F477818
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 270 | 1456 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300045836|Ga0466958_0011049|Ga0466958_0011049_1082_2314 |
| Length | 410 |
| Sequence | MPPGTARLLAVRQLGSPRMQVGLKIWRFNSRTGERELQEYEIDAPEEATLLDCLDIVKDRHDGTLAYRKSCRMMICGSCGMRMDGAAVLACKTRMYDVAQAGHVPVISAMGNLPIVKDLVVDMKPFWEKFESVDPYLQPGYEEPPLGREHLIDQPRMNVIHKEALCINCGCCVSECNAMEADPLFTGPQALAKAFRFVGDPRDGNKIARLEKLNGEHGIWECTRCYFCNERCPKGVDPRDAIAKLGAESMKEGIDRDMGAKHAKWFVKSAETTGWLRETELVPKTQGIVSAIKQTRFALDLARHGKVPPPFPPHVAKDVVEARRLRDLVNAQGRDGYRGIVQGERALARLAHGHTGEESLADIYDRPGAFHRPFIAEEQYTGGANEGMGSRTQADATPGEAPTKKPGGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 64 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 99 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 103 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 107 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 116 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 122 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 125 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 126 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 127 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 128 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 129 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 132 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 136 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 137 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 138 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 140 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 141 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 142 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 143 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 144 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 145 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 146 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 147 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 148 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 149 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 150 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 151 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 152 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 153 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 154 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 155 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 156 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 159 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 211 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 216 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 222 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 223 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 224 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 270 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 1.51 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0 |
| Rhizoplane | 8.79 |
| Rhizosphere | 90.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466958_0011049 | 3300045836 | Bacteria | 5076 |
| 2 | JGI25407J50210_10018035 | 3300003373 | Bacteria | 1834 |
| 3 | Ga0070658_10007689 | 3300005327 | Bacteria | 8687 |
| 4 | Ga0070658_10013409 | 3300005327 | Bacteria | 6576 |
| 5 | Ga0070658_10042251 | 3300005327 | Bacteria | 3681 |
| 6 | Ga0070658_10080437 | 3300005327 | Bacteria | 2676 |
| 7 | Ga0070658_10207738 | 3300005327 | Bacteria | 1653 |
| 8 | Ga0070683_100006231 | 3300005329 | Bacteria | 10005 |
| 9 | Ga0070680_100002965 | 3300005336 | Bacteria | 12617 |
| 10 | Ga0070680_100052761 | 3300005336 | Bacteria | 3318 |
| 11 | Ga0070680_100082986 | 3300005336 | Bacteria | 2646 |
| 12 | Ga0070682_100016550 | 3300005337 | Bacteria | 4289 |
| 13 | Ga0070660_100001406 | 3300005339 | Bacteria | 16411 |
| 14 | Ga0070660_100007008 | 3300005339 | Bacteria | 7824 |
| 15 | Ga0070660_100009642 | 3300005339 | Bacteria | 6802 |
| 16 | Ga0070660_100027063 | 3300005339 | Bacteria | 4277 |
| 17 | Ga0070660_100039348 | 3300005339 | Bacteria | 3593 |
| 18 | Ga0070660_100313841 | 3300005339 | Bacteria | 1287 |
| 19 | Ga0070661_100005203 | 3300005344 | Bacteria | 8959 |
| 20 | Ga0070661_100084952 | 3300005344 | Bacteria | 2338 |
| 21 | Ga0070671_100360681 | 3300005355 | Bacteria | 1241 |
| 22 | Ga0070667_100184539 | 3300005367 | Bacteria | 1846 |
| 23 | Ga0070709_10034067 | 3300005434 | Bacteria | 3085 |
| 24 | Ga0070714_100008279 | 3300005435 | Bacteria | 8108 |
| 25 | Ga0070714_100030493 | 3300005435 | Bacteria | 4489 |
| 26 | Ga0070713_100030257 | 3300005436 | Bacteria | 4298 |
| 27 | Ga0070713_100077580 | 3300005436 | Bacteria | 2825 |
| 28 | Ga0070710_10139696 | 3300005437 | Bacteria | 1484 |
| 29 | Ga0070711_100128960 | 3300005439 | Bacteria | 1881 |
| 30 | Ga0070700_100199087 | 3300005441 | Bacteria | 1406 |
| 31 | Ga0070708_100268755 | 3300005445 | Bacteria | 1604 |
| 32 | Ga0070678_100123885 | 3300005456 | Bacteria | 2042 |
| 33 | Ga0070681_10004535 | 3300005458 | Bacteria | 13259 |
| 34 | Ga0070681_10007722 | 3300005458 | Bacteria | 10513 |
| 35 | Ga0070681_10049708 | 3300005458 | Bacteria | 4186 |
| 36 | Ga0070681_10072047 | 3300005458 | Bacteria | 3419 |
| 37 | Ga0070681_10119255 | 3300005458 | Bacteria | 2574 |
| 38 | Ga0070681_10151071 | 3300005458 | Bacteria | 2249 |
| 39 | Ga0070706_100075099 | 3300005467 | Bacteria | 3128 |
| 40 | Ga0070707_100127307 | 3300005468 | Bacteria | 2475 |
| 41 | Ga0070707_100136216 | 3300005468 | Bacteria | 2389 |
| 42 | Ga0070707_100245467 | 3300005468 | Bacteria | 1742 |
| 43 | Ga0070698_100068103 | 3300005471 | Bacteria | 3578 |
| 44 | Ga0070698_100154850 | 3300005471 | Bacteria | 2238 |
| 45 | Ga0070698_100251549 | 3300005471 | Bacteria | 1700 |
