F477818

General Info

Members Datasets Scaffolds Average Seq Length
728 270 1456 367

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0011049|Ga0466958_0011049_1082_2314
Length 410
Sequence MPPGTARLLAVRQLGSPRMQVGLKIWRFNSRTGERELQEYEIDAPEEATLLDCLDIVKDRHDGTLAYRKSCRMMICGSCGMRMDGAAVLACKTRMYDVAQAGHVPVISAMGNLPIVKDLVVDMKPFWEKFESVDPYLQPGYEEPPLGREHLIDQPRMNVIHKEALCINCGCCVSECNAMEADPLFTGPQALAKAFRFVGDPRDGNKIARLEKLNGEHGIWECTRCYFCNERCPKGVDPRDAIAKLGAESMKEGIDRDMGAKHAKWFVKSAETTGWLRETELVPKTQGIVSAIKQTRFALDLARHGKVPPPFPPHVAKDVVEARRLRDLVNAQGRDGYRGIVQGERALARLAHGHTGEESLADIYDRPGAFHRPFIAEEQYTGGANEGMGSRTQADATPGEAPTKKPGGGA

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
139 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
140 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
141 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
144 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
145 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
146 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
147 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
191 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
192 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
196 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 1.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 8.79
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0011049 3300045836 Bacteria 5076
2 JGI25407J50210_10018035 3300003373 Bacteria 1834
3 Ga0070658_10007689 3300005327 Bacteria 8687
4 Ga0070658_10013409 3300005327 Bacteria 6576
5 Ga0070658_10042251 3300005327 Bacteria 3681
6 Ga0070658_10080437 3300005327 Bacteria 2676
7 Ga0070658_10207738 3300005327 Bacteria 1653
8 Ga0070683_100006231 3300005329 Bacteria 10005
9 Ga0070680_100002965 3300005336 Bacteria 12617
10 Ga0070680_100052761 3300005336 Bacteria 3318
11 Ga0070680_100082986 3300005336 Bacteria 2646
12 Ga0070682_100016550 3300005337 Bacteria 4289
13 Ga0070660_100001406 3300005339 Bacteria 16411
14 Ga0070660_100007008 3300005339 Bacteria 7824
15 Ga0070660_100009642 3300005339 Bacteria 6802
16 Ga0070660_100027063 3300005339 Bacteria 4277
17 Ga0070660_100039348 3300005339 Bacteria 3593
18 Ga0070660_100313841 3300005339 Bacteria 1287
19 Ga0070661_100005203 3300005344 Bacteria 8959
20 Ga0070661_100084952 3300005344 Bacteria 2338
21 Ga0070671_100360681 3300005355 Bacteria 1241
22 Ga0070667_100184539 3300005367 Bacteria 1846
23 Ga0070709_10034067 3300005434 Bacteria 3085
24 Ga0070714_100008279 3300005435 Bacteria 8108
25 Ga0070714_100030493 3300005435 Bacteria 4489
26 Ga0070713_100030257 3300005436 Bacteria 4298
27 Ga0070713_100077580 3300005436 Bacteria 2825
28 Ga0070710_10139696 3300005437 Bacteria 1484
29 Ga0070711_100128960 3300005439 Bacteria 1881
30 Ga0070700_100199087 3300005441 Bacteria 1406
31 Ga0070708_100268755 3300005445 Bacteria 1604
32 Ga0070678_100123885 3300005456 Bacteria 2042
33 Ga0070681_10004535 3300005458 Bacteria 13259
34 Ga0070681_10007722 3300005458 Bacteria 10513
35 Ga0070681_10049708 3300005458 Bacteria 4186
36 Ga0070681_10072047 3300005458 Bacteria 3419
37 Ga0070681_10119255 3300005458 Bacteria 2574
38 Ga0070681_10151071 3300005458 Bacteria 2249
39 Ga0070706_100075099 3300005467 Bacteria 3128
40 Ga0070707_100127307 3300005468 Bacteria 2475
41 Ga0070707_100136216 3300005468 Bacteria 2389
42 Ga0070707_100245467 3300005468 Bacteria 1742
43 Ga0070698_100068103 3300005471 Bacteria 3578
44 Ga0070698_100154850 3300005471 Bacteria 2238
45 Ga0070698_100251549 3300005471 Bacteria 1700
46 Ga0070698_100285514 3300005471 Bacteria 1581
47 Ga0070679_100002527 3300005530 Bacteria 16579
48 Ga0070679_100049305 3300005530 Bacteria 4193
49 Ga0070679_100050852 3300005530 Bacteria 4128
50 Ga0070679_100083069 3300005530 Bacteria 3192
51 Ga0070679_100088755 3300005530 Bacteria 3078
52 Ga0070679_100119300 3300005530 Bacteria 2623
53 Ga0070684_100001220 3300005535 Bacteria 18471
54 Ga0070684_100052240 3300005535 Bacteria 3554
55 Ga0070684_100177347 3300005535 Bacteria 1937
56 Ga0070672_100184256 3300005543 Bacteria 1741
57 Ga0070695_100000523 3300005545 Bacteria 20235
58 Ga0070704_100238959 3300005549 Bacteria 1486
59 Ga0068855_100006830 3300005563 Bacteria 13844
60 Ga0068855_100008162 3300005563 Bacteria 12657
61 Ga0068855_100096520 3300005563 Bacteria 3405
62 Ga0068855_100199760 3300005563 Bacteria 2251
63 Ga0068855_100227387 3300005563 Bacteria 2090
64 Ga0068857_100120340 3300005577 Bacteria 2363
65 Ga0068857_100379300 3300005577 Bacteria 1313
66 Ga0068856_100213124 3300005614 Bacteria 1947
67 Ga0081455_10009231 3300005937 Bacteria 10164
68 Ga0081455_10035388 3300005937 Bacteria 4463
69 Ga0081455_10077751 3300005937 Bacteria 2728
70 Ga0081538_10001387 3300005981 Bacteria 24845
71 Ga0081538_10002772 3300005981 Bacteria 16794
72 Ga0081538_10021267 3300005981 Bacteria 4742
73 Ga0081540_1025693 3300005983 Bacteria 3382
74 Ga0081539_10000363 3300005985 Bacteria 99391
75 Ga0081539_10004020 3300005985 Bacteria 16903
76 Ga0081539_10034906 3300005985 Bacteria 3032
77 Ga0070717_10013843 3300006028 Bacteria 6194
78 Ga0070717_10014834 3300006028 Bacteria 5995
79 Ga0070717_10021296 3300006028 Bacteria 5106
80 Ga0070717_10022330 3300006028 Bacteria 4998
81 Ga0070717_10040148 3300006028 Bacteria 3811
82 Ga0070717_10227893 3300006028 Bacteria 1640
83 Ga0075365_10001885 3300006038 Bacteria 9873
84 Ga0070715_10015217 3300006163 Bacteria 2864
85 Ga0070716_100018341 3300006173 Bacteria 3644
86 Ga0070712_100007705 3300006175 Bacteria 6735
87 Ga0070712_100320253 3300006175 Bacteria 1261
88 Ga0075431_100264568 3300006847 Bacteria 1744
89 Ga0075431_100391268 3300006847 Bacteria 1392
90 Ga0075433_10106529 3300006852 Bacteria 2485
91 Ga0075434_100045954 3300006871 Bacteria 4333
92 Ga0075435_100056779 3300007076 Bacteria 3165
93 Ga0075435_100116197 3300007076 Bacteria 2229
94 Ga0105240_10047915 3300009093 Bacteria 5405
95 Ga0105240_10071608 3300009093 Bacteria 4286
96 Ga0105240_10174177 3300009093 Bacteria 2545
97 Ga0111539_10231466 3300009094 Bacteria 2152
98 Ga0111539_10272509 3300009094 Bacteria 1970
99 Ga0111539_10499941 3300009094 Bacteria 1416
100 Ga0114129_10003327 3300009147 Bacteria 22585
101 Ga0114129_10125486 3300009147 Bacteria 3530
102 Ga0114129_10813930 3300009147 Bacteria 1191
103 Ga0105242_10118680 3300009176 Bacteria 2266
104 Ga0105248_10097248 3300009177 Bacteria 3317
105 Ga0105237_10015062 3300009545 Bacteria 8058
106 Ga0105238_10344305 3300009551 Bacteria 1479
107 Ga0157370_10017228 3300013104 Bacteria 7291
108 Ga0157370_10026911 3300013104 Bacteria 5673
109 Ga0157370_10035895 3300013104 Bacteria 4814
110 Ga0157370_10078696 3300013104 Bacteria 3105
111 Ga0157370_10101032 3300013104 Bacteria 2701
112 Ga0157369_10016730 3300013105 Bacteria 8242
113 Ga0157369_10022561 3300013105 Bacteria 7021
114 Ga0157369_10027914 3300013105 Bacteria 6251
115 Ga0157369_10032906 3300013105 Bacteria 5698
116 Ga0157369_10033935 3300013105 Bacteria 5604
117 Ga0157369_10056062 3300013105 Bacteria 4252
118 Ga0157374_10093193 3300013296 Bacteria 2875
119 Ga0157374_10325773 3300013296 Bacteria 1523
120 Ga0157372_10015478 3300013307 Bacteria 8176
121 Ga0157375_10042331 3300013308 Bacteria 4408
122 Ga0182008_10003086 3300014497 Bacteria 10224
123 Ga0157379_10142190 3300014968 Bacteria 2163
124 Ga0182006_1008684 3300015261 Bacteria 4598
125 Ga0197907_10553097 3300020069 Bacteria 3026
126 Ga0197907_10959694 3300020069 Bacteria 1561
127 Ga0206356_10339530 3300020070 Bacteria 2630
128 Ga0206356_10731890 3300020070 Bacteria 2298
129 Ga0206356_10833043 3300020070 Bacteria 2515
130 Ga0206354_10694068 3300020081 Bacteria 2386
