313141 | |||
| 1120 | Ga0466967_0366104 | |||
| 1121 | Ga0495592_0004301 | |||
| 1122 | Ga0495592_0058302 | |||
| 1123 | Ga0495592_0084790 | |||
| 1124 | Ga0495592_0132050 | |||
| 1125 | Ga0495603_0026451 | |||
| 1126 | Ga0495603_0047464 | |||
| 1127 | Ga0495629_0000349 | |||
| 1128 | Ga0495629_0021069 | |||
| 1129 | Ga0495629_0142323 | |||
| 1130 | Ga0495641_0000494 | |||
| 1131 | Ga0495641_0004048 | |||
| 1132 | Ga0495641_0035070 | |||
| 1133 | Ga0495651_0056790 | |||
| 1134 | Ga0495651_0072909 | |||
| 1135 | Ga0495651_0089901 | |||
| 1136 | Ga0495651_0225973 | |||
| 1137 | Ga0495651_0275279 | |||
| 1138 | Ga0495653_0003625 | |||
| 1139 | Ga0495653_0031880 | |||
| 1140 | Ga0495653_0072984 | |||
| 1141 | Ga0495653_0085368 | |||
| 1142 | Ga0495653_0097829 | |||
| 1143 | Ga0495580_0203470 | |||
| 1144 | Ga0495582_0004719 | |||
| 1145 | Ga0495605_0112792 | |||
| 1146 | Ga0495639_0000386 | |||
| 1147 | Ga0495639_0004618 | |||
| 1148 | Ga0495662_0000205 | |||
| 1149 | Ga0495662_0000943 | |||
| 1150 | Ga0495662_0060272 | |||
| 1151 | Ga0495662_0132262 | |||
| 1152 | Ga0495585_0087799 | |||
| 1153 | Ga0495607_0028837 | |||
| 1154 | Ga0495608_0009205 | |||
| 1155 | Ga0495608_0049889 | |||
| 1156 | Ga0495608_0071856 | |||
| 1157 | Ga0495618_0012134 | |||
| 1158 | Ga0495618_0017488 | |||
| 1159 | Ga0495628_0009377 | |||
| 1160 | Ga0495628_0011556 | |||
| 1161 | Ga0495630_0011615 | |||
| 1162 | Ga0495630_0016892 | |||
| 1163 | Ga0495630_0022376 | |||
| 1164 | Ga0495630_0042674 | |||
| 1165 | Ga0495630_0042844 | |||
| 1166 | Ga0495630_0093917 | |||
| 1167 | Ga0495663_0036520 | |||
| 1168 | Ga0495666_0000241 | |||
| 1169 | Ga0495666_0055663 | |||
| 1170 | Ga0495652_0009902 | |||
| 1171 | Ga0495652_0115326 | |||
| 1172 | Ga0495652_0171163 | |||
| 1173 | Ga0495652_0186166 | |||
| 1174 | Ga0495665_0000739 | |||
| 1175 | Ga0495665_0001708 | |||
| 1176 | Ga0495665_0186750 | |||
| 1177 | Ga0495640_0013233 | |||
| 1178 | Ga0495640_0055929 | |||
| 1179 | Ga0495640_0061391 | |||
| 1180 | Ga0495640_0263778 | |||
| 1181 | Ga0495640_0278491 | |||
| 1182 | Ga0495586_0173936 | |||
| 1183 | Ga0495587_0044904 | |||
| 1184 | Ga0495587_0164439 | |||
| 1185 | Ga0495645_0045918 | |||
| 1186 | Ga0495645_0099848 | |||
| 1187 | Ga0495645_0179068 | |||
| 1188 | Ga0495667_0019097 | |||
| 1189 | Ga0495667_0021551 | |||
| 1190 | Ga0495667_0046978 | |||
| 1191 | Ga0495667_0143691 | |||
| 1192 | Ga0495656_0008016 | |||
| 1193 | Ga0495634_0007732 | |||
| 1194 | Ga0495634_0029774 | |||
| 1195 | Ga0495634_0082043 | |||
| 1196 | Ga0495611_0068859 | |||
| 1197 | Ga0495635_0005865 | |||
| 1198 | Ga0495635_0073794 | |||