| 46 | Ga0070698_100285514 | 3300005471 | Bacteria | 1581 |
| 47 | Ga0070679_100002527 | 3300005530 | Bacteria | 16579 |
| 48 | Ga0070679_100049305 | 3300005530 | Bacteria | 4193 |
| 49 | Ga0070679_100050852 | 3300005530 | Bacteria | 4128 |
| 50 | Ga0070679_100083069 | 3300005530 | Bacteria | 3192 |
| 51 | Ga0070679_100088755 | 3300005530 | Bacteria | 3078 |
| 52 | Ga0070679_100119300 | 3300005530 | Bacteria | 2623 |
| 53 | Ga0070684_100001220 | 3300005535 | Bacteria | 18471 |
| 54 | Ga0070684_100052240 | 3300005535 | Bacteria | 3554 |
| 55 | Ga0070684_100177347 | 3300005535 | Bacteria | 1937 |
| 56 | Ga0070672_100184256 | 3300005543 | Bacteria | 1741 |
| 57 | Ga0070695_100000523 | 3300005545 | Bacteria | 20235 |
| 58 | Ga0070704_100238959 | 3300005549 | Bacteria | 1486 |
| 59 | Ga0068855_100006830 | 3300005563 | Bacteria | 13844 |
| 60 | Ga0068855_100008162 | 3300005563 | Bacteria | 12657 |
| 61 | Ga0068855_100096520 | 3300005563 | Bacteria | 3405 |
| 62 | Ga0068855_100199760 | 3300005563 | Bacteria | 2251 |
| 63 | Ga0068855_100227387 | 3300005563 | Bacteria | 2090 |
| 64 | Ga0068857_100120340 | 3300005577 | Bacteria | 2363 |
| 65 | Ga0068857_100379300 | 3300005577 | Bacteria | 1313 |
| 66 | Ga0068856_100213124 | 3300005614 | Bacteria | 1947 |
| 67 | Ga0081455_10009231 | 3300005937 | Bacteria | 10164 |
| 68 | Ga0081455_10035388 | 3300005937 | Bacteria | 4463 |
| 69 | Ga0081455_10077751 | 3300005937 | Bacteria | 2728 |
| 70 | Ga0081538_10001387 | 3300005981 | Bacteria | 24845 |
| 71 | Ga0081538_10002772 | 3300005981 | Bacteria | 16794 |
| 72 | Ga0081538_10021267 | 3300005981 | Bacteria | 4742 |
| 73 | Ga0081540_1025693 | 3300005983 | Bacteria | 3382 |
| 74 | Ga0081539_10000363 | 3300005985 | Bacteria | 99391 |
| 75 | Ga0081539_10004020 | 3300005985 | Bacteria | 16903 |
| 76 | Ga0081539_10034906 | 3300005985 | Bacteria | 3032 |
| 77 | Ga0070717_10013843 | 3300006028 | Bacteria | 6194 |
| 78 | Ga0070717_10014834 | 3300006028 | Bacteria | 5995 |
| 79 | Ga0070717_10021296 | 3300006028 | Bacteria | 5106 |
| 80 | Ga0070717_10022330 | 3300006028 | Bacteria | 4998 |
| 81 | Ga0070717_10040148 | 3300006028 | Bacteria | 3811 |
| 82 | Ga0070717_10227893 | 3300006028 | Bacteria | 1640 |
| 83 | Ga0075365_10001885 | 3300006038 | Bacteria | 9873 |
| 84 | Ga0070715_10015217 | 3300006163 | Bacteria | 2864 |
| 85 | Ga0070716_100018341 | 3300006173 | Bacteria | 3644 |
| 86 | Ga0070712_100007705 | 3300006175 | Bacteria | 6735 |
| 87 | Ga0070712_100320253 | 3300006175 | Bacteria | 1261 |
| 88 | Ga0075431_100264568 | 3300006847 | Bacteria | 1744 |
| 89 | Ga0075431_100391268 | 3300006847 | Bacteria | 1392 |
| 90 | Ga0075433_10106529 | 3300006852 | Bacteria | 2485 |
| 91 | Ga0075434_100045954 | 3300006871 | Bacteria | 4333 |
| 92 | Ga0075435_100056779 | 3300007076 | Bacteria | 3165 |
| 93 | Ga0075435_100116197 | 3300007076 | Bacteria | 2229 |
| 94 | Ga0105240_10047915 | 3300009093 | Bacteria | 5405 |
| 95 | Ga0105240_10071608 | 3300009093 | Bacteria | 4286 |
| 96 | Ga0105240_10174177 | 3300009093 | Bacteria | 2545 |
| 97 | Ga0111539_10231466 | 3300009094 | Bacteria | 2152 |
| 98 | Ga0111539_10272509 | 3300009094 | Bacteria | 1970 |
| 99 | Ga0111539_10499941 | 3300009094 | Bacteria | 1416 |
| 100 | Ga0114129_10003327 | 3300009147 | Bacteria | 22585 |
| 101 | Ga0114129_10125486 | 3300009147 | Bacteria | 3530 |
| 102 | Ga0114129_10813930 | 3300009147 | Bacteria | 1191 |
| 103 | Ga0105242_10118680 | 3300009176 | Bacteria | 2266 |
| 104 | Ga0105248_10097248 | 3300009177 | Bacteria | 3317 |
| 105 | Ga0105237_10015062 | 3300009545 | Bacteria | 8058 |
| 106 | Ga0105238_10344305 | 3300009551 | Bacteria | 1479 |
| 107 | Ga0157370_10017228 | 3300013104 | Bacteria | 7291 |
| 108 | Ga0157370_10026911 | 3300013104 | Bacteria | 5673 |
| 109 | Ga0157370_10035895 | 3300013104 | Bacteria | 4814 |
| 110 | Ga0157370_10078696 | 3300013104 | Bacteria | 3105 |
| 111 | Ga0157370_10101032 | 3300013104 | Bacteria | 2701 |
| 112 | Ga0157369_10016730 | 3300013105 | Bacteria | 8242 |
| 113 | Ga0157369_10022561 | 3300013105 | Bacteria | 7021 |
| 114 | Ga0157369_10027914 | 3300013105 | Bacteria | 6251 |
| 115 | Ga0157369_10032906 | 3300013105 | Bacteria | 5698 |
| 116 | Ga0157369_10033935 | 3300013105 | Bacteria | 5604 |
| 117 | Ga0157369_10056062 | 3300013105 | Bacteria | 4252 |
| 118 | Ga0157374_10093193 | 3300013296 | Bacteria | 2875 |
| 119 | Ga0157374_10325773 | 3300013296 | Bacteria | 1523 |
| 120 | Ga0157372_10015478 | 3300013307 | Bacteria | 8176 |
| 121 | Ga0157375_10042331 | 3300013308 | Bacteria | 4408 |
| 122 | Ga0182008_10003086 | 3300014497 | Bacteria | 10224 |
| 123 | Ga0157379_10142190 | 3300014968 | Bacteria | 2163 |
| 124 | Ga0182006_1008684 | 3300015261 | Bacteria | 4598 |
| 125 | Ga0197907_10553097 | 3300020069 | Bacteria | 3026 |
| 126 | Ga0197907_10959694 | 3300020069 | Bacteria | 1561 |
| 127 | Ga0206356_10339530 | 3300020070 | Bacteria | 2630 |
| 128 | Ga0206356_10731890 | 3300020070 | Bacteria | 2298 |
| 129 | Ga0206356_10833043 | 3300020070 | Bacteria | 2515 |
| 130 | Ga0206354_10694068 | 3300020081 | Bacteria | 2386 |
| 131 | Ga0206354_11254550 | 3300020081 | Bacteria | 4385 |
| 132 | Ga0206353_10332968 | 3300020082 | Bacteria | 5024 |
| 133 | Ga0206353_10594941 | 3300020082 | Bacteria | 3357 |
| 134 | Ga0206353_11926521 | 3300020082 | Bacteria | 3853 |
| 135 | Ga0213871_10028995 | 3300021441 | Bacteria | 1432 |
| 136 | Ga0224712_10023780 | 3300022467 | Bacteria | 2131 |
| 137 | Ga0207699_10181356 | 3300025906 | Bacteria | 1416 |
| 138 | Ga0207699_10188883 | 3300025906 | Bacteria | 1389 |
| 139 | Ga0207705_10010429 | 3300025909 | Bacteria | 6754 |
| 140 | Ga0207705_10011584 | 3300025909 | Bacteria | 6375 |
| 141 | Ga0207705_10055179 | 3300025909 | Bacteria | 2864 |