131 Ga0206354_11254550 3300020081 Bacteria 4385
132 Ga0206353_10332968 3300020082 Bacteria 5024
133 Ga0206353_10594941 3300020082 Bacteria 3357
134 Ga0206353_11926521 3300020082 Bacteria 3853
135 Ga0213871_10028995 3300021441 Bacteria 1432
136 Ga0224712_10023780 3300022467 Bacteria 2131
137 Ga0207699_10181356 3300025906 Bacteria 1416
138 Ga0207699_10188883 3300025906 Bacteria 1389
139 Ga0207705_10010429 3300025909 Bacteria 6754
140 Ga0207705_10011584 3300025909 Bacteria 6375
141 Ga0207705_10055179 3300025909 Bacteria 2864
142 Ga0207705_10059091 3300025909 Bacteria 2766
143 Ga0207705_10127433 3300025909 Bacteria 1892
144 Ga0207705_10230544 3300025909 Bacteria 1408
145 Ga0207684_10046425 3300025910 Bacteria 3685
146 Ga0207707_10020828 3300025912 Bacteria 5728
147 Ga0207707_10031096 3300025912 Bacteria 4670
148 Ga0207707_10036735 3300025912 Bacteria 4282
149 Ga0207707_10051691 3300025912 Bacteria 3579
150 Ga0207707_10129501 3300025912 Bacteria 2207
151 Ga0207695_10018456 3300025913 Bacteria 8069
152 Ga0207695_10288440 3300025913 Bacteria 1534
153 Ga0207693_10003301 3300025915 Bacteria 13810
154 Ga0207693_10020537 3300025915 Bacteria 5252
155 Ga0207693_10228461 3300025915 Bacteria 1461
156 Ga0207663_10038991 3300025916 Bacteria 2875
157 Ga0207660_10005633 3300025917 Bacteria 8131
158 Ga0207657_10000397 3300025919 Bacteria 46007
159 Ga0207657_10012919 3300025919 Bacteria 8210
160 Ga0207657_10020516 3300025919 Bacteria 6242
161 Ga0207657_10049893 3300025919 Bacteria 3644
162 Ga0207657_10057049 3300025919 Bacteria 3367
163 Ga0207657_10185384 3300025919 Bacteria 1681
164 Ga0207649_10010018 3300025920 Bacteria 5198
165 Ga0207649_10044164 3300025920 Bacteria 2728
166 Ga0207649_10101071 3300025920 Bacteria 1908
167 Ga0207652_10016307 3300025921 Bacteria 6063
168 Ga0207652_10100066 3300025921 Bacteria 2559
169 Ga0207652_10105562 3300025921 Bacteria 2493
170 Ga0207646_10000149 3300025922 Bacteria 95761
171 Ga0207646_10074675 3300025922 Bacteria 3028
172 Ga0207646_10126983 3300025922 Bacteria 2294
173 Ga0207694_10011242 3300025924 Bacteria 6760
174 Ga0207694_10041047 3300025924 Bacteria 3565
175 Ga0207694_10310124 3300025924 Bacteria 1301
176 Ga0207687_10045549 3300025927 Bacteria 3032
177 Ga0207700_10000004 3300025928 Bacteria 443409
178 Ga0207700_10131998 3300025928 Bacteria 2040
179 Ga0207664_10003350 3300025929 Bacteria 10650
180 Ga0207664_10046369 3300025929 Bacteria 3411
181 Ga0207664_10063835 3300025929 Bacteria 2944
182 Ga0207690_10110439 3300025932 Bacteria 1979
183 Ga0207686_10093958 3300025934 Bacteria 1987
184 Ga0207665_10005604 3300025939 Bacteria 8369
185 Ga0207691_10143036 3300025940 Bacteria 2106
186 Ga0207661_10008939 3300025944 Bacteria 7175
187 Ga0207661_10009294 3300025944 Bacteria 7045
188 Ga0207661_10045618 3300025944 Bacteria 3471
189 Ga0207661_10272261 3300025944 Bacteria 1511
190 Ga0207667_10011350 3300025949 Bacteria 10360
191 Ga0207667_10015984 3300025949 Bacteria 8499
192 Ga0207667_10118531 3300025949 Bacteria 2728
193 Ga0207658_10062336 3300025986 Bacteria 2790
194 Ga0207678_10262314 3300026067 Bacteria 1481
195 Ga0207708_10310556 3300026075 Bacteria 1284
196 Ga0207674_10063065 3300026116 Bacteria 3742
197 Ga0207674_10394601 3300026116 Bacteria 1337
198 Ga0207683_10233261 3300026121 Bacteria 1678
199 Ga0207698_10044833 3300026142 Bacteria 3326
200 Ga0268266_10262087 3300028379 Bacteria 1602
201 Ga0265337_1025549 3300028556 Bacteria 1798
202 Ga0265319_1000431 3300028563 Bacteria 30124
203 Ga0265319_1023407 3300028563 Bacteria 2239
204 Ga0265334_10005458 3300028573 Bacteria 5555
205 Ga0265334_10010540 3300028573 Bacteria 3902
206 Ga0265334_10019919 3300028573 Bacteria 2753
207 Ga0265334_10033378 3300028573 Bacteria 2049
208 Ga0265318_10001185 3300028577 Bacteria 16028
209 Ga0265318_10002390 3300028577 Bacteria 10047
210 Ga0265323_10006962 3300028653 Bacteria 4728
211 Ga0265323_10031565 3300028653 Bacteria 1969
212 Ga0265322_10001626 3300028654 Bacteria 7177
213 Ga0265322_10006716 3300028654 Bacteria 3380
214 Ga0265338_10002622 3300028800 Bacteria 26550
215 Ga0265338_10007766 3300028800 Bacteria 13196
216 Ga0265338_10009902 3300028800 Bacteria 11275
217 Ga0265338_10016969 3300028800 Bacteria 7878
218 Ga0265338_10024447 3300028800 Bacteria 6170
219 Ga0265338_10032702 3300028800 Bacteria 5064
220 Ga0265338_10144910 3300028800 Bacteria 1854
221 Ga0265324_10016115 3300029957 Bacteria 2736
222 Ga0265324_10045962 3300029957 Bacteria 1503
223 Ga0265330_10000883 3300031235 Bacteria 18661
224 Ga0265332_10059673 3300031238 Bacteria 1632
225 Ga0265328_10002844 3300031239 Bacteria 7726
226 Ga0265328_10043214 3300031239 Bacteria 1658
227 Ga0265320_10033179 3300031240 Bacteria 2637
228 Ga0265320_10056266 3300031240 Bacteria 1890
229 Ga0265325_10004991 3300031241 Bacteria 8268
230 Ga0265329_10023454 3300031242 Bacteria 2055
231 Ga0265339_10017629 3300031249 Bacteria 4224
232 Ga0265339_10036750 3300031249 Bacteria 2738
233 Ga0265339_10053262 3300031249 Bacteria 2201
234 Ga0265331_10010004 3300031250 Bacteria 5274
235 Ga0265331_10020900 3300031250 Bacteria 3355
236 Ga0265327_10006964 3300031251 Bacteria 8873
237 Ga0265327_10029296 3300031251 Bacteria 3133
238 Ga0265316_10011096 3300031344 Bacteria 8160
239 Ga0265316_10011765 3300031344 Bacteria 7871
240 Ga0265316_10040833 3300031344 Bacteria 3717
241 Ga0265313_10007900 3300031595 Bacteria 7160
242 Ga0265313_10020198 3300031595 Bacteria 3680
243 Ga0265313_10023831 3300031595 Bacteria 3287
244 Ga0265313_10056813 3300031595 Bacteria 1849
245 Ga0265314_10005549 3300031711 Bacteria 11347
246 Ga0265314_10012186 3300031711 Bacteria 7041
247 Ga0265314_10013264 3300031711 Bacteria 6668
248 Ga0265314_10019953 3300031711 Bacteria 5182
249 Ga0265314_10162396 3300031711 Bacteria 1358
250 Ga0265342_10025478 3300031712 Bacteria 3716
251 Ga0265342_10027315 3300031712 Bacteria 3568
252 Ga0307405_10012074 3300031731 Bacteria 4557
253 Ga0307406_10141511 3300031901 Bacteria 1703
254 Ga0307416_100115114 3300032002 Bacteria 2380
255 Ga0307414_10100235 3300032004 Bacteria 2178
256 Ga0307411_10126551 3300032005 Bacteria 1859
257 Ga0307415_100118963 3300032126 Bacteria 1976
258 Ga0373944_0013612 3300035089 Bacteria 2260
259 Ga0373945_0011842 3300035116 Bacteria 2889
260 Ga0373956_0053987 3300035119 Bacteria 1810
261 Ga0373943_0051076 3300035170 Bacteria 2034
262 Ga0373946_0086542 3300035171 Bacteria 1381
263 Ga0373955_0065460 3300035172 Bacteria 2018
264 Ga0373935_0050969 3300035692 Bacteria 2628
265 Ga0373933_0041737 3300035724 Bacteria 2709
266 Ga0373947_0001423 3300035725 Bacteria 14714
267 Ga0373937_0001607 3300036401 Bacteria 18982
268 Ga0373937_0031621 3300036401 Bacteria 4797
269 Ga0373925_0000937 3300037068 Bacteria 26571
270 Ga0373925_0026889 3300037068 Bacteria 4212
271 Ga0373925_0215341 3300037068 Bacteria 1531
272 Ga0373925_0368818 3300037068 Bacteria 1168
273 Ga0395899_0003146 3300037312 Bacteria 13111
274 Ga0395899_0008109 3300037312 Bacteria 8091
275 Ga0395899_0023971 3300037312 Bacteria 4617
276 Ga0395899_0032725 3300037312 Bacteria 3907
277 Ga0395899_0035879 3300037312 Bacteria 3721
278 Ga0395899_0058748 3300037312 Bacteria 2836
279 Ga0395899_0058896 3300037312 Bacteria 2832
280 Ga0395899_0090536 3300037312 Bacteria 2218
281 Ga0395899_0093795 3300037312 Bacteria 2172
282 Ga0395900_0001650 3300037418 Bacteria 26129
283 Ga0395900_0011838 3300037418 Bacteria 8919
284 Ga0395900_0013401 3300037418 Bacteria 8377
285 Ga0395900_0014506 3300037418 Bacteria 8041
286 Ga0395900_0014600 3300037418 Bacteria 8014
287 Ga0395900_0017415 3300037418 Bacteria 7333