| 1199 | Ga0495635_0119252 | |||
| 1200 | Ga0495635_0125474 | |||
| 1201 | Ga0495635_0246302 | |||
| 1202 | Ga0495635_0249661 | |||
| 1203 | Ga0495588_0233226 | |||
| 1204 | Ga0495657_0009030 | |||
| 1205 | Ga0495657_0053354 | |||
| 1206 | Ga0495657_0086442 | |||
| 1207 | Ga0495657_0211263 | |||
| 1208 | Ga0495657_0393566 | |||
| 1209 | Ga0495599_0001915 | |||
| 1210 | Ga0495599_0017772 | |||
| 1211 | Ga0495599_0042291 | |||
| 1212 | Ga0495599_0069593 | |||
| 1213 | Ga0495646_0030954 | |||
| 1214 | Ga0495646_0160342 | |||
| 1215 | Ga0495646_0166094 | |||
| 1216 | Ga0495647_0000459 | |||
| 1217 | Ga0495647_0007052 | |||
| 1218 | Ga0495658_0001095 | |||
| 1219 | Ga0495658_0008072 | |||
| 1220 | Ga0495658_0117402 | |||
| 1221 | Ga0495658_0263397 | |||
| 1222 | Ga0495613_0001699 | |||
| 1223 | Ga0495613_0027945 | |||
| 1224 | Ga0495613_0153353 | |||
| 1225 | Ga0495624_0005284 | |||
| 1226 | Ga0495624_0188865 | |||
| 1227 | Ga0495600_0005713 | |||
| 1228 | Ga0495581_0001329 | |||
| 1229 | Ga0495581_0005659 | |||
| 1230 | Ga0495604_0112412 | |||
| 1231 | Ga0495674_0002551 | |||
| 1232 | Ga0495674_0019005 | |||
| 1233 | Ga0495674_0021561 | |||
| 1234 | Ga0495674_0140253 | |||
| 1235 | Ga0495674_0157406 | |||
| 1236 | Ga0495676_0000940 | |||
| 1237 | Ga0495676_0033863 | |||
| 1238 | Ga0495676_0073667 | |||
| 1239 | Ga0495676_0126034 | |||
| 1240 | Ga0495680_0000259 | |||
| 1241 | Ga0495680_0002170 | |||
| 1242 | Ga0495680_0011371 | |||
| 1243 | Ga0495680_0024798 | |||
| 1244 | Ga0495680_0037514 | |||
| 1245 | Ga0495680_0045562 | |||
| 1246 | Ga0495675_0097220 | |||
| 1247 | Ga0495679_033584 | |||
| 1248 | Ga0495684_0014086 | |||
| 1249 | Ga0495684_0028838 | |||
| 1250 | Ga0495684_0043156 | |||
| 1251 | Ga0495684_0154365 | |||
| 1252 | Ga0495593_0000440 | |||
| 1253 | Ga0495593_0039074 | |||
| 1254 | Ga0495602_0026925 | |||
| 1255 | Ga0495602_0077527 | |||
| 1256 | Ga0495602_0292973 | |||
| 1257 | Ga0495614_0002534 | |||
| 1258 | Ga0495614_0032077 | |||
| 1259 | Ga0496101_0014092 | |||
| 1260 | Ga0496101_0024371 | |||
| 1261 | Ga0496101_0070701 | |||
| 1262 | Ga0496101_0224564 | |||
| 1263 | Ga0496102_0036246 | |||
| 1264 | Ga0496102_0083206 | |||
| 1265 | Ga0496102_0205274 | |||
| 1266 | Ga0496103_0336741 | |||
| 1267 | Ga0496104_0007409 | |||
| 1268 | Ga0496104_0027315 | |||
| 1269 | Ga0496104_0081598 | |||
| 1270 | Ga0496104_0088514 | |||
| 1271 | Ga0496105_0006640 | |||
| 1272 | Ga0496105_0006934 | |||
| 1273 | Ga0496105_0019785 | |||
| 1274 | Ga0496105_0158681 | |||
| 1275 | Ga0496106_0010226 | |||
| 1276 | Ga0496106_0011970 | |||
| 1277 | Ga0496106_0043931 | |||
| 1278 | Ga0496106_0244966 | |||