| 142 | Ga0207705_10059091 | 3300025909 | Bacteria | 2766 |
| 143 | Ga0207705_10127433 | 3300025909 | Bacteria | 1892 |
| 144 | Ga0207705_10230544 | 3300025909 | Bacteria | 1408 |
| 145 | Ga0207684_10046425 | 3300025910 | Bacteria | 3685 |
| 146 | Ga0207707_10020828 | 3300025912 | Bacteria | 5728 |
| 147 | Ga0207707_10031096 | 3300025912 | Bacteria | 4670 |
| 148 | Ga0207707_10036735 | 3300025912 | Bacteria | 4282 |
| 149 | Ga0207707_10051691 | 3300025912 | Bacteria | 3579 |
| 150 | Ga0207707_10129501 | 3300025912 | Bacteria | 2207 |
| 151 | Ga0207695_10018456 | 3300025913 | Bacteria | 8069 |
| 152 | Ga0207695_10288440 | 3300025913 | Bacteria | 1534 |
| 153 | Ga0207693_10003301 | 3300025915 | Bacteria | 13810 |
| 154 | Ga0207693_10020537 | 3300025915 | Bacteria | 5252 |
| 155 | Ga0207693_10228461 | 3300025915 | Bacteria | 1461 |
| 156 | Ga0207663_10038991 | 3300025916 | Bacteria | 2875 |
| 157 | Ga0207660_10005633 | 3300025917 | Bacteria | 8131 |
| 158 | Ga0207657_10000397 | 3300025919 | Bacteria | 46007 |
| 159 | Ga0207657_10012919 | 3300025919 | Bacteria | 8210 |
| 160 | Ga0207657_10020516 | 3300025919 | Bacteria | 6242 |
| 161 | Ga0207657_10049893 | 3300025919 | Bacteria | 3644 |
| 162 | Ga0207657_10057049 | 3300025919 | Bacteria | 3367 |
| 163 | Ga0207657_10185384 | 3300025919 | Bacteria | 1681 |
| 164 | Ga0207649_10010018 | 3300025920 | Bacteria | 5198 |
| 165 | Ga0207649_10044164 | 3300025920 | Bacteria | 2728 |
| 166 | Ga0207649_10101071 | 3300025920 | Bacteria | 1908 |
| 167 | Ga0207652_10016307 | 3300025921 | Bacteria | 6063 |
| 168 | Ga0207652_10100066 | 3300025921 | Bacteria | 2559 |
| 169 | Ga0207652_10105562 | 3300025921 | Bacteria | 2493 |
| 170 | Ga0207646_10000149 | 3300025922 | Bacteria | 95761 |
| 171 | Ga0207646_10074675 | 3300025922 | Bacteria | 3028 |
| 172 | Ga0207646_10126983 | 3300025922 | Bacteria | 2294 |
| 173 | Ga0207694_10011242 | 3300025924 | Bacteria | 6760 |
| 174 | Ga0207694_10041047 | 3300025924 | Bacteria | 3565 |
| 175 | Ga0207694_10310124 | 3300025924 | Bacteria | 1301 |
| 176 | Ga0207687_10045549 | 3300025927 | Bacteria | 3032 |
| 177 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 178 | Ga0207700_10131998 | 3300025928 | Bacteria | 2040 |
| 179 | Ga0207664_10003350 | 3300025929 | Bacteria | 10650 |
| 180 | Ga0207664_10046369 | 3300025929 | Bacteria | 3411 |
| 181 | Ga0207664_10063835 | 3300025929 | Bacteria | 2944 |
| 182 | Ga0207690_10110439 | 3300025932 | Bacteria | 1979 |
| 183 | Ga0207686_10093958 | 3300025934 | Bacteria | 1987 |
| 184 | Ga0207665_10005604 | 3300025939 | Bacteria | 8369 |
| 185 | Ga0207691_10143036 | 3300025940 | Bacteria | 2106 |
| 186 | Ga0207661_10008939 | 3300025944 | Bacteria | 7175 |
| 187 | Ga0207661_10009294 | 3300025944 | Bacteria | 7045 |
| 188 | Ga0207661_10045618 | 3300025944 | Bacteria | 3471 |
| 189 | Ga0207661_10272261 | 3300025944 | Bacteria | 1511 |
| 190 | Ga0207667_10011350 | 3300025949 | Bacteria | 10360 |
| 191 | Ga0207667_10015984 | 3300025949 | Bacteria | 8499 |
| 192 | Ga0207667_10118531 | 3300025949 | Bacteria | 2728 |
| 193 | Ga0207658_10062336 | 3300025986 | Bacteria | 2790 |
| 194 | Ga0207678_10262314 | 3300026067 | Bacteria | 1481 |
| 195 | Ga0207708_10310556 | 3300026075 | Bacteria | 1284 |
| 196 | Ga0207674_10063065 | 3300026116 | Bacteria | 3742 |
| 197 | Ga0207674_10394601 | 3300026116 | Bacteria | 1337 |
| 198 | Ga0207683_10233261 | 3300026121 | Bacteria | 1678 |
| 199 | Ga0207698_10044833 | 3300026142 | Bacteria | 3326 |
| 200 | Ga0268266_10262087 | 3300028379 | Bacteria | 1602 |
| 201 | Ga0265337_1025549 | 3300028556 | Bacteria | 1798 |
| 202 | Ga0265319_1000431 | 3300028563 | Bacteria | 30124 |
| 203 | Ga0265319_1023407 | 3300028563 | Bacteria | 2239 |
| 204 | Ga0265334_10005458 | 3300028573 | Bacteria | 5555 |
| 205 | Ga0265334_10010540 | 3300028573 | Bacteria | 3902 |
| 206 | Ga0265334_10019919 | 3300028573 | Bacteria | 2753 |
| 207 | Ga0265334_10033378 | 3300028573 | Bacteria | 2049 |
| 208 | Ga0265318_10001185 | 3300028577 | Bacteria | 16028 |
| 209 | Ga0265318_10002390 | 3300028577 | Bacteria | 10047 |
| 210 | Ga0265323_10006962 | 3300028653 | Bacteria | 4728 |
| 211 | Ga0265323_10031565 | 3300028653 | Bacteria | 1969 |
| 212 | Ga0265322_10001626 | 3300028654 | Bacteria | 7177 |
| 213 | Ga0265322_10006716 | 3300028654 | Bacteria | 3380 |
| 214 | Ga0265338_10002622 | 3300028800 | Bacteria | 26550 |
| 215 | Ga0265338_10007766 | 3300028800 | Bacteria | 13196 |
| 216 | Ga0265338_10009902 | 3300028800 | Bacteria | 11275 |
| 217 | Ga0265338_10016969 | 3300028800 | Bacteria | 7878 |
| 218 | Ga0265338_10024447 | 3300028800 | Bacteria | 6170 |
| 219 | Ga0265338_10032702 | 3300028800 | Bacteria | 5064 |
| 220 | Ga0265338_10144910 | 3300028800 | Bacteria | 1854 |
| 221 | Ga0265324_10016115 | 3300029957 | Bacteria | 2736 |
| 222 | Ga0265324_10045962 | 3300029957 | Bacteria | 1503 |
| 223 | Ga0265330_10000883 | 3300031235 | Bacteria | 18661 |
| 224 | Ga0265332_10059673 | 3300031238 | Bacteria | 1632 |
| 225 | Ga0265328_10002844 | 3300031239 | Bacteria | 7726 |
| 226 | Ga0265328_10043214 | 3300031239 | Bacteria | 1658 |
| 227 | Ga0265320_10033179 | 3300031240 | Bacteria | 2637 |
| 228 | Ga0265320_10056266 | 3300031240 | Bacteria | 1890 |
| 229 | Ga0265325_10004991 | 3300031241 | Bacteria | 8268 |
| 230 | Ga0265329_10023454 | 3300031242 | Bacteria | 2055 |
| 231 | Ga0265339_10017629 | 3300031249 | Bacteria | 4224 |
| 232 | Ga0265339_10036750 | 3300031249 | Bacteria | 2738 |
| 233 | Ga0265339_10053262 | 3300031249 | Bacteria | 2201 |
| 234 | Ga0265331_10010004 | 3300031250 | Bacteria | 5274 |
| 235 | Ga0265331_10020900 | 3300031250 | Bacteria | 3355 |
| 236 | Ga0265327_10006964 | 3300031251 | Bacteria | 8873 |
| 237 | Ga0265327_10029296 | 3300031251 | Bacteria | 3133 |