288 Ga0395900_0023124 3300037418 Bacteria 6360
289 Ga0395900_0028224 3300037418 Bacteria 5748
290 Ga0395900_0028823 3300037418 Bacteria 5691
291 Ga0395900_0035682 3300037418 Bacteria 5122
292 Ga0395900_0043702 3300037418 Bacteria 4618
293 Ga0395900_0055941 3300037418 Bacteria 4061
294 Ga0395900_0080057 3300037418 Bacteria 3357
295 Ga0395900_0123003 3300037418 Bacteria 2661
296 Ga0395900_0198691 3300037418 Bacteria 2030
297 Ga0395900_0288524 3300037418 Bacteria 1630
298 Ga0395898_0003199 3300037466 Bacteria 18440
299 Ga0395898_0003920 3300037466 Bacteria 16425
300 Ga0395898_0004513 3300037466 Bacteria 15211
301 Ga0395898_0017628 3300037466 Bacteria 7290
302 Ga0395898_0033886 3300037466 Bacteria 5093
303 Ga0395898_0038341 3300037466 Bacteria 4750
304 Ga0395898_0063672 3300037466 Bacteria 3578
305 Ga0395898_0101394 3300037466 Bacteria 2764
306 Ga0395898_0105135 3300037466 Bacteria 2707
307 Ga0395898_0211022 3300037466 Bacteria 1852
308 Ga0395905_0005878 3300037471 Bacteria 12452
309 Ga0395905_0015302 3300037471 Bacteria 7293
310 Ga0395905_0018302 3300037471 Bacteria 6650
311 Ga0395905_0024516 3300037471 Bacteria 5693
312 Ga0395905_0025607 3300037471 Bacteria 5563
313 Ga0395905_0040690 3300037471 Bacteria 4360
314 Ga0395905_0066983 3300037471 Bacteria 3363
315 Ga0395905_0107317 3300037471 Bacteria 2621
316 Ga0395905_0179675 3300037471 Bacteria 1986
317 Ga0395905_0225359 3300037471 Bacteria 1754
318 Ga0395905_0271592 3300037471 Bacteria 1581
319 Ga0395905_0448171 3300037471 Bacteria 1188
320 Ga0395901_0001109 3300038443 Bacteria 28630
321 Ga0395901_0001415 3300038443 Bacteria 25052
322 Ga0395901_0003315 3300038443 Bacteria 16225
323 Ga0395901_0006987 3300038443 Bacteria 11407
324 Ga0395901_0011644 3300038443 Bacteria 8908
325 Ga0395901_0011863 3300038443 Bacteria 8836
326 Ga0395901_0017655 3300038443 Bacteria 7284
327 Ga0395901_0022326 3300038443 Bacteria 6485
328 Ga0395901_0032209 3300038443 Bacteria 5410
329 Ga0395901_0035300 3300038443 Bacteria 5165
330 Ga0395901_0045563 3300038443 Bacteria 4552
331 Ga0395901_0113112 3300038443 Bacteria 2850
332 Ga0395901_0128672 3300038443 Bacteria 2661
333 Ga0395901_0156638 3300038443 Bacteria 2392
334 Ga0395901_0506882 3300038443 Bacteria 1228
335 Ga0436360_0905733 3300039438 Bacteria 2685
336 Ga0451797_0707371 3300041453 Bacteria 1927
337 Ga0451839_0968295 3300041496 Bacteria 2958
338 Ga0451847_0641130 3300041503 Bacteria 2807
339 Ga0451849_1223099 3300041505 Bacteria 2473
340 Ga0439431_0001608 3300041997 Bacteria 5012
341 Ga0439442_006856 3300042002 Bacteria 2286
342 Ga0439451_001811 3300042009 Bacteria 4271
343 Ga0439454_000463 3300042011 Bacteria 3248
344 Ga0439462_0008036 3300042015 Bacteria 2654
345 Ga0439446_0001720 3300042156 Bacteria 5084
346 Ga0439446_0002494 3300042156 Bacteria 4425
347 Ga0439434_0007533 3300042435 Bacteria 3190
348 Ga0466969_0009470 3300044656 Bacteria 5165
349 Ga0466965_0030776 3300044683 Bacteria 2616
350 Ga0466966_0003226 3300044684 Bacteria 10750
351 Ga0466966_0030929 3300044684 Bacteria 3472
352 Ga0466966_0086862 3300044684 Bacteria 1944
353 Ga0466961_0018936 3300044693 Bacteria 4430
354 Ga0466961_0049490 3300044693 Bacteria 2686
355 Ga0466961_0096658 3300044693 Bacteria 1862
356 Ga0466963_0000081 3300044694 Bacteria 32755
357 Ga0466963_0000205 3300044694 Bacteria 25099
358 Ga0466963_0001379 3300044694 Bacteria 12998
359 Ga0466963_0001591 3300044694 Bacteria 12328
360 Ga0466963_0004538 3300044694 Bacteria 8084
361 Ga0466963_0005886 3300044694 Bacteria 7225
362 Ga0466963_0018010 3300044694 Bacteria 4407
363 Ga0466963_0025761 3300044694 Bacteria 3754
364 Ga0466963_0027451 3300044694 Bacteria 3645
365 Ga0466963_0041099 3300044694 Bacteria 3031
366 Ga0466963_0079646 3300044694 Bacteria 2216
367 Ga0466963_0085424 3300044694 Bacteria 2142
368 Ga0466963_0153019 3300044694 Bacteria 1602
369 Ga0466964_0000776 3300044706 Bacteria 10380
370 Ga0466964_0002319 3300044706 Bacteria 6753
371 Ga0466964_0004317 3300044706 Bacteria 5238
372 Ga0466964_0040879 3300044706 Bacteria 1873
373 Ga0466971_0000381 3300044719 Bacteria 17046
374 Ga0466971_0008589 3300044719 Bacteria 4454
375 Ga0466968_0011582 3300044735 Bacteria 3438
376 Ga0466968_0022463 3300044735 Bacteria 2564
377 Ga0466968_0073675 3300044735 Bacteria 1490
378 Ga0466968_0101113 3300044735 Bacteria 1287
379 Ga0466957_0003329 3300044842 Bacteria 8808
380 Ga0466957_0041323 3300044842 Bacteria 2788
381 Ga0466957_0045670 3300044842 Bacteria 2657
382 Ga0466960_0005225 3300044901 Bacteria 5132
383 Ga0466960_0018744 3300044901 Bacteria 3038
384 Ga0466959_0006265 3300045049 Bacteria 8221
385 Ga0466959_0020299 3300045049 Bacteria 4893
386 Ga0466959_0105453 3300045049 Bacteria 2015
387 Ga0466959_0169696 3300045049 Bacteria 1531
388 Ga0451576_0072860 3300045051 Bacteria 3574
389 Ga0466958_0009888 3300045836 Bacteria 5326
390 Ga0466958_0016769 3300045836 Bacteria 4223
391 Ga0466958_0040401 3300045836 Bacteria 2803
392 Ga0466958_0132631 3300045836 Bacteria 1565
393 Ga0466967_0000577 3300045976 Bacteria 18063
394 Ga0466967_0005190 3300045976 Bacteria 8966
395 Ga0466967_0013499 3300045976 Bacteria 6316
396 Ga0466967_0017100 3300045976 Bacteria 5745
397 Ga0466967_0021530 3300045976 Bacteria 5240
398 Ga0466967_0022511 3300045976 Bacteria 5143
399 Ga0466967_0040428 3300045976 Bacteria 4014
400 Ga0466967_0042369 3300045976 Bacteria 3933
401 Ga0466967_0045629 3300045976 Bacteria 3809
402 Ga0466967_0046176 3300045976 Bacteria 3790
403 Ga0466967_0046347 3300045976 Bacteria 3784
404 Ga0466967_0064101 3300045976 Bacteria 3267
405 Ga0466967_0067766 3300045976 Bacteria 3184
406 Ga0466967_0073132 3300045976 Bacteria 3074
407 Ga0466967_0101318 3300045976 Bacteria 2632
408 Ga0466967_0123891 3300045976 Bacteria 2392
409 Ga0466967_0196850 3300045976 Bacteria 1907
410 Ga0466967_0243103 3300045976 Bacteria 1717
411 Ga0466967_0281271 3300045976 Bacteria 1596
412 Ga0466967_0329904 3300045976 Bacteria 1473
413 Ga0495592_0000048 3300046454 Bacteria 114599
414 Ga0495603_0008192 3300046455 Bacteria 6316
415 Ga0495629_0001775 3300046459 Bacteria 16928
416 Ga0495629_0095647 3300046459 Bacteria 2072
417 Ga0495641_0001166 3300046461 Bacteria 22610
418 Ga0495641_0029476 3300046461 Bacteria 2644
419 Ga0495641_0033022 3300046461 Bacteria 2460
420 Ga0495651_0000276 3300046462 Bacteria 39992
421 Ga0495651_0001012 3300046462 Bacteria 21756
422 Ga0495651_0026947 3300046462 Bacteria 4474
423 Ga0495651_0082018 3300046462 Bacteria 2434
424 Ga0495653_0002971 3300046463 Bacteria 13578
425 Ga0495653_0010213 3300046463 Bacteria 7685
426 Ga0495653_0041275 3300046463 Bacteria 3602
427 Ga0495653_0041550 3300046463 Bacteria 3589
428 Ga0495653_0046090 3300046463 Bacteria 3376
429 Ga0495582_0000476 3300046473 Bacteria 21966
430 Ga0495639_0003394 3300046475 Bacteria 6900
431 Ga0495662_0002104 3300046476 Bacteria 9983
432 Ga0495662_0082208 3300046476 Bacteria 1567
433 Ga0495664_0022031 3300046477 Bacteria 3686
434 Ga0495664_0044924 3300046477 Bacteria 2619
435 Ga0495608_0044375 3300046511 Bacteria 2967
436 Ga0495608_0048227 3300046511 Bacteria 2831
437 Ga0495618_0007437 3300046514 Bacteria 6625
438 Ga0495618_0017828 3300046514 Bacteria 4357
439 Ga0495628_0000026 3300046516 Bacteria 127398
440 Ga0495628_0035138 3300046516 Bacteria 4029
441 Ga0495628_0104176 3300046516 Bacteria 2187
442 Ga0495630_0019207 3300046517 Bacteria 5023
443 Ga0495630_0161830 3300046517 Bacteria 1704
444 Ga0495644_0001935 3300046523 Bacteria 8317
445 Ga0495644_0065073 3300046523 Bacteria 1370
446 Ga0495666_0031133 3300046526 Bacteria 2615
447 Ga0495652_0001333 3300046529 Bacteria 27472