| 1279 | Ga0496107_0002153 | |||
| 1280 | Ga0496107_0008025 | |||
| 1281 | Ga0496107_0131203 | |||
| 1282 | Ga0496108_0011999 | |||
| 1283 | Ga0496109_0135115 | |||
| 1284 | Ga0496109_0183940 | |||
| 1285 | Ga0496110_0014342 | |||
| 1286 | Ga0496110_0018539 | |||
| 1287 | Ga0496110_0045677 | |||
| 1288 | Ga0496111_0009438 | |||
| 1289 | Ga0496111_0044345 | |||
| 1290 | Ga0496111_0153292 | |||
| 1291 | Ga0496112_0013497 | |||
| 1292 | Ga0496112_0095006 | |||
| 1293 | Ga0496112_0144500 | |||
| 1294 | Ga0496112_0212742 | |||
| 1295 | Ga0496113_0491176 | |||
| 1296 | Ga0496114_0014192 | |||
| 1297 | Ga0496114_0021457 | |||
| 1298 | Ga0496114_0036020 | |||
| 1299 | Ga0496114_0038988 | |||
| 1300 | Ga0496114_0152148 | |||
| 1301 | Ga0496115_0001532 | |||
| 1302 | Ga0496115_0014019 | |||
| 1303 | Ga0496115_0039715 | |||
| 1304 | Ga0496115_0048042 | |||
| 1305 | Ga0496115_0116268 | |||
| 1306 | Ga0496115_0505550 | |||
| 1307 | Ga0501031_0000335 | |||
| 1308 | Ga0501031_0100056 | |||
| 1309 | Ga0501031_0120302 | |||
| 1310 | Ga0501032_0000618 | |||
| 1311 | Ga0501033_0000542 | |||
| 1312 | Ga0501034_0014073 | |||
| 1313 | Ga0501034_0041313 | |||
| 1314 | Ga0501036_0007246 | |||
| 1315 | Ga0501036_0072632 | |||
| 1316 | Ga0501036_0149298 | |||
| 1317 | Ga0501037_0001374 | |||
| 1318 | Ga0501037_0013620 | |||
| 1319 | Ga0501037_0392988 | |||
| 1320 | Ga0501038_0032152 | |||
| 1321 | Ga0501039_0004107 | |||
| 1322 | Ga0501040_0000758 | |||
| 1323 | Ga0501040_0001041 | |||
| 1324 | Ga0501040_0014563 | |||
| 1325 | Ga0501040_0127111 | |||
| 1326 | Ga0501041_0000503 | |||
| 1327 | Ga0501041_0013083 | |||
| 1328 | Ga0501041_0080792 | |||
| 1329 | Ga0501042_0019548 | |||
| 1330 | Ga0501042_0020233 | |||
| 1331 | Ga0501043_0030842 | |||
| 1332 | Ga0501043_0198589 | |||
| 1333 | Ga0501046_0005878 | |||
| 1334 | Ga0501046_0111014 | |||
| 1335 | Ga0501046_0124035 | |||
| 1336 | Ga0501047_0009196 | |||
| 1337 | Ga0501047_0279482 | |||
| 1338 | Ga0501047_0406814 | |||
| 1339 | Ga0501048_0002721 | |||
| 1340 | Ga0501048_0036864 | |||
| 1341 | Ga0501067_0000386 | |||
| 1342 | Ga0501067_0006875 | |||
| 1343 | Ga0501067_0040068 | |||
| 1344 | Ga0501067_0124121 | |||
| 1345 | Ga0501067_0133837 | |||
| 1346 | Ga0501068_0000640 | |||
| 1347 | Ga0501068_0006989 | |||
| 1348 | Ga0501068_0038749 | |||
| 1349 | Ga0501068_0049580 | |||
| 1350 | Ga0501068_0133074 | |||
| 1351 | Ga0501069_0000218 | |||
| 1352 | Ga0501069_0000488 | |||
| 1353 | Ga0501069_0001705 | |||
| 1354 | Ga0501070_0004939 | |||
| 1355 | Ga0501070_0033214 | |||
| 1356 | Ga0501070_0069699 | |||
| 1357 | Ga0501070_0157854 | |||
| 1358 | Ga0501070_0162693 | |||