| 238 | Ga0265316_10011096 | 3300031344 | Bacteria | 8160 |
| 239 | Ga0265316_10011765 | 3300031344 | Bacteria | 7871 |
| 240 | Ga0265316_10040833 | 3300031344 | Bacteria | 3717 |
| 241 | Ga0265313_10007900 | 3300031595 | Bacteria | 7160 |
| 242 | Ga0265313_10020198 | 3300031595 | Bacteria | 3680 |
| 243 | Ga0265313_10023831 | 3300031595 | Bacteria | 3287 |
| 244 | Ga0265313_10056813 | 3300031595 | Bacteria | 1849 |
| 245 | Ga0265314_10005549 | 3300031711 | Bacteria | 11347 |
| 246 | Ga0265314_10012186 | 3300031711 | Bacteria | 7041 |
| 247 | Ga0265314_10013264 | 3300031711 | Bacteria | 6668 |
| 248 | Ga0265314_10019953 | 3300031711 | Bacteria | 5182 |
| 249 | Ga0265314_10162396 | 3300031711 | Bacteria | 1358 |
| 250 | Ga0265342_10025478 | 3300031712 | Bacteria | 3716 |
| 251 | Ga0265342_10027315 | 3300031712 | Bacteria | 3568 |
| 252 | Ga0307405_10012074 | 3300031731 | Bacteria | 4557 |
| 253 | Ga0307406_10141511 | 3300031901 | Bacteria | 1703 |
| 254 | Ga0307416_100115114 | 3300032002 | Bacteria | 2380 |
| 255 | Ga0307414_10100235 | 3300032004 | Bacteria | 2178 |
| 256 | Ga0307411_10126551 | 3300032005 | Bacteria | 1859 |
| 257 | Ga0307415_100118963 | 3300032126 | Bacteria | 1976 |
| 258 | Ga0373944_0013612 | 3300035089 | Bacteria | 2260 |
| 259 | Ga0373945_0011842 | 3300035116 | Bacteria | 2889 |
| 260 | Ga0373956_0053987 | 3300035119 | Bacteria | 1810 |
| 261 | Ga0373943_0051076 | 3300035170 | Bacteria | 2034 |
| 262 | Ga0373946_0086542 | 3300035171 | Bacteria | 1381 |
| 263 | Ga0373955_0065460 | 3300035172 | Bacteria | 2018 |
| 264 | Ga0373935_0050969 | 3300035692 | Bacteria | 2628 |
| 265 | Ga0373933_0041737 | 3300035724 | Bacteria | 2709 |
| 266 | Ga0373947_0001423 | 3300035725 | Bacteria | 14714 |
| 267 | Ga0373937_0001607 | 3300036401 | Bacteria | 18982 |
| 268 | Ga0373937_0031621 | 3300036401 | Bacteria | 4797 |
| 269 | Ga0373925_0000937 | 3300037068 | Bacteria | 26571 |
| 270 | Ga0373925_0026889 | 3300037068 | Bacteria | 4212 |
| 271 | Ga0373925_0215341 | 3300037068 | Bacteria | 1531 |
| 272 | Ga0373925_0368818 | 3300037068 | Bacteria | 1168 |
| 273 | Ga0395899_0003146 | 3300037312 | Bacteria | 13111 |
| 274 | Ga0395899_0008109 | 3300037312 | Bacteria | 8091 |
| 275 | Ga0395899_0023971 | 3300037312 | Bacteria | 4617 |
| 276 | Ga0395899_0032725 | 3300037312 | Bacteria | 3907 |
| 277 | Ga0395899_0035879 | 3300037312 | Bacteria | 3721 |
| 278 | Ga0395899_0058748 | 3300037312 | Bacteria | 2836 |
| 279 | Ga0395899_0058896 | 3300037312 | Bacteria | 2832 |
| 280 | Ga0395899_0090536 | 3300037312 | Bacteria | 2218 |
| 281 | Ga0395899_0093795 | 3300037312 | Bacteria | 2172 |
| 282 | Ga0395900_0001650 | 3300037418 | Bacteria | 26129 |
| 283 | Ga0395900_0011838 | 3300037418 | Bacteria | 8919 |
| 284 | Ga0395900_0013401 | 3300037418 | Bacteria | 8377 |
| 285 | Ga0395900_0014506 | 3300037418 | Bacteria | 8041 |
| 286 | Ga0395900_0014600 | 3300037418 | Bacteria | 8014 |
| 287 | Ga0395900_0017415 | 3300037418 | Bacteria | 7333 |
| 288 | Ga0395900_0023124 | 3300037418 | Bacteria | 6360 |
| 289 | Ga0395900_0028224 | 3300037418 | Bacteria | 5748 |
| 290 | Ga0395900_0028823 | 3300037418 | Bacteria | 5691 |
| 291 | Ga0395900_0035682 | 3300037418 | Bacteria | 5122 |
| 292 | Ga0395900_0043702 | 3300037418 | Bacteria | 4618 |
| 293 | Ga0395900_0055941 | 3300037418 | Bacteria | 4061 |
| 294 | Ga0395900_0080057 | 3300037418 | Bacteria | 3357 |
| 295 | Ga0395900_0123003 | 3300037418 | Bacteria | 2661 |
| 296 | Ga0395900_0198691 | 3300037418 | Bacteria | 2030 |
| 297 | Ga0395900_0288524 | 3300037418 | Bacteria | 1630 |
| 298 | Ga0395898_0003199 | 3300037466 | Bacteria | 18440 |
| 299 | Ga0395898_0003920 | 3300037466 | Bacteria | 16425 |
| 300 | Ga0395898_0004513 | 3300037466 | Bacteria | 15211 |
| 301 | Ga0395898_0017628 | 3300037466 | Bacteria | 7290 |
| 302 | Ga0395898_0033886 | 3300037466 | Bacteria | 5093 |
| 303 | Ga0395898_0038341 | 3300037466 | Bacteria | 4750 |
| 304 | Ga0395898_0063672 | 3300037466 | Bacteria | 3578 |
| 305 | Ga0395898_0101394 | 3300037466 | Bacteria | 2764 |
| 306 | Ga0395898_0105135 | 3300037466 | Bacteria | 2707 |
| 307 | Ga0395898_0211022 | 3300037466 | Bacteria | 1852 |
| 308 | Ga0395905_0005878 | 3300037471 | Bacteria | 12452 |
| 309 | Ga0395905_0015302 | 3300037471 | Bacteria | 7293 |
| 310 | Ga0395905_0018302 | 3300037471 | Bacteria | 6650 |
| 311 | Ga0395905_0024516 | 3300037471 | Bacteria | 5693 |
| 312 | Ga0395905_0025607 | 3300037471 | Bacteria | 5563 |
| 313 | Ga0395905_0040690 | 3300037471 | Bacteria | 4360 |
| 314 | Ga0395905_0066983 | 3300037471 | Bacteria | 3363 |
| 315 | Ga0395905_0107317 | 3300037471 | Bacteria | 2621 |
| 316 | Ga0395905_0179675 | 3300037471 | Bacteria | 1986 |
| 317 | Ga0395905_0225359 | 3300037471 | Bacteria | 1754 |
| 318 | Ga0395905_0271592 | 3300037471 | Bacteria | 1581 |
| 319 | Ga0395905_0448171 | 3300037471 | Bacteria | 1188 |
| 320 | Ga0395901_0001109 | 3300038443 | Bacteria | 28630 |
| 321 | Ga0395901_0001415 | 3300038443 | Bacteria | 25052 |
| 322 | Ga0395901_0003315 | 3300038443 | Bacteria | 16225 |
| 323 | Ga0395901_0006987 | 3300038443 | Bacteria | 11407 |
| 324 | Ga0395901_0011644 | 3300038443 | Bacteria | 8908 |
| 325 | Ga0395901_0011863 | 3300038443 | Bacteria | 8836 |
| 326 | Ga0395901_0017655 | 3300038443 | Bacteria | 7284 |
| 327 | Ga0395901_0022326 | 3300038443 | Bacteria | 6485 |
| 328 | Ga0395901_0032209 | 3300038443 | Bacteria | 5410 |
| 329 | Ga0395901_0035300 | 3300038443 | Bacteria | 5165 |
| 330 | Ga0395901_0045563 | 3300038443 | Bacteria | 4552 |
| 331 | Ga0395901_0113112 | 3300038443 | Bacteria | 2850 |
| 332 | Ga0395901_0128672 | 3300038443 | Bacteria | 2661 |
| 333 | Ga0395901_0156638 | 3300038443 | Bacteria | 2392 |
| 334 | Ga0395901_0506882 | 3300038443 | Bacteria | 1228 |