448 Ga0495652_0034698 3300046529 Bacteria 4395
449 Ga0495652_0072827 3300046529 Bacteria 2862
450 Ga0495652_0108856 3300046529 Bacteria 2232
451 Ga0495665_0001189 3300046531 Bacteria 13861
452 Ga0495665_0094806 3300046531 Bacteria 1567
453 Ga0495640_0082518 3300046533 Bacteria 2134
454 Ga0495640_0098390 3300046533 Bacteria 1923
455 Ga0495640_0141289 3300046533 Bacteria 1552
456 Ga0495640_0181414 3300046533 Bacteria 1341
457 Ga0495586_0015445 3300046535 Bacteria 4062
458 Ga0495587_0000080 3300046536 Bacteria 75321
459 Ga0495587_0022930 3300046536 Bacteria 3839
460 Ga0495645_0000016 3300046543 Bacteria 158415
461 Ga0495645_0022823 3300046543 Bacteria 4529
462 Ga0495645_0039892 3300046543 Bacteria 3424
463 Ga0495645_0146125 3300046543 Bacteria 1647
464 Ga0495645_0186227 3300046543 Bacteria 1418
465 Ga0495667_0002615 3300046559 Bacteria 12024
466 Ga0495667_0003931 3300046559 Bacteria 9967
467 Ga0495667_0013954 3300046559 Bacteria 5424
468 Ga0495667_0059328 3300046559 Bacteria 2511
469 Ga0495667_0103592 3300046559 Bacteria 1840
470 Ga0495656_0014083 3300046615 Bacteria 2991
471 Ga0495634_0090378 3300046642 Bacteria 1989
472 Ga0495635_0054874 3300046663 Bacteria 2744
473 Ga0495635_0075671 3300046663 Bacteria 2306
474 Ga0495635_0100044 3300046663 Bacteria 1981
475 Ga0495657_0003925 3300046675 Bacteria 11937
476 Ga0495657_0011872 3300046675 Bacteria 6492
477 Ga0495657_0066480 3300046675 Bacteria 2368
478 Ga0495657_0149893 3300046675 Bacteria 1449
479 Ga0495599_0000016 3300046678 Bacteria 169605
480 Ga0495599_0024318 3300046678 Bacteria 3788
481 Ga0495599_0071639 3300046678 Bacteria 2163
482 Ga0495623_0000385 3300046679 Bacteria 28941
483 Ga0495623_0020335 3300046679 Bacteria 4290
484 Ga0495623_0075522 3300046679 Bacteria 2092
485 Ga0495646_0000472 3300046680 Bacteria 21408
486 Ga0495646_0045298 3300046680 Bacteria 2688
487 Ga0495646_0050214 3300046680 Bacteria 2529
488 Ga0495647_0005421 3300046681 Bacteria 4179
489 Ga0495658_0004076 3300046683 Bacteria 7197
490 Ga0495658_0023607 3300046683 Bacteria 3266
491 Ga0495613_0002526 3300046689 Bacteria 13768
492 Ga0495613_0016591 3300046689 Bacteria 5483
493 Ga0495624_0079438 3300046690 Bacteria 2034
494 Ga0495589_0029426 3300046794 Bacteria 2769
495 Ga0495600_0005580 3300046809 Bacteria 7598
496 Ga0495600_0019762 3300046809 Bacteria 4305
497 Ga0495600_0048595 3300046809 Bacteria 2767
498 Ga0495600_0087142 3300046809 Bacteria 2037
499 Ga0495600_0125537 3300046809 Bacteria 1669
500 Ga0495581_0000403 3300047315 Bacteria 21748
501 Ga0495604_0000004 3300047317 Bacteria 456385
502 Ga0495604_0040336 3300047317 Bacteria 3666
503 Ga0495604_0040491 3300047317 Bacteria 3659
504 Ga0495604_0074049 3300047317 Bacteria 2568
505 Ga0495636_0068590 3300047318 Bacteria 1510
506 Ga0495674_0015212 3300047319 Bacteria 7198
507 Ga0495674_0015273 3300047319 Bacteria 7184
508 Ga0495674_0059705 3300047319 Bacteria 3330
509 Ga0495674_0069086 3300047319 Bacteria 3055
510 Ga0495674_0294105 3300047319 Bacteria 1327
511 Ga0495680_0004050 3300047322 Bacteria 14128
512 Ga0495680_0006021 3300047322 Bacteria 11342
513 Ga0495680_0007620 3300047322 Bacteria 9890
514 Ga0495680_0024898 3300047322 Bacteria 4956
515 Ga0495680_0027388 3300047322 Bacteria 4684
516 Ga0495680_0081914 3300047322 Bacteria 2435
517 Ga0495680_0086669 3300047322 Bacteria 2356
518 Ga0495680_0134119 3300047322 Bacteria 1817
519 Ga0495675_0000033 3300047444 Bacteria 98338
520 Ga0495675_0191207 3300047444 Bacteria 1249
521 Ga0495684_0005124 3300047471 Bacteria 10225
522 Ga0495684_0006551 3300047471 Bacteria 9034
523 Ga0495684_0009586 3300047471 Bacteria 7464
524 Ga0495684_0206465 3300047471 Bacteria 1446
525 Ga0495593_0019262 3300047673 Bacteria 3826
526 Ga0495602_0000036 3300048088 Bacteria 133584
527 Ga0495602_0055723 3300048088 Bacteria 3480
528 Ga0495602_0061488 3300048088 Bacteria 3265
529 Ga0495614_0015782 3300048089 Bacteria 3289
530 Ga0496100_0002064 3300048903 Bacteria 10092
531 Ga0496100_0019468 3300048903 Bacteria 4050
532 Ga0496100_0021678 3300048903 Bacteria 3874
533 Ga0496100_0048585 3300048903 Bacteria 2739
534 Ga0496100_0222465 3300048903 Bacteria 1386
535 Ga0496101_0002824 3300048904 Bacteria 10672
536 Ga0496101_0004739 3300048904 Bacteria 8621
537 Ga0496101_0046568 3300048904 Bacteria 3110
538 Ga0496102_0027053 3300048905 Bacteria 5121
539 Ga0496103_0013530 3300048906 Bacteria 4839
540 Ga0496103_0059315 3300048906 Bacteria 2378
541 Ga0496104_0017338 3300048907 Bacteria 6555
542 Ga0496104_0044090 3300048907 Bacteria 4191
543 Ga0496104_0068084 3300048907 Bacteria 3383
544 Ga0496104_0136242 3300048907 Bacteria 2359
545 Ga0496104_0234161 3300048907 Bacteria 1748
546 Ga0496104_0245132 3300048907 Bacteria 1704
547 Ga0496105_0085250 3300048908 Bacteria 2610
548 Ga0496105_0183740 3300048908 Bacteria 1711
549 Ga0496105_0183835 3300048908 Bacteria 1711
550 Ga0496105_0184108 3300048908 Bacteria 1709
551 Ga0496106_0000377 3300048909 Bacteria 31680
552 Ga0496106_0003866 3300048909 Bacteria 11165
553 Ga0496106_0024495 3300048909 Bacteria 4487
554 Ga0496106_0084243 3300048909 Bacteria 2446
555 Ga0496106_0236022 3300048909 Bacteria 1461
556 Ga0496107_0001149 3300048910 Bacteria 16027
557 Ga0496107_0016875 3300048910 Bacteria 5132
558 Ga0496107_0051131 3300048910 Bacteria 2980
559 Ga0496107_0247817 3300048910 Bacteria 1325
560 Ga0496108_0076387 3300048911 Bacteria 2831
561 Ga0496108_0374266 3300048911 Bacteria 1244
562 Ga0496109_0000875 3300048912 Bacteria 25071
563 Ga0496109_0098583 3300048912 Bacteria 2709
564 Ga0496109_0203286 3300048912 Bacteria 1862
565 Ga0496110_0020073 3300048913 Bacteria 5636
566 Ga0496110_0060311 3300048913 Bacteria 3345
567 Ga0496110_0082620 3300048913 Bacteria 2865
568 Ga0496110_0442666 3300048913 Bacteria 1184
569 Ga0496111_0002365 3300048914 Bacteria 11365
570 Ga0496111_0046669 3300048914 Bacteria 3119
571 Ga0496111_0240054 3300048914 Bacteria 1346
572 Ga0496112_0004337 3300048915 Bacteria 11993
573 Ga0496112_0016789 3300048915 Bacteria 6866
574 Ga0496112_0044766 3300048915 Bacteria 4337
575 Ga0496112_0132399 3300048915 Bacteria 2464
576 Ga0496112_0151358 3300048915 Bacteria 2287
577 Ga0496112_0299694 3300048915 Bacteria 1553
578 Ga0496113_0000570 3300048916 Bacteria 18358
579 Ga0496113_0019703 3300048916 Bacteria 4726
580 Ga0496113_0231084 3300048916 Bacteria 1475
581 Ga0496113_0347271 3300048916 Bacteria 1190
582 Ga0496114_0015496 3300048917 Bacteria 6129
583 Ga0496114_0015865 3300048917 Bacteria 6062
584 Ga0496114_0035357 3300048917 Bacteria 4125
585 Ga0496114_0060683 3300048917 Bacteria 3161
586 Ga0496114_0074887 3300048917 Bacteria 2850
587 Ga0496114_0202105 3300048917 Bacteria 1740
588 Ga0496115_0015705 3300048918 Bacteria 5750
589 Ga0496115_0085116 3300048918 Bacteria 2578
590 Ga0496115_0112034 3300048918 Bacteria 2242
591 Ga0496115_0140667 3300048918 Bacteria 1991
592 Ga0496115_0147599 3300048918 Bacteria 1941
593 Ga0501031_0081147 3300049568 Bacteria 2114
594 Ga0501032_0123081 3300049569 Bacteria 1714
595 Ga0501033_0015081 3300049570 Bacteria 5863
596 Ga0501033_0018239 3300049570 Bacteria 5302
597 Ga0501034_0012732 3300049571 Bacteria 8676
598 Ga0501036_0024148 3300049572 Bacteria 5124
599 Ga0501036_0051513 3300049572 Bacteria 3485
600 Ga0501036_0078815 3300049572 Bacteria 2786
601 Ga0501038_0016547 3300049574 Bacteria 6685
602 Ga0501039_0004278 3300049575 Bacteria 10760
603 Ga0501039_0042605 3300049575 Bacteria 3506
604 Ga0501039_0121282 3300049575 Bacteria 2049
605 Ga0501039_0232231 3300049575 Bacteria 1450
606 Ga0501040_0001660 3300049576 Bacteria 14230
607 Ga0501040_0051785 3300049576 Bacteria 2808