| 1359 | Ga0501071_0019297 | |||
| 1360 | Ga0501071_0032131 | |||
| 1361 | Ga0501071_0058820 | |||
| 1362 | Ga0501071_0083896 | |||
| 1363 | Ga0501071_0104098 | |||
| 1364 | Ga0501071_0124444 | |||
| 1365 | Ga0501072_0002729 | |||
| 1366 | Ga0501072_0006126 | |||
| 1367 | Ga0501072_0038840 | |||
| 1368 | Ga0501072_0207637 | |||
| 1369 | Ga0501072_0287060 | |||
| 1370 | Ga0501073_0000709 | |||
| 1371 | Ga0501073_0020416 | |||
| 1372 | Ga0501073_0022563 | |||
| 1373 | Ga0501074_0000853 | |||
| 1374 | Ga0501074_0016209 | |||
| 1375 | Ga0501074_0056442 | |||
| 1376 | Ga0501074_0086091 | |||
| 1377 | Ga0501074_0117463 | |||
| 1378 | Ga0501074_0325325 | |||
| 1379 | Ga0501075_0002836 | |||
| 1380 | Ga0501075_0005127 | |||
| 1381 | Ga0501075_0037076 | |||
| 1382 | Ga0501075_0038822 | |||
| 1383 | Ga0501075_0434779 | |||
| 1384 | Ga0501076_0001525 | |||
| 1385 | Ga0501076_0026020 | |||
| 1386 | Ga0501076_0215336 | |||
| 1387 | Ga0501077_0002103 | |||
| 1388 | Ga0501077_0005718 | |||
| 1389 | Ga0501077_0013512 | |||
| 1390 | Ga0501077_0074979 | |||
| 1391 | Ga0501077_0107371 | |||
| 1392 | Ga0501079_0005920 | |||
| 1393 | Ga0501079_0006056 | |||
| 1394 | Ga0501080_0002094 | |||
| 1395 | Ga0501080_0021337 | |||
| 1396 | Ga0501080_0077511 | |||
| 1397 | Ga0501080_0092696 | |||
| 1398 | Ga0501080_0154737 | |||
| 1399 | Ga0501081_0017744 | |||
| 1400 | Ga0501081_0018741 | |||
| 1401 | Ga0501081_0128605 | |||
| 1402 | Ga0501081_0203639 | |||
| 1403 | Ga0501083_0000599 | |||
| 1404 | Ga0501083_0138160 | |||
| 1405 | Ga0501035_0010818 | |||
| 1406 | Ga0501035_0030086 | |||
| 1407 | Ga0501035_0078247 | |||
| 1408 | Ga0501035_0115310 | |||
| 1409 | Ga0501044_0022645 | |||
| 1410 | Ga0501044_0220563 | |||
| 1411 | Ga0501044_0368360 | |||
| 1412 | Ga0501045_0000562 | |||
| 1413 | Ga0501045_0186067 | |||
| 1414 | Ga0501045_0204766 | |||
| 1415 | nmdc:mga05p37_12539_c1 | |||
| 1416 | nmdc:mga05p37_401517_c1 | |||
| 1417 | nmdc:mga09592_5866_c1 | |||
| 1418 | nmdc:mga0qj67_129545_c1 | |||
| 1419 | nmdc:mga0qj67_81483_c1 | |||
| 1420 | nmdc:mga06r32_215352_c1 | |||
| 1421 | nmdc:mga08y16_345326_c1 | |||
| 1422 | nmdc:mga0n895_111674_c1 | |||
| 1423 | nmdc:mga0n895_14170_c1 | |||
| 1424 | nmdc:mga0rr50_40206_c1 | |||
| 1425 | Ga0495601_0014262 | |||
| 1426 | Ga0495601_0022152 | |||
| 1427 | Ga0495601_0073904 | |||
| 1428 | Ga0495601_0100678 | |||
| 1429 | Ga0495601_0365717 | |||
| 1430 | Ga0495601_0399366 | |||
| 1431 | Ga0495612_0053676 | |||
| 1432 | Ga0495655_0057009 | |||
| 1433 | Ga0495595_0016912 | |||
| 1434 | Ga0495595_0035231 | |||
| 1435 | Ga0495595_0050064 | |||
| 1436 | Ga0495619_0003134 | |||