| 335 | Ga0436360_0905733 | 3300039438 | Bacteria | 2685 |
| 336 | Ga0451797_0707371 | 3300041453 | Bacteria | 1927 |
| 337 | Ga0451839_0968295 | 3300041496 | Bacteria | 2958 |
| 338 | Ga0451847_0641130 | 3300041503 | Bacteria | 2807 |
| 339 | Ga0451849_1223099 | 3300041505 | Bacteria | 2473 |
| 340 | Ga0439431_0001608 | 3300041997 | Bacteria | 5012 |
| 341 | Ga0439442_006856 | 3300042002 | Bacteria | 2286 |
| 342 | Ga0439451_001811 | 3300042009 | Bacteria | 4271 |
| 343 | Ga0439454_000463 | 3300042011 | Bacteria | 3248 |
| 344 | Ga0439462_0008036 | 3300042015 | Bacteria | 2654 |
| 345 | Ga0439446_0001720 | 3300042156 | Bacteria | 5084 |
| 346 | Ga0439446_0002494 | 3300042156 | Bacteria | 4425 |
| 347 | Ga0439434_0007533 | 3300042435 | Bacteria | 3190 |
| 348 | Ga0466969_0009470 | 3300044656 | Bacteria | 5165 |
| 349 | Ga0466965_0030776 | 3300044683 | Bacteria | 2616 |
| 350 | Ga0466966_0003226 | 3300044684 | Bacteria | 10750 |
| 351 | Ga0466966_0030929 | 3300044684 | Bacteria | 3472 |
| 352 | Ga0466966_0086862 | 3300044684 | Bacteria | 1944 |
| 353 | Ga0466961_0018936 | 3300044693 | Bacteria | 4430 |
| 354 | Ga0466961_0049490 | 3300044693 | Bacteria | 2686 |
| 355 | Ga0466961_0096658 | 3300044693 | Bacteria | 1862 |
| 356 | Ga0466963_0000081 | 3300044694 | Bacteria | 32755 |
| 357 | Ga0466963_0000205 | 3300044694 | Bacteria | 25099 |
| 358 | Ga0466963_0001379 | 3300044694 | Bacteria | 12998 |
| 359 | Ga0466963_0001591 | 3300044694 | Bacteria | 12328 |
| 360 | Ga0466963_0004538 | 3300044694 | Bacteria | 8084 |
| 361 | Ga0466963_0005886 | 3300044694 | Bacteria | 7225 |
| 362 | Ga0466963_0018010 | 3300044694 | Bacteria | 4407 |
| 363 | Ga0466963_0025761 | 3300044694 | Bacteria | 3754 |
| 364 | Ga0466963_0027451 | 3300044694 | Bacteria | 3645 |
| 365 | Ga0466963_0041099 | 3300044694 | Bacteria | 3031 |
| 366 | Ga0466963_0079646 | 3300044694 | Bacteria | 2216 |
| 367 | Ga0466963_0085424 | 3300044694 | Bacteria | 2142 |
| 368 | Ga0466963_0153019 | 3300044694 | Bacteria | 1602 |
| 369 | Ga0466964_0000776 | 3300044706 | Bacteria | 10380 |
| 370 | Ga0466964_0002319 | 3300044706 | Bacteria | 6753 |
| 371 | Ga0466964_0004317 | 3300044706 | Bacteria | 5238 |
| 372 | Ga0466964_0040879 | 3300044706 | Bacteria | 1873 |
| 373 | Ga0466971_0000381 | 3300044719 | Bacteria | 17046 |
| 374 | Ga0466971_0008589 | 3300044719 | Bacteria | 4454 |
| 375 | Ga0466968_0011582 | 3300044735 | Bacteria | 3438 |
| 376 | Ga0466968_0022463 | 3300044735 | Bacteria | 2564 |
| 377 | Ga0466968_0073675 | 3300044735 | Bacteria | 1490 |
| 378 | Ga0466968_0101113 | 3300044735 | Bacteria | 1287 |
| 379 | Ga0466957_0003329 | 3300044842 | Bacteria | 8808 |
| 380 | Ga0466957_0041323 | 3300044842 | Bacteria | 2788 |
| 381 | Ga0466957_0045670 | 3300044842 | Bacteria | 2657 |
| 382 | Ga0466960_0005225 | 3300044901 | Bacteria | 5132 |
| 383 | Ga0466960_0018744 | 3300044901 | Bacteria | 3038 |
| 384 | Ga0466959_0006265 | 3300045049 | Bacteria | 8221 |
| 385 | Ga0466959_0020299 | 3300045049 | Bacteria | 4893 |
| 386 | Ga0466959_0105453 | 3300045049 | Bacteria | 2015 |
| 387 | Ga0466959_0169696 | 3300045049 | Bacteria | 1531 |
| 388 | Ga0451576_0072860 | 3300045051 | Bacteria | 3574 |
| 389 | Ga0466958_0009888 | 3300045836 | Bacteria | 5326 |
| 390 | Ga0466958_0016769 | 3300045836 | Bacteria | 4223 |
| 391 | Ga0466958_0040401 | 3300045836 | Bacteria | 2803 |
| 392 | Ga0466958_0132631 | 3300045836 | Bacteria | 1565 |
| 393 | Ga0466967_0000577 | 3300045976 | Bacteria | 18063 |
| 394 | Ga0466967_0005190 | 3300045976 | Bacteria | 8966 |
| 395 | Ga0466967_0013499 | 3300045976 | Bacteria | 6316 |
| 396 | Ga0466967_0017100 | 3300045976 | Bacteria | 5745 |
| 397 | Ga0466967_0021530 | 3300045976 | Bacteria | 5240 |
| 398 | Ga0466967_0022511 | 3300045976 | Bacteria | 5143 |
| 399 | Ga0466967_0040428 | 3300045976 | Bacteria | 4014 |
| 400 | Ga0466967_0042369 | 3300045976 | Bacteria | 3933 |
| 401 | Ga0466967_0045629 | 3300045976 | Bacteria | 3809 |
| 402 | Ga0466967_0046176 | 3300045976 | Bacteria | 3790 |
| 403 | Ga0466967_0046347 | 3300045976 | Bacteria | 3784 |
| 404 | Ga0466967_0064101 | 3300045976 | Bacteria | 3267 |
| 405 | Ga0466967_0067766 | 3300045976 | Bacteria | 3184 |
| 406 | Ga0466967_0073132 | 3300045976 | Bacteria | 3074 |
| 407 | Ga0466967_0101318 | 3300045976 | Bacteria | 2632 |
| 408 | Ga0466967_0123891 | 3300045976 | Bacteria | 2392 |
| 409 | Ga0466967_0196850 | 3300045976 | Bacteria | 1907 |
| 410 | Ga0466967_0243103 | 3300045976 | Bacteria | 1717 |
| 411 | Ga0466967_0281271 | 3300045976 | Bacteria | 1596 |
| 412 | Ga0466967_0329904 | 3300045976 | Bacteria | 1473 |
| 413 | Ga0495592_0000048 | 3300046454 | Bacteria | 114599 |
| 414 | Ga0495603_0008192 | 3300046455 | Bacteria | 6316 |
| 415 | Ga0495629_0001775 | 3300046459 | Bacteria | 16928 |
| 416 | Ga0495629_0095647 | 3300046459 | Bacteria | 2072 |
| 417 | Ga0495641_0001166 | 3300046461 | Bacteria | 22610 |
| 418 | Ga0495641_0029476 | 3300046461 | Bacteria | 2644 |
| 419 | Ga0495641_0033022 | 3300046461 | Bacteria | 2460 |
| 420 | Ga0495651_0000276 | 3300046462 | Bacteria | 39992 |
| 421 | Ga0495651_0001012 | 3300046462 | Bacteria | 21756 |
| 422 | Ga0495651_0026947 | 3300046462 | Bacteria | 4474 |
| 423 | Ga0495651_0082018 | 3300046462 | Bacteria | 2434 |
| 424 | Ga0495653_0002971 | 3300046463 | Bacteria | 13578 |
| 425 | Ga0495653_0010213 | 3300046463 | Bacteria | 7685 |
| 426 | Ga0495653_0041275 | 3300046463 | Bacteria | 3602 |
| 427 | Ga0495653_0041550 | 3300046463 | Bacteria | 3589 |
| 428 | Ga0495653_0046090 | 3300046463 | Bacteria | 3376 |
| 429 | Ga0495582_0000476 | 3300046473 | Bacteria | 21966 |
| 430 | Ga0495639_0003394 | 3300046475 | Bacteria | 6900 |
| 431 | Ga0495662_0002104 | 3300046476 | Bacteria | 9983 |