608 Ga0501041_0000828 3300049577 Bacteria 16596
609 Ga0501041_0030739 3300049577 Bacteria 3242
610 Ga0501042_0001513 3300049578 Bacteria 13741
611 Ga0501042_0002947 3300049578 Bacteria 10571
612 Ga0501043_0167152 3300049579 Bacteria 1717
613 Ga0501046_0003106 3300049580 Bacteria 15320
614 Ga0501046_0041342 3300049580 Bacteria 3680
615 Ga0501047_0049964 3300049581 Bacteria 4038
616 Ga0501047_0050187 3300049581 Bacteria 4029
617 Ga0501048_0000542 3300049582 Bacteria 26560
618 Ga0501048_0086261 3300049582 Bacteria 2214
619 Ga0501067_0028924 3300049583 Bacteria 3072
620 Ga0501067_0040638 3300049583 Bacteria 2582
621 Ga0501067_0120199 3300049583 Bacteria 1461
622 Ga0501068_0021796 3300049584 Bacteria 3744
623 Ga0501068_0037759 3300049584 Bacteria 2891
624 Ga0501068_0213747 3300049584 Bacteria 1225
625 Ga0501069_0012859 3300049585 Bacteria 4457
626 Ga0501069_0047259 3300049585 Bacteria 2389
627 Ga0501069_0048082 3300049585 Bacteria 2368
628 Ga0501070_0004260 3300049586 Bacteria 12299
629 Ga0501070_0008299 3300049586 Bacteria 8778
630 Ga0501070_0009383 3300049586 Bacteria 8273
631 Ga0501070_0027484 3300049586 Bacteria 4772
632 Ga0501071_0019748 3300049587 Bacteria 4677
633 Ga0501071_0027918 3300049587 Bacteria 3973
634 Ga0501071_0035337 3300049587 Bacteria 3559
635 Ga0501071_0126003 3300049587 Bacteria 1901
636 Ga0501071_0203845 3300049587 Bacteria 1486
637 Ga0501071_0217488 3300049587 Bacteria 1437
638 Ga0501072_0001031 3300049588 Bacteria 20648
639 Ga0501072_0001639 3300049588 Bacteria 16736
640 Ga0501072_0009973 3300049588 Bacteria 7224
641 Ga0501072_0088898 3300049588 Bacteria 2451
642 Ga0501072_0099201 3300049588 Bacteria 2315
643 Ga0501073_0035243 3300049589 Bacteria 3558
644 Ga0501073_0060072 3300049589 Bacteria 2653
645 Ga0501074_0000631 3300049590 Bacteria 21842
646 Ga0501074_0008110 3300049590 Bacteria 7611
647 Ga0501074_0059123 3300049590 Bacteria 2762
648 Ga0501075_0003045 3300049591 Bacteria 11199
649 Ga0501075_0003746 3300049591 Bacteria 10213
650 Ga0501075_0019318 3300049591 Bacteria 4940
651 Ga0501076_0002847 3300049592 Bacteria 11972
652 Ga0501076_0018038 3300049592 Bacteria 5371
653 Ga0501076_0126151 3300049592 Bacteria 2074
654 Ga0501076_0212384 3300049592 Bacteria 1581
655 Ga0501077_0001982 3300049593 Bacteria 12355
656 Ga0501077_0003218 3300049593 Bacteria 9832
657 Ga0501077_0144830 3300049593 Bacteria 1507
658 Ga0501077_0243070 3300049593 Bacteria 1144
659 Ga0501079_0005924 3300049741 Bacteria 9156
660 Ga0501079_0023099 3300049741 Bacteria 4774
661 Ga0501079_0060051 3300049741 Bacteria 2933
662 Ga0501079_0107504 3300049741 Bacteria 2165
663 Ga0501079_0302911 3300049741 Bacteria 1251
664 Ga0501080_0003171 3300049742 Bacteria 14495
665 Ga0501080_0018327 3300049742 Bacteria 6479
666 Ga0501080_0036379 3300049742 Bacteria 4595
667 Ga0501080_0137937 3300049742 Bacteria 2256
668 Ga0501080_0251257 3300049742 Bacteria 1612
669 Ga0501081_0001818 3300049743 Bacteria 13220
670 Ga0501081_0004537 3300049743 Bacteria 8916
671 Ga0501081_0023167 3300049743 Bacteria 4161
672 Ga0501083_0052449 3300049744 Bacteria 2740
673 Ga0501035_0116207 3300049822 Bacteria 2341
674 Ga0501035_0181803 3300049822 Bacteria 1811
675 Ga0501044_0047740 3300049823 Bacteria 4428
676 Ga0501044_0163786 3300049823 Bacteria 2199
677 Ga0501045_0006905 3300049824 Bacteria 7870
678 Ga0501045_0011126 3300049824 Bacteria 6305
679 Ga0501045_0016794 3300049824 Bacteria 5199
680 Ga0501045_0067491 3300049824 Bacteria 2627
681 Ga0501045_0243881 3300049824 Bacteria 1337
682 nmdc:mga03n38_78507_c1 3300050490 Bacteria 1545
683 nmdc:mga05p37_28454_c1 3300050507 Bacteria 6814
684 nmdc:mga05p37_705612_c1 3300050507 Bacteria 1120
685 nmdc:mga08y16_136912_c1 3300050511 Bacteria 2545
686 nmdc:mga08y16_49960_c1 3300050511 Bacteria 4376
687 nmdc:mga0n895_116845_c1 3300050512 Bacteria 2686
688 nmdc:mga0n895_122716_c1 3300050512 Bacteria 2620
689 nmdc:mga0n895_28470_c1 3300050512 Bacteria 5314
690 nmdc:mga0rr50_41123_c1 3300050513 Bacteria 3366
691 nmdc:mga0rr50_82614_c1 3300050513 Bacteria 2482
692 nmdc:mga08x19_141327_c1 3300050514 Bacteria 1626
693 nmdc:mga0a205_47813_c1 3300050515 Bacteria 4129
694 Ga0495601_0000101 3300053077 Bacteria 47661
695 Ga0495601_0023366 3300053077 Bacteria 3798
696 Ga0495601_0033107 3300053077 Bacteria 3219
697 Ga0495601_0046549 3300053077 Bacteria 2730
698 Ga0495601_0071776 3300053077 Bacteria 2211
699 Ga0495612_0051751 3300053078 Bacteria 1688
700 Ga0495595_0027693 3300053084 Bacteria 2526
701 Ga0495619_0000235 3300053085 Bacteria 40323
702 Ga0495619_0001903 3300053085 Bacteria 13907
703 Ga0495619_0014867 3300053085 Bacteria 4916
704 Ga0495619_0020786 3300053085 Bacteria 4186
705 Ga0495619_0038976 3300053085 Bacteria 3102
706 Ga0495619_0062800 3300053085 Bacteria 2473
707 Ga0495619_0076823 3300053085 Bacteria 2242
708 Ga0495619_0082557 3300053085 Bacteria 2166
709 Ga0501084_0009898 3300054114 Bacteria 7879
710 Ga0501084_0049243 3300054114 Bacteria 3527
711 Ga0501084_0054566 3300054114 Bacteria 3343
712 Ga0501084_0075212 3300054114 Bacteria 2829
713 Ga0501084_0176818 3300054114 Bacteria 1801
714 Ga0501082_0017062 3300060353 Bacteria 6254
715 Ga0501082_0023829 3300060353 Bacteria 5277
716 Ga0501082_0047727 3300060353 Bacteria 3690
717 Ga0501082_0074426 3300060353 Bacteria 2925
718 Ga0501082_0184023 3300060353 Bacteria 1817
719 Ga0501082_0315120 3300060353 Bacteria 1362
720 Ga0466962_0011206 3300061719 Bacteria 4317
721 Ga0466962_0020097 3300061719 Bacteria 3209
722 Ga0466962_0028520 3300061719 Bacteria 2674
723 Ga0530510_0001724 3300061734 Bacteria 14863
724 Ga0530510_0002879 3300061734 Bacteria 11818
725 Ga0530510_0009891 3300061734 Bacteria 6692
726 Ga0530510_0025027 3300061734 Bacteria 4267
727 Ga0530510_0256253 3300061734 Bacteria 1304
728 Ga0530510_0359200 3300061734 Bacteria 1095
729 Ga0466958_0011049
730 JGI25407J50210_10018035
731 Ga0070658_10007689
732 Ga0070658_10013409
733 Ga0070658_10042251
734 Ga0070658_10080437
735 Ga0070658_10207738
736 Ga0070683_100006231
737 Ga0070680_100002965
738 Ga0070680_100052761
739 Ga0070680_100082986
740 Ga0070682_100016550
741 Ga0070660_100001406
742 Ga0070660_100007008
743 Ga0070660_100009642
744 Ga0070660_100027063
745 Ga0070660_100039348
746 Ga0070660_100313841
747 Ga0070661_100005203
748 Ga0070661_100084952
749 Ga0070671_100360681
750 Ga0070667_100184539
751 Ga0070709_10034067
752 Ga0070714_100008279
753 Ga0070714_100030493
754 Ga0070713_100030257
755 Ga0070713_100077580
756 Ga0070710_10139696
757 Ga0070711_100128960
758 Ga0070700_100199087
759 Ga0070708_100268755
760 Ga0070678_100123885
761 Ga0070681_10004535
762 Ga0070681_10007722
763 Ga0070681_10049708
764 Ga0070681_10072047
765 Ga0070681_10119255
766 Ga0070681_10151071
767 Ga0070706_100075099
768 Ga0070707_100127307
769 Ga0070707_100136216
770 Ga0070707_100245467
771 Ga0070698_100068103
772 Ga0070698_100154850
773 Ga0070698_100251549
774 Ga0070698_100285514
775 Ga0070679_100002527
776 Ga0070679_100049305
777 Ga0070679_100050852
778 Ga0070679_100083069
779 Ga0070679_100088755
780 Ga0070679_100119300
781 Ga0070684_100001220
782 Ga0070684_100052240
783 Ga0070684_100177347
784 Ga0070672_100184256
785 Ga0070695_100000523
786 Ga0070704_100238959
787 Ga0068855_100006830
788 Ga0068855_100008162
789 Ga0068855_100096520
790 Ga0068855_100199760
791 Ga0068855_100227387
792 Ga0068857_100120340
793 Ga0068857_100379300
794 Ga0068856_100213124
795 Ga0081455_10009231
796 Ga0081455_10035388
797 Ga0081455_10077751
798 Ga0081538_10001387
799 Ga0081538_10002772
800 Ga0081538_10021267
801 Ga0081540_1025693
802 Ga0081539_10000363
803 Ga0081539_10004020