| 1437 | Ga0495619_0008408 | |||
| 1438 | Ga0495619_0048145 | |||
| 1439 | Ga0495619_0096300 | |||
| 1440 | Ga0495619_0181197 | |||
| 1441 | Ga0500566_0074789 | |||
| 1442 | Ga0501084_0001256 | |||
| 1443 | Ga0501084_0005567 | |||
| 1444 | Ga0501084_0037145 | |||
| 1445 | Ga0501084_0234628 | |||
| 1446 | Ga0590075_045323 | |||
| 1447 | Ga0501082_0030718 | |||
| 1448 | Ga0501082_0034896 | |||
| 1449 | Ga0501082_0083898 | |||
| 1450 | Ga0501082_0404688 | |||
| 1451 | Ga0466962_0002439 | |||
| 1452 | Ga0466962_0002534 | |||
| 1453 | Ga0466962_0007231 | |||
| 1454 | Ga0466962_0017272 | |||
| 1455 | Ga0530510_0005431 | |||
| 1456 | Ga0530510_0050453 | |||
| 1457 | Ga0530510_0124645 | |||
| 1458 | Ga0530510_0327122 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zdd-assembly1.cif.gz_A-2 | structure of e. coli exoix in complex with the palindromic 5ov6 oligonucleotide and potassium | 0.8598 | 1 | 249 |
| 6c33-assembly1.cif.gz_A | mycobacterium smegmatis dna flap endonuclease | 0.8573 | 1 | 273 |
| 6c36-assembly1.cif.gz_A | mycobacterium smegmatis flap endonuclease mutant d208n | 0.8571 | 1 | 273 |
| 3zdc-assembly1.cif.gz_A | structure of e. coli exoix in complex with the palindromic 5ov4 dna oligonucleotide, potassium and calcium | 0.8541 | 1 | 249 |
| 6c35-assembly1.cif.gz_A | mycobacterium smegmatis flap endonuclease mutant d148n | 0.8538 | 1 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P00582_2_172_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9198 | 2 | 172 | 3.40.50.1010 |
| af_A8MQG8_313_403_1.10.150.20 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain | 0.9166 | 177 | 241 | 1.10.150.20 |
| af_P9WNU5_7_186_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9154 | 1 | 171 | 3.40.50.1010 |
| af_Q2FXN9_1_169_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9073 | 1 | 169 | 3.40.50.1010 |
| af_Q2FXN9_1_169_3.40.50.1010 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.8973 | 1 | 169 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537NAG0-F1-model_v4 | 5'-3' exonuclease domain-containing protein | 0.9688 | 2 | 174 |
GO:0003677
GO:0008409 GO:0017108 GO:0033567 |
| AF-A0A7W1BQ95-F1-model_v4 | 5'-3' exonuclease domain-containing protein | 0.9616 | 1 | 275 |
GO:0003677
GO:0008409 GO:0017108 GO:0033567 |
| AF-A0A537TLQ8-F1-model_v4 | 5'-3' exonuclease | 0.9614 | 2 | 276 |
GO:0003677
GO:0008409 GO:0017108 GO:0033567 |
| AF-A0A537TLQ8-F1-model_v4 | 5'-3' exonuclease | 0.9547 | 2 | 276 |
GO:0003677
GO:0008409 GO:0017108 GO:0033567 |
| AF-A0A7Y5XXC8-F1-model_v4 | DNA polymerase I | 0.954 | 2 | 230 |
GO:0003677
GO:0008409 GO:0017108 GO:0033567 |