| 432 | Ga0495662_0082208 | 3300046476 | Bacteria | 1567 |
| 433 | Ga0495664_0022031 | 3300046477 | Bacteria | 3686 |
| 434 | Ga0495664_0044924 | 3300046477 | Bacteria | 2619 |
| 435 | Ga0495608_0044375 | 3300046511 | Bacteria | 2967 |
| 436 | Ga0495608_0048227 | 3300046511 | Bacteria | 2831 |
| 437 | Ga0495618_0007437 | 3300046514 | Bacteria | 6625 |
| 438 | Ga0495618_0017828 | 3300046514 | Bacteria | 4357 |
| 439 | Ga0495628_0000026 | 3300046516 | Bacteria | 127398 |
| 440 | Ga0495628_0035138 | 3300046516 | Bacteria | 4029 |
| 441 | Ga0495628_0104176 | 3300046516 | Bacteria | 2187 |
| 442 | Ga0495630_0019207 | 3300046517 | Bacteria | 5023 |
| 443 | Ga0495630_0161830 | 3300046517 | Bacteria | 1704 |
| 444 | Ga0495644_0001935 | 3300046523 | Bacteria | 8317 |
| 445 | Ga0495644_0065073 | 3300046523 | Bacteria | 1370 |
| 446 | Ga0495666_0031133 | 3300046526 | Bacteria | 2615 |
| 447 | Ga0495652_0001333 | 3300046529 | Bacteria | 27472 |
| 448 | Ga0495652_0034698 | 3300046529 | Bacteria | 4395 |
| 449 | Ga0495652_0072827 | 3300046529 | Bacteria | 2862 |
| 450 | Ga0495652_0108856 | 3300046529 | Bacteria | 2232 |
| 451 | Ga0495665_0001189 | 3300046531 | Bacteria | 13861 |
| 452 | Ga0495665_0094806 | 3300046531 | Bacteria | 1567 |
| 453 | Ga0495640_0082518 | 3300046533 | Bacteria | 2134 |
| 454 | Ga0495640_0098390 | 3300046533 | Bacteria | 1923 |
| 455 | Ga0495640_0141289 | 3300046533 | Bacteria | 1552 |
| 456 | Ga0495640_0181414 | 3300046533 | Bacteria | 1341 |
| 457 | Ga0495586_0015445 | 3300046535 | Bacteria | 4062 |
| 458 | Ga0495587_0000080 | 3300046536 | Bacteria | 75321 |
| 459 | Ga0495587_0022930 | 3300046536 | Bacteria | 3839 |
| 460 | Ga0495645_0000016 | 3300046543 | Bacteria | 158415 |
| 461 | Ga0495645_0022823 | 3300046543 | Bacteria | 4529 |
| 462 | Ga0495645_0039892 | 3300046543 | Bacteria | 3424 |
| 463 | Ga0495645_0146125 | 3300046543 | Bacteria | 1647 |
| 464 | Ga0495645_0186227 | 3300046543 | Bacteria | 1418 |
| 465 | Ga0495667_0002615 | 3300046559 | Bacteria | 12024 |
| 466 | Ga0495667_0003931 | 3300046559 | Bacteria | 9967 |
| 467 | Ga0495667_0013954 | 3300046559 | Bacteria | 5424 |
| 468 | Ga0495667_0059328 | 3300046559 | Bacteria | 2511 |
| 469 | Ga0495667_0103592 | 3300046559 | Bacteria | 1840 |
| 470 | Ga0495656_0014083 | 3300046615 | Bacteria | 2991 |
| 471 | Ga0495634_0090378 | 3300046642 | Bacteria | 1989 |
| 472 | Ga0495635_0054874 | 3300046663 | Bacteria | 2744 |
| 473 | Ga0495635_0075671 | 3300046663 | Bacteria | 2306 |
| 474 | Ga0495635_0100044 | 3300046663 | Bacteria | 1981 |
| 475 | Ga0495657_0003925 | 3300046675 | Bacteria | 11937 |
| 476 | Ga0495657_0011872 | 3300046675 | Bacteria | 6492 |
| 477 | Ga0495657_0066480 | 3300046675 | Bacteria | 2368 |
| 478 | Ga0495657_0149893 | 3300046675 | Bacteria | 1449 |
| 479 | Ga0495599_0000016 | 3300046678 | Bacteria | 169605 |
| 480 | Ga0495599_0024318 | 3300046678 | Bacteria | 3788 |
| 481 | Ga0495599_0071639 | 3300046678 | Bacteria | 2163 |
| 482 | Ga0495623_0000385 | 3300046679 | Bacteria | 28941 |
| 483 | Ga0495623_0020335 | 3300046679 | Bacteria | 4290 |
| 484 | Ga0495623_0075522 | 3300046679 | Bacteria | 2092 |
| 485 | Ga0495646_0000472 | 3300046680 | Bacteria | 21408 |
| 486 | Ga0495646_0045298 | 3300046680 | Bacteria | 2688 |
| 487 | Ga0495646_0050214 | 3300046680 | Bacteria | 2529 |
| 488 | Ga0495647_0005421 | 3300046681 | Bacteria | 4179 |
| 489 | Ga0495658_0004076 | 3300046683 | Bacteria | 7197 |
| 490 | Ga0495658_0023607 | 3300046683 | Bacteria | 3266 |
| 491 | Ga0495613_0002526 | 3300046689 | Bacteria | 13768 |
| 492 | Ga0495613_0016591 | 3300046689 | Bacteria | 5483 |
| 493 | Ga0495624_0079438 | 3300046690 | Bacteria | 2034 |
| 494 | Ga0495589_0029426 | 3300046794 | Bacteria | 2769 |
| 495 | Ga0495600_0005580 | 3300046809 | Bacteria | 7598 |
| 496 | Ga0495600_0019762 | 3300046809 | Bacteria | 4305 |
| 497 | Ga0495600_0048595 | 3300046809 | Bacteria | 2767 |
| 498 | Ga0495600_0087142 | 3300046809 | Bacteria | 2037 |
| 499 | Ga0495600_0125537 | 3300046809 | Bacteria | 1669 |
| 500 | Ga0495581_0000403 | 3300047315 | Bacteria | 21748 |
| 501 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 502 | Ga0495604_0040336 | 3300047317 | Bacteria | 3666 |
| 503 | Ga0495604_0040491 | 3300047317 | Bacteria | 3659 |
| 504 | Ga0495604_0074049 | 3300047317 | Bacteria | 2568 |
| 505 | Ga0495636_0068590 | 3300047318 | Bacteria | 1510 |
| 506 | Ga0495674_0015212 | 3300047319 | Bacteria | 7198 |
| 507 | Ga0495674_0015273 | 3300047319 | Bacteria | 7184 |
| 508 | Ga0495674_0059705 | 3300047319 | Bacteria | 3330 |
| 509 | Ga0495674_0069086 | 3300047319 | Bacteria | 3055 |
| 510 | Ga0495674_0294105 | 3300047319 | Bacteria | 1327 |
| 511 | Ga0495680_0004050 | 3300047322 | Bacteria | 14128 |
| 512 | Ga0495680_0006021 | 3300047322 | Bacteria | 11342 |
| 513 | Ga0495680_0007620 | 3300047322 | Bacteria | 9890 |
| 514 | Ga0495680_0024898 | 3300047322 | Bacteria | 4956 |
| 515 | Ga0495680_0027388 | 3300047322 | Bacteria | 4684 |
| 516 | Ga0495680_0081914 | 3300047322 | Bacteria | 2435 |
| 517 | Ga0495680_0086669 | 3300047322 | Bacteria | 2356 |
| 518 | Ga0495680_0134119 | 3300047322 | Bacteria | 1817 |
| 519 | Ga0495675_0000033 | 3300047444 | Bacteria | 98338 |
| 520 | Ga0495675_0191207 | 3300047444 | Bacteria | 1249 |
| 521 | Ga0495684_0005124 | 3300047471 | Bacteria | 10225 |
| 522 | Ga0495684_0006551 | 3300047471 | Bacteria | 9034 |
| 523 | Ga0495684_0009586 | 3300047471 | Bacteria | 7464 |
| 524 | Ga0495684_0206465 | 3300047471 | Bacteria | 1446 |
| 525 | Ga0495593_0019262 | 3300047673 | Bacteria | 3826 |
| 526 | Ga0495602_0000036 | 3300048088 | Bacteria | 133584 |
| 527 | Ga0495602_0055723 | 3300048088 | Bacteria | 3480 |
| 528 | Ga0495602_0061488 | 3300048088 | Bacteria | 3265 |
| 529 | Ga0495614_0015782 | 3300048089 | Bacteria | 3289 |