804 Ga0081539_10034906
805 Ga0070717_10013843
806 Ga0070717_10014834
807 Ga0070717_10021296
808 Ga0070717_10022330
809 Ga0070717_10040148
810 Ga0070717_10227893
811 Ga0075365_10001885
812 Ga0070715_10015217
813 Ga0070716_100018341
814 Ga0070712_100007705
815 Ga0070712_100320253
816 Ga0075431_100264568
817 Ga0075431_100391268
818 Ga0075433_10106529
819 Ga0075434_100045954
820 Ga0075435_100056779
821 Ga0075435_100116197
822 Ga0105240_10047915
823 Ga0105240_10071608
824 Ga0105240_10174177
825 Ga0111539_10231466
826 Ga0111539_10272509
827 Ga0111539_10499941
828 Ga0114129_10003327
829 Ga0114129_10125486
830 Ga0114129_10813930
831 Ga0105242_10118680
832 Ga0105248_10097248
833 Ga0105237_10015062
834 Ga0105238_10344305
835 Ga0157370_10017228
836 Ga0157370_10026911
837 Ga0157370_10035895
838 Ga0157370_10078696
839 Ga0157370_10101032
840 Ga0157369_10016730
841 Ga0157369_10022561
842 Ga0157369_10027914
843 Ga0157369_10032906
844 Ga0157369_10033935
845 Ga0157369_10056062
846 Ga0157374_10093193
847 Ga0157374_10325773
848 Ga0157372_10015478
849 Ga0157375_10042331
850 Ga0182008_10003086
851 Ga0157379_10142190
852 Ga0182006_1008684
853 Ga0197907_10553097
854 Ga0197907_10959694
855 Ga0206356_10339530
856 Ga0206356_10731890
857 Ga0206356_10833043
858 Ga0206354_10694068
859 Ga0206354_11254550
860 Ga0206353_10332968
861 Ga0206353_10594941
862 Ga0206353_11926521
863 Ga0213871_10028995
864 Ga0224712_10023780
865 Ga0207699_10181356
866 Ga0207699_10188883
867 Ga0207705_10010429
868 Ga0207705_10011584
869 Ga0207705_10055179
870 Ga0207705_10059091
871 Ga0207705_10127433
872 Ga0207705_10230544
873 Ga0207684_10046425
874 Ga0207707_10020828
875 Ga0207707_10031096
876 Ga0207707_10036735
877 Ga0207707_10051691
878 Ga0207707_10129501
879 Ga0207695_10018456
880 Ga0207695_10288440
881 Ga0207693_10003301
882 Ga0207693_10020537
883 Ga0207693_10228461
884 Ga0207663_10038991
885 Ga0207660_10005633
886 Ga0207657_10000397
887 Ga0207657_10012919
888 Ga0207657_10020516
889 Ga0207657_10049893
890 Ga0207657_10057049
891 Ga0207657_10185384
892 Ga0207649_10010018
893 Ga0207649_10044164
894 Ga0207649_10101071
895 Ga0207652_10016307
896 Ga0207652_10100066
897 Ga0207652_10105562
898 Ga0207646_10000149
899 Ga0207646_10074675
900 Ga0207646_10126983
901 Ga0207694_10011242
902 Ga0207694_10041047
903 Ga0207694_10310124
904 Ga0207687_10045549
905 Ga0207700_10000004
906 Ga0207700_10131998
907 Ga0207664_10003350
908 Ga0207664_10046369
909 Ga0207664_10063835
910 Ga0207690_10110439
911 Ga0207686_10093958
912 Ga0207665_10005604
913 Ga0207691_10143036
914 Ga0207661_10008939
915 Ga0207661_10009294
916 Ga0207661_10045618
917 Ga0207661_10272261
918 Ga0207667_10011350
919 Ga0207667_10015984
920 Ga0207667_10118531
921 Ga0207658_10062336
922 Ga0207678_10262314
923 Ga0207708_10310556
924 Ga0207674_10063065
925 Ga0207674_10394601
926 Ga0207683_10233261
927 Ga0207698_10044833
928 Ga0268266_10262087
929 Ga0265337_1025549
930 Ga0265319_1000431
931 Ga0265319_1023407
932 Ga0265334_10005458
933 Ga0265334_10010540
934 Ga0265334_10019919
935 Ga0265334_10033378
936 Ga0265318_10001185
937 Ga0265318_10002390
938 Ga0265323_10006962
939 Ga0265323_10031565
940 Ga0265322_10001626
941 Ga0265322_10006716
942 Ga0265338_10002622
943 Ga0265338_10007766
944 Ga0265338_10009902
945 Ga0265338_10016969
946 Ga0265338_10024447
947 Ga0265338_10032702
948 Ga0265338_10144910
949 Ga0265324_10016115
950 Ga0265324_10045962
951 Ga0265330_10000883
952 Ga0265332_10059673
953 Ga0265328_10002844
954 Ga0265328_10043214
955 Ga0265320_10033179
956 Ga0265320_10056266
957 Ga0265325_10004991
958 Ga0265329_10023454
959 Ga0265339_10017629
960 Ga0265339_10036750
961 Ga0265339_10053262
962 Ga0265331_10010004
963 Ga0265331_10020900
964 Ga0265327_10006964
965 Ga0265327_10029296
966 Ga0265316_10011096
967 Ga0265316_10011765
968 Ga0265316_10040833
969 Ga0265313_10007900
970 Ga0265313_10020198
971 Ga0265313_10023831
972 Ga0265313_10056813
973 Ga0265314_10005549
974 Ga0265314_10012186
975 Ga0265314_10013264
976 Ga0265314_10019953
977 Ga0265314_10162396
978 Ga0265342_10025478
979 Ga0265342_10027315
980 Ga0307405_10012074
981 Ga0307406_10141511
982 Ga0307416_100115114
983 Ga0307414_10100235
984 Ga0307411_10126551
985 Ga0307415_100118963
986 Ga0373944_0013612
987 Ga0373945_0011842
988 Ga0373956_0053987
989 Ga0373943_0051076
990 Ga0373946_0086542
991 Ga0373955_0065460
992 Ga0373935_0050969
993 Ga0373933_0041737
994 Ga0373947_0001423
995 Ga0373937_0001607
996 Ga0373937_0031621
997 Ga0373925_0000937
998 Ga0373925_0026889
999 Ga0373925_0215341
1000 Ga0373925_0368818
1001 Ga0395899_0003146
1002 Ga0395899_0008109
1003 Ga0395899_0023971
1004 Ga0395899_0032725
1005 Ga0395899_0035879
1006 Ga0395899_0058748
1007 Ga0395899_0058896
1008 Ga0395899_0090536
1009 Ga0395899_0093795
1010 Ga0395900_0001650
1011 Ga0395900_0011838
1012 Ga0395900_0013401
1013 Ga0395900_0014506
1014 Ga0395900_0014600
1015 Ga0395900_0017415
1016 Ga0395900_0023124
1017 Ga0395900_0028224
1018 Ga0395900_0028823
1019 Ga0395900_0035682
1020 Ga0395900_0043702
1021 Ga0395900_0055941
1022 Ga0395900_0080057
1023 Ga0395900_0123003
1024 Ga0395900_0198691
1025 Ga0395900_0288524
1026 Ga0395898_0003199
1027 Ga0395898_0003920
1028 Ga0395898_0004513
1029 Ga0395898_0017628
1030 Ga0395898_0033886
1031 Ga0395898_0038341
1032 Ga0395898_0063672
1033 Ga0395898_0101394
1034 Ga0395898_0105135
1035 Ga0395898_0211022
1036 Ga0395905_0005878
1037 Ga0395905_0015302
1038 Ga0395905_0018302
1039 Ga0395905_0024516
1040 Ga0395905_0025607
1041 Ga0395905_0040690
1042 Ga0395905_0066983
1043 Ga0395905_0107317
1044 Ga0395905_0179675
1045 Ga0395905_0225359
1046 Ga0395905_0271592
1047 Ga0395905_0448171
1048 Ga0395901_0001109
1049 Ga0395901_0001415
1050 Ga0395901_0003315
1051 Ga0395901_0006987
1052 Ga0395901_0011644
1053 Ga0395901_0011863
1054 Ga0395901_0017655
1055 Ga0395901_0022326
1056 Ga0395901_0032209
1057 Ga0395901_0035300
1058 Ga0395901_0045563
1059 Ga0395901_0113112
1060 Ga0395901_0128672
1061 Ga0395901_0156638
1062 Ga0395901_0506882
1063 Ga0436360_0905733
1064 Ga0451797_0707371
1065 Ga0451839_0968295
1066 Ga0451847_0641130
1067 Ga0451849_1223099
1068 Ga0439431_0001608
1069 Ga0439442_006856
1070 Ga0439451_001811
1071 Ga0439454_000463
1072 Ga0439462_0008036
1073 Ga0439446_0001720
1074 Ga0439446_0002494
1075 Ga0439434_0007533
1076 Ga0466969_0009470
1077 Ga0466965_0030776
1078 Ga0466966_0003226
1079 Ga0466966_0030929
1080 Ga0466966_0086862
1081 Ga0466961_0018936
1082 Ga0466961_0049490
1083 Ga0466961_0096658
1084 Ga0466963_0000081
1085 Ga0466963_0000205
1086 Ga0466963_0001379
1087 Ga0466963_0001591
1088 Ga0466963_0004538
1089 Ga0466963_0005886
1090 Ga0466963_0018010
1091 Ga0466963_0025761
1092 Ga0466963_0027451
1093 Ga0466963_0041099
1094 Ga0466963_0079646
1095 Ga0466963_0085424
1096 Ga0466963_0153019
1097 Ga0466964_0000776
1098 Ga0466964_0002319
1099 Ga0466964_0004317
1100 Ga0466964_0040879
1101 Ga0466971_0000381
1102 Ga0466971_0008589
1103 Ga0466968_0011582
1104 Ga0466968_0022463
1105 Ga0466968_0073675
1106 Ga0466968_0101113
1107 Ga0466957_0003329
1108 Ga0466957_0041323
1109 Ga0466957_0045670
1110 Ga0466960_0005225
1111 Ga0466960_0018744
1112 Ga0466959_0006265
1113 Ga0466959_0020299
1114 Ga0466959_0105453
1115 Ga0466959_0169696
1116 Ga0451576_0072860
1117 Ga0466958_0009888
1118 Ga0466958_0016769
1119 Ga0466958_0040401
1120 Ga0466958_0132631
1121 Ga0466967_0000577
1122 Ga0466967_0005190
1123 Ga0466967_0013499
1124 Ga0466967_0017100
1125 Ga0466967_0021530
1126 Ga0466967_0022511
1127 Ga0466967_0040428
1128 Ga0466967_0042369
1129 Ga0466967_0045629
1130 Ga0466967_0046176
1131 Ga0466967_0046347