| 530 | Ga0496100_0002064 | 3300048903 | Bacteria | 10092 |
| 531 | Ga0496100_0019468 | 3300048903 | Bacteria | 4050 |
| 532 | Ga0496100_0021678 | 3300048903 | Bacteria | 3874 |
| 533 | Ga0496100_0048585 | 3300048903 | Bacteria | 2739 |
| 534 | Ga0496100_0222465 | 3300048903 | Bacteria | 1386 |
| 535 | Ga0496101_0002824 | 3300048904 | Bacteria | 10672 |
| 536 | Ga0496101_0004739 | 3300048904 | Bacteria | 8621 |
| 537 | Ga0496101_0046568 | 3300048904 | Bacteria | 3110 |
| 538 | Ga0496102_0027053 | 3300048905 | Bacteria | 5121 |
| 539 | Ga0496103_0013530 | 3300048906 | Bacteria | 4839 |
| 540 | Ga0496103_0059315 | 3300048906 | Bacteria | 2378 |
| 541 | Ga0496104_0017338 | 3300048907 | Bacteria | 6555 |
| 542 | Ga0496104_0044090 | 3300048907 | Bacteria | 4191 |
| 543 | Ga0496104_0068084 | 3300048907 | Bacteria | 3383 |
| 544 | Ga0496104_0136242 | 3300048907 | Bacteria | 2359 |
| 545 | Ga0496104_0234161 | 3300048907 | Bacteria | 1748 |
| 546 | Ga0496104_0245132 | 3300048907 | Bacteria | 1704 |
| 547 | Ga0496105_0085250 | 3300048908 | Bacteria | 2610 |
| 548 | Ga0496105_0183740 | 3300048908 | Bacteria | 1711 |
| 549 | Ga0496105_0183835 | 3300048908 | Bacteria | 1711 |
| 550 | Ga0496105_0184108 | 3300048908 | Bacteria | 1709 |
| 551 | Ga0496106_0000377 | 3300048909 | Bacteria | 31680 |
| 552 | Ga0496106_0003866 | 3300048909 | Bacteria | 11165 |
| 553 | Ga0496106_0024495 | 3300048909 | Bacteria | 4487 |
| 554 | Ga0496106_0084243 | 3300048909 | Bacteria | 2446 |
| 555 | Ga0496106_0236022 | 3300048909 | Bacteria | 1461 |
| 556 | Ga0496107_0001149 | 3300048910 | Bacteria | 16027 |
| 557 | Ga0496107_0016875 | 3300048910 | Bacteria | 5132 |
| 558 | Ga0496107_0051131 | 3300048910 | Bacteria | 2980 |
| 559 | Ga0496107_0247817 | 3300048910 | Bacteria | 1325 |
| 560 | Ga0496108_0076387 | 3300048911 | Bacteria | 2831 |
| 561 | Ga0496108_0374266 | 3300048911 | Bacteria | 1244 |
| 562 | Ga0496109_0000875 | 3300048912 | Bacteria | 25071 |
| 563 | Ga0496109_0098583 | 3300048912 | Bacteria | 2709 |
| 564 | Ga0496109_0203286 | 3300048912 | Bacteria | 1862 |
| 565 | Ga0496110_0020073 | 3300048913 | Bacteria | 5636 |
| 566 | Ga0496110_0060311 | 3300048913 | Bacteria | 3345 |
| 567 | Ga0496110_0082620 | 3300048913 | Bacteria | 2865 |
| 568 | Ga0496110_0442666 | 3300048913 | Bacteria | 1184 |
| 569 | Ga0496111_0002365 | 3300048914 | Bacteria | 11365 |
| 570 | Ga0496111_0046669 | 3300048914 | Bacteria | 3119 |
| 571 | Ga0496111_0240054 | 3300048914 | Bacteria | 1346 |
| 572 | Ga0496112_0004337 | 3300048915 | Bacteria | 11993 |
| 573 | Ga0496112_0016789 | 3300048915 | Bacteria | 6866 |
| 574 | Ga0496112_0044766 | 3300048915 | Bacteria | 4337 |
| 575 | Ga0496112_0132399 | 3300048915 | Bacteria | 2464 |
| 576 | Ga0496112_0151358 | 3300048915 | Bacteria | 2287 |
| 577 | Ga0496112_0299694 | 3300048915 | Bacteria | 1553 |
| 578 | Ga0496113_0000570 | 3300048916 | Bacteria | 18358 |
| 579 | Ga0496113_0019703 | 3300048916 | Bacteria | 4726 |
| 580 | Ga0496113_0231084 | 3300048916 | Bacteria | 1475 |
| 581 | Ga0496113_0347271 | 3300048916 | Bacteria | 1190 |
| 582 | Ga0496114_0015496 | 3300048917 | Bacteria | 6129 |
| 583 | Ga0496114_0015865 | 3300048917 | Bacteria | 6062 |
| 584 | Ga0496114_0035357 | 3300048917 | Bacteria | 4125 |
| 585 | Ga0496114_0060683 | 3300048917 | Bacteria | 3161 |
| 586 | Ga0496114_0074887 | 3300048917 | Bacteria | 2850 |
| 587 | Ga0496114_0202105 | 3300048917 | Bacteria | 1740 |
| 588 | Ga0496115_0015705 | 3300048918 | Bacteria | 5750 |
| 589 | Ga0496115_0085116 | 3300048918 | Bacteria | 2578 |
| 590 | Ga0496115_0112034 | 3300048918 | Bacteria | 2242 |
| 591 | Ga0496115_0140667 | 3300048918 | Bacteria | 1991 |
| 592 | Ga0496115_0147599 | 3300048918 | Bacteria | 1941 |
| 593 | Ga0501031_0081147 | 3300049568 | Bacteria | 2114 |
| 594 | Ga0501032_0123081 | 3300049569 | Bacteria | 1714 |
| 595 | Ga0501033_0015081 | 3300049570 | Bacteria | 5863 |
| 596 | Ga0501033_0018239 | 3300049570 | Bacteria | 5302 |
| 597 | Ga0501034_0012732 | 3300049571 | Bacteria | 8676 |
| 598 | Ga0501036_0024148 | 3300049572 | Bacteria | 5124 |
| 599 | Ga0501036_0051513 | 3300049572 | Bacteria | 3485 |
| 600 | Ga0501036_0078815 | 3300049572 | Bacteria | 2786 |
| 601 | Ga0501038_0016547 | 3300049574 | Bacteria | 6685 |
| 602 | Ga0501039_0004278 | 3300049575 | Bacteria | 10760 |
| 603 | Ga0501039_0042605 | 3300049575 | Bacteria | 3506 |
| 604 | Ga0501039_0121282 | 3300049575 | Bacteria | 2049 |
| 605 | Ga0501039_0232231 | 3300049575 | Bacteria | 1450 |
| 606 | Ga0501040_0001660 | 3300049576 | Bacteria | 14230 |
| 607 | Ga0501040_0051785 | 3300049576 | Bacteria | 2808 |
| 608 | Ga0501041_0000828 | 3300049577 | Bacteria | 16596 |
| 609 | Ga0501041_0030739 | 3300049577 | Bacteria | 3242 |
| 610 | Ga0501042_0001513 | 3300049578 | Bacteria | 13741 |
| 611 | Ga0501042_0002947 | 3300049578 | Bacteria | 10571 |
| 612 | Ga0501043_0167152 | 3300049579 | Bacteria | 1717 |
| 613 | Ga0501046_0003106 | 3300049580 | Bacteria | 15320 |
| 614 | Ga0501046_0041342 | 3300049580 | Bacteria | 3680 |
| 615 | Ga0501047_0049964 | 3300049581 | Bacteria | 4038 |
| 616 | Ga0501047_0050187 | 3300049581 | Bacteria | 4029 |
| 617 | Ga0501048_0000542 | 3300049582 | Bacteria | 26560 |
| 618 | Ga0501048_0086261 | 3300049582 | Bacteria | 2214 |
| 619 | Ga0501067_0028924 | 3300049583 | Bacteria | 3072 |
| 620 | Ga0501067_0040638 | 3300049583 | Bacteria | 2582 |
| 621 | Ga0501067_0120199 | 3300049583 | Bacteria | 1461 |
| 622 | Ga0501068_0021796 | 3300049584 | Bacteria | 3744 |
| 623 | Ga0501068_0037759 | 3300049584 | Bacteria | 2891 |
| 624 | Ga0501068_0213747 | 3300049584 | Bacteria | 1225 |
| 625 | Ga0501069_0012859 | 3300049585 | Bacteria | 4457 |
| 626 | Ga0501069_0047259 | 3300049585 | Bacteria | 2389 |
| 627 | Ga0501069_0048082 | 3300049585 | Bacteria | 2368 |
| 628 | Ga0501070_0004260 | 3300049586 | Bacteria | 12299 |
| 629 | Ga0501070_0008299 | 3300049586 | Bacteria | 8778 |
| 630 | Ga0501070_0009383 | 3300049586 | Bacteria | 8273 |
| 631 | Ga0501070_0027484 | 3300049586 | Bacteria | 4772 |
| 632 | Ga0501071_0019748 | 3300049587 | Bacteria | 4677 |
| 633 | Ga0501071_0027918 | 3300049587 | Bacteria | 3973 |
| 634 | Ga0501071_0035337 | 3300049587 | Bacteria | 3559 |
| 635 | Ga0501071_0126003 | 3300049587 | Bacteria | 1901 |
| 636 | Ga0501071_0203845 | 3300049587 | Bacteria | 1486 |
| 637 | Ga0501071_0217488 | 3300049587 | Bacteria | 1437 |
| 638 | Ga0501072_0001031 | 3300049588 | Bacteria | 20648 |
| 639 | Ga0501072_0001639 | 3300049588 | Bacteria | 16736 |
| 640 | Ga0501072_0009973 | 3300049588 | Bacteria | 7224 |
| 641 | Ga0501072_0088898 | 3300049588 | Bacteria | 2451 |
| 642 | Ga0501072_0099201 | 3300049588 | Bacteria | 2315 |
| 643 | Ga0501073_0035243 | 3300049589 | Bacteria | 3558 |
| 644 | Ga0501073_0060072 | 3300049589 | Bacteria | 2653 |
| 645 | Ga0501074_0000631 | 3300049590 | Bacteria | 21842 |
| 646 | Ga0501074_0008110 | 3300049590 | Bacteria | 7611 |
| 647 | Ga0501074_0059123 | 3300049590 | Bacteria | 2762 |
| 648 | Ga0501075_0003045 | 3300049591 | Bacteria | 11199 |
| 649 | Ga0501075_0003746 | 3300049591 | Bacteria | 10213 |
| 650 | Ga0501075_0019318 | 3300049591 | Bacteria | 4940 |
| 651 | Ga0501076_0002847 | 3300049592 | Bacteria | 11972 |
| 652 | Ga0501076_0018038 | 3300049592 | Bacteria | 5371 |
| 653 | Ga0501076_0126151 | 3300049592 | Bacteria | 2074 |
| 654 | Ga0501076_0212384 | 3300049592 | Bacteria | 1581 |
| 655 | Ga0501077_0001982 | 3300049593 | Bacteria | 12355 |
| 656 | Ga0501077_0003218 | 3300049593 | Bacteria | 9832 |
| 657 | Ga0501077_0144830 | 3300049593 | Bacteria | 1507 |
| 658 | Ga0501077_0243070 | 3300049593 | Bacteria | 1144 |
| 659 | Ga0501079_0005924 | 3300049741 | Bacteria | 9156 |
| 660 | Ga0501079_0023099 | 3300049741 | Bacteria | 4774 |
| 661 | Ga0501079_0060051 | 3300049741 | Bacteria | 2933 |
| 662 | Ga0501079_0107504 | 3300049741 | Bacteria | 2165 |
| 663 | Ga0501079_0302911 | 3300049741 | Bacteria | 1251 |
| 664 | Ga0501080_0003171 | 3300049742 | Bacteria | 14495 |
| 665 | Ga0501080_0018327 | 3300049742 | Bacteria | 6479 |
| 666 | Ga0501080_0036379 | 3300049742 | Bacteria | 4595 |
| 667 | Ga0501080_0137937 | 3300049742 | Bacteria | 2256 |
| 668 | Ga0501080_0251257 | 3300049742 | Bacteria | 1612 |
| 669 | Ga0501081_0001818 | 3300049743 | Bacteria | 13220 |
| 670 | Ga0501081_0004537 | 3300049743 | Bacteria | 8916 |
| 671 | Ga0501081_0023167 | 3300049743 | Bacteria | 4161 |
| 672 | Ga0501083_0052449 | 3300049744 | Bacteria | 2740 |
| 673 | Ga0501035_0116207 | 3300049822 | Bacteria | 2341 |
| 674 | Ga0501035_0181803 | 3300049822 | Bacteria | 1811 |
| 675 | Ga0501044_0047740 | 3300049823 | Bacteria | 4428 |
| 676 | Ga0501044_0163786 | 3300049823 | Bacteria | 2199 |
| 677 | Ga0501045_0006905 | 3300049824 | Bacteria | 7870 |
| 678 | Ga0501045_0011126 | 3300049824 | Bacteria | 6305 |
| 679 | Ga0501045_0016794 | 3300049824 | Bacteria | 5199 |
| 680 | Ga0501045_0067491 | 3300049824 | Bacteria | 2627 |
| 681 | Ga0501045_0243881 | 3300049824 | Bacteria | 1337 |
| 682 | nmdc:mga03n38_78507_c1 | 3300050490 | Bacteria | 1545 |
| 683 | nmdc:mga05p37_28454_c1 | 3300050507 | Bacteria | 6814 |
| 684 | nmdc:mga05p37_705612_c1 | 3300050507 | Bacteria | 1120 |
| 685 | nmdc:mga08y16_136912_c1 | 3300050511 | Bacteria | 2545 |
| 686 | nmdc:mga08y16_49960_c1 | 3300050511 | Bacteria | 4376 |
| 687 | nmdc:mga0n895_116845_c1 | 3300050512 | Bacteria | 2686 |
| 688 | nmdc:mga0n895_122716_c1 | 3300050512 | Bacteria | 2620 |
| 689 | nmdc:mga0n895_28470_c1 | 3300050512 | Bacteria | 5314 |
| 690 | nmdc:mga0rr50_41123_c1 | 3300050513 | Bacteria | 3366 |
| 691 | nmdc:mga0rr50_82614_c1 | 3300050513 | Bacteria | 2482 |
| 692 | nmdc:mga08x19_141327_c1 | 3300050514 | Bacteria | 1626 |
| 693 | nmdc:mga0a205_47813_c1 | 3300050515 | Bacteria | 4129 |
| 694 | Ga0495601_0000101 | 3300053077 | Bacteria | 47661 |
| 695 | Ga0495601_0023366 | 3300053077 | Bacteria | 3798 |
| 696 | Ga0495601_0033107 | 3300053077 | Bacteria | 3219 |
| 697 | Ga0495601_0046549 | 3300053077 | Bacteria | 2730 |
| 698 | Ga0495601_0071776 | 3300053077 | Bacteria | 2211 |
| 699 | Ga0495612_0051751 | 3300053078 | Bacteria | 1688 |
| 700 | Ga0495595_0027693 | 3300053084 | Bacteria | 2526 |
| 701 | Ga0495619_0000235 | 3300053085 | Bacteria | 40323 |
| 702 | Ga0495619_0001903 | 3300053085 | Bacteria | 13907 |
| 703 | Ga0495619_0014867 | 3300053085 | Bacteria | 4916 |
| 704 | Ga0495619_0020786 | 3300053085 | Bacteria | 4186 |
| 705 | Ga0495619_0038976 | 3300053085 | Bacteria | 3102 |
| 706 | Ga0495619_0062800 | 3300053085 | Bacteria | 2473 |
| 707 | Ga0495619_0076823 | 3300053085 | Bacteria | 2242 |
| 708 | Ga0495619_0082557 | 3300053085 | Bacteria | 2166 |
| 709 | Ga0501084_0009898 | 3300054114 | Bacteria | 7879 |
| 710 | Ga0501084_0049243 | 3300054114 | Bacteria | 3527 |
| 711 | Ga0501084_0054566 | 3300054114 | Bacteria | 3343 |
| 712 | Ga0501084_0075212 | 3300054114 | Bacteria | 2829 |
| 713 | Ga0501084_0176818 | 3300054114 | Bacteria | 1801 |
| 714 | Ga0501082_0017062 | 3300060353 | Bacteria | 6254 |
| 715 | Ga0501082_0023829 | 3300060353 | Bacteria | 5277 |
| 716 | Ga0501082_0047727 | 3300060353 | Bacteria | 3690 |
| 717 | Ga0501082_0074426 | 3300060353 | Bacteria | 2925 |
| 718 | Ga0501082_0184023 | 3300060353 | Bacteria | 1817 |
| 719 | Ga0501082_0315120 | 3300060353 | Bacteria | 1362 |
| 720 | Ga0466962_0011206 | 3300061719 | Bacteria | 4317 |
| 721 | Ga0466962_0020097 | 3300061719 | Bacteria | 3209 |
| 722 | Ga0466962_0028520 | 3300061719 | Bacteria | 2674 |
| 723 | Ga0530510_0001724 | 3