1132 Ga0466967_0064101
1133 Ga0466967_0067766
1134 Ga0466967_0073132
1135 Ga0466967_0101318
1136 Ga0466967_0123891
1137 Ga0466967_0196850
1138 Ga0466967_0243103
1139 Ga0466967_0281271
1140 Ga0466967_0329904
1141 Ga0495592_0000048
1142 Ga0495603_0008192
1143 Ga0495629_0001775
1144 Ga0495629_0095647
1145 Ga0495641_0001166
1146 Ga0495641_0029476
1147 Ga0495641_0033022
1148 Ga0495651_0000276
1149 Ga0495651_0001012
1150 Ga0495651_0026947
1151 Ga0495651_0082018
1152 Ga0495653_0002971
1153 Ga0495653_0010213
1154 Ga0495653_0041275
1155 Ga0495653_0041550
1156 Ga0495653_0046090
1157 Ga0495582_0000476
1158 Ga0495639_0003394
1159 Ga0495662_0002104
1160 Ga0495662_0082208
1161 Ga0495664_0022031
1162 Ga0495664_0044924
1163 Ga0495608_0044375
1164 Ga0495608_0048227
1165 Ga0495618_0007437
1166 Ga0495618_0017828
1167 Ga0495628_0000026
1168 Ga0495628_0035138
1169 Ga0495628_0104176
1170 Ga0495630_0019207
1171 Ga0495630_0161830
1172 Ga0495644_0001935
1173 Ga0495644_0065073
1174 Ga0495666_0031133
1175 Ga0495652_0001333
1176 Ga0495652_0034698
1177 Ga0495652_0072827
1178 Ga0495652_0108856
1179 Ga0495665_0001189
1180 Ga0495665_0094806
1181 Ga0495640_0082518
1182 Ga0495640_0098390
1183 Ga0495640_0141289
1184 Ga0495640_0181414
1185 Ga0495586_0015445
1186 Ga0495587_0000080
1187 Ga0495587_0022930
1188 Ga0495645_0000016
1189 Ga0495645_0022823
1190 Ga0495645_0039892
1191 Ga0495645_0146125
1192 Ga0495645_0186227
1193 Ga0495667_0002615
1194 Ga0495667_0003931
1195 Ga0495667_0013954
1196 Ga0495667_0059328
1197 Ga0495667_0103592
1198 Ga0495656_0014083
1199 Ga0495634_0090378
1200 Ga0495635_0054874
1201 Ga0495635_0075671
1202 Ga0495635_0100044
1203 Ga0495657_0003925
1204 Ga0495657_0011872
1205 Ga0495657_0066480
1206 Ga0495657_0149893
1207 Ga0495599_0000016
1208 Ga0495599_0024318
1209 Ga0495599_0071639
1210 Ga0495623_0000385
1211 Ga0495623_0020335
1212 Ga0495623_0075522
1213 Ga0495646_0000472
1214 Ga0495646_0045298
1215 Ga0495646_0050214
1216 Ga0495647_0005421
1217 Ga0495658_0004076
1218 Ga0495658_0023607
1219 Ga0495613_0002526
1220 Ga0495613_0016591
1221 Ga0495624_0079438
1222 Ga0495589_0029426
1223 Ga0495600_0005580
1224 Ga0495600_0019762
1225 Ga0495600_0048595
1226 Ga0495600_0087142
1227 Ga0495600_0125537
1228 Ga0495581_0000403
1229 Ga0495604_0000004
1230 Ga0495604_0040336
1231 Ga0495604_0040491
1232 Ga0495604_0074049
1233 Ga0495636_0068590
1234 Ga0495674_0015212
1235 Ga0495674_0015273
1236 Ga0495674_0059705
1237 Ga0495674_0069086
1238 Ga0495674_0294105
1239 Ga0495680_0004050
1240 Ga0495680_0006021
1241 Ga0495680_0007620
1242 Ga0495680_0024898
1243 Ga0495680_0027388
1244 Ga0495680_0081914
1245 Ga0495680_0086669
1246 Ga0495680_0134119
1247 Ga0495675_0000033
1248 Ga0495675_0191207
1249 Ga0495684_0005124
1250 Ga0495684_0006551
1251 Ga0495684_0009586
1252 Ga0495684_0206465
1253 Ga0495593_0019262
1254 Ga0495602_0000036
1255 Ga0495602_0055723
1256 Ga0495602_0061488
1257 Ga0495614_0015782
1258 Ga0496100_0002064
1259 Ga0496100_0019468
1260 Ga0496100_0021678
1261 Ga0496100_0048585
1262 Ga0496100_0222465
1263 Ga0496101_0002824
1264 Ga0496101_0004739
1265 Ga0496101_0046568
1266 Ga0496102_0027053
1267 Ga0496103_0013530
1268 Ga0496103_0059315
1269 Ga0496104_0017338
1270 Ga0496104_0044090
1271 Ga0496104_0068084
1272 Ga0496104_0136242
1273 Ga0496104_0234161
1274 Ga0496104_0245132
1275 Ga0496105_0085250
1276 Ga0496105_0183740
1277 Ga0496105_0183835
1278 Ga0496105_0184108
1279 Ga0496106_0000377
1280 Ga0496106_0003866
1281 Ga0496106_0024495
1282 Ga0496106_0084243
1283 Ga0496106_0236022
1284 Ga0496107_0001149
1285 Ga0496107_0016875
1286 Ga0496107_0051131
1287 Ga0496107_0247817
1288 Ga0496108_0076387
1289 Ga0496108_0374266
1290 Ga0496109_0000875
1291 Ga0496109_0098583
1292 Ga0496109_0203286
1293 Ga0496110_0020073
1294 Ga0496110_0060311
1295 Ga0496110_0082620
1296 Ga0496110_0442666
1297 Ga0496111_0002365
1298 Ga0496111_0046669
1299 Ga0496111_0240054
1300 Ga0496112_0004337
1301 Ga0496112_0016789
1302 Ga0496112_0044766
1303 Ga0496112_0132399
1304 Ga0496112_0151358
1305 Ga0496112_0299694
1306 Ga0496113_0000570
1307 Ga0496113_0019703
1308 Ga0496113_0231084
1309 Ga0496113_0347271
1310 Ga0496114_0015496
1311 Ga0496114_0015865
1312 Ga0496114_0035357
1313 Ga0496114_0060683
1314 Ga0496114_0074887
1315 Ga0496114_0202105
1316 Ga0496115_0015705
1317 Ga0496115_0085116
1318 Ga0496115_0112034
1319 Ga0496115_0140667
1320 Ga0496115_0147599
1321 Ga0501031_0081147
1322 Ga0501032_0123081
1323 Ga0501033_0015081
1324 Ga0501033_0018239
1325 Ga0501034_0012732
1326 Ga0501036_0024148
1327 Ga0501036_0051513
1328 Ga0501036_0078815
1329 Ga0501038_0016547
1330 Ga0501039_0004278
1331 Ga0501039_0042605
1332 Ga0501039_0121282
1333 Ga0501039_0232231
1334 Ga0501040_0001660
1335 Ga0501040_0051785
1336 Ga0501041_0000828
1337 Ga0501041_0030739
1338 Ga0501042_0001513
1339 Ga0501042_0002947
1340 Ga0501043_0167152
1341 Ga0501046_0003106
1342 Ga0501046_0041342
1343 Ga0501047_0049964
1344 Ga0501047_0050187
1345 Ga0501048_0000542
1346 Ga0501048_0086261
1347 Ga0501067_0028924
1348 Ga0501067_0040638
1349 Ga0501067_0120199
1350 Ga0501068_0021796
1351 Ga0501068_0037759
1352 Ga0501068_0213747
1353 Ga0501069_0012859
1354 Ga0501069_0047259
1355 Ga0501069_0048082
1356 Ga0501070_0004260
1357 Ga0501070_0008299
1358 Ga0501070_0009383
1359 Ga0501070_0027484
1360 Ga0501071_0019748
1361 Ga0501071_0027918
1362 Ga0501071_0035337
1363 Ga0501071_0126003
1364 Ga0501071_0203845
1365 Ga0501071_0217488
1366 Ga0501072_0001031
1367 Ga0501072_0001639
1368 Ga0501072_0009973
1369 Ga0501072_0088898
1370 Ga0501072_0099201
1371 Ga0501073_0035243
1372 Ga0501073_0060072
1373 Ga0501074_0000631
1374 Ga0501074_0008110
1375 Ga0501074_0059123
1376 Ga0501075_0003045
1377 Ga0501075_0003746
1378 Ga0501075_0019318
1379 Ga0501076_0002847
1380 Ga0501076_0018038
1381 Ga0501076_0126151
1382 Ga0501076_0212384
1383 Ga0501077_0001982
1384 Ga0501077_0003218
1385 Ga0501077_0144830
1386 Ga0501077_0243070
1387 Ga0501079_0005924
1388 Ga0501079_0023099
1389 Ga0501079_0060051
1390 Ga0501079_0107504
1391 Ga0501079_0302911
1392 Ga0501080_0003171
1393 Ga0501080_0018327
1394 Ga0501080_0036379
1395 Ga0501080_0137937
1396 Ga0501080_0251257
1397 Ga0501081_0001818
1398 Ga0501081_0004537
1399 Ga0501081_0023167
1400 Ga0501083_0052449
1401 Ga0501035_0116207
1402 Ga0501035_0181803
1403 Ga0501044_0047740
1404 Ga0501044_0163786
1405 Ga0501045_0006905
1406 Ga0501045_0011126
1407 Ga0501045_0016794
1408 Ga0501045_0067491
1409 Ga0501045_0243881
1410 nmdc:mga03n38_78507_c1
1411 nmdc:mga05p37_28454_c1
1412 nmdc:mga05p37_705612_c1
1413 nmdc:mga08y16_136912_c1
1414 nmdc:mga08y16_49960_c1
1415 nmdc:mga0n895_116845_c1
1416 nmdc:mga0n895_122716_c1
1417 nmdc:mga0n895_28470_c1
1418 nmdc:mga0rr50_41123_c1
1419 nmdc:mga0rr50_82614_c1
1420 nmdc:mga08x19_141327_c1
1421 nmdc:mga0a205_47813_c1
1422 Ga0495601_0000101
1423 Ga0495601_0023366
1424 Ga0495601_0033107
1425 Ga0495601_0046549
1426 Ga0495601_0071776
1427 Ga0495612_0051751
1428 Ga0495595_0027693
1429 Ga0495619_0000235
1430 Ga0495619_0001903
1431 Ga0495619_0014867
1432 Ga0495619_0020786
1433 Ga0495619_0038976
1434 Ga0495619_0062800
1435 Ga0495619_0076823
1436 Ga0495619_0082557
1437 Ga0501084_0009898
1438 Ga0501084_0049243
1439 Ga0501084_0054566
1440 Ga0501084_0075212
1441 Ga0501084_0176818
1442 Ga0501082_0017062
1443 Ga0501082_0023829
1444 Ga0501082_0047727
1445 Ga0501082_0074426
1446 Ga0501082_0184023
1447 Ga0501082_0315120
1448 Ga0466962_0011206
1449 Ga0466962_0020097
1450 Ga0466962_0028520
1451 Ga0530510_0001724
1452 Ga0530510_0002879
1453 Ga0530510_0009891
1454 Ga0530510_0025027
1455 Ga0530510_0256253
1456 Ga0530510_0359200

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

22

128

0.95

PF13237

Fer4_10

4Fe-4S dicluster domain

158

233

0.95

PF13534

Fer4_17

4Fe-4S dicluster domain

165

237

0.92

PF13183

Fer4_8

4Fe-4S dicluster domain

164

236

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lum-assembly1.cif.gz_Q structure of mycobacterium smegmatis succinate dehydrogenase 2 0.8983 1 226
3abv-assembly1.cif.gz_B crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.8951 2 226
2wp9-assembly3.cif.gz_J crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant 0.8926 1 234
8gs8-assembly1.cif.gz_B cryo-em structure of the human respiratory complex ii 0.8921 2 226
2acz-assembly1.cif.gz_B complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.8905 1 234
ID Description Score Start End Superfamily
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9366 2 104 3.10.20.30
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9161 1 104 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9106 2 104 3.10.20.30
af_Q57557_1_93_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9096 3 104 3.10.20.30
af_Q4DKU9_58_161_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.901 2 100 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A7W1LEK7-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9819 1 113 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051536
AF-A0A7W1LEK7-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.965 1 113 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051536
AF-A0A7W0NI69-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9443 1 155 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051537
GO:0051539
AF-A0A538CFY4-F1-model_v4 Succinate dehydrogenase/fumarate reductase iron-sulfur subunit 0.9413 1 183 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051539
AF-A0A836RW40-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9372 1 113 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051537

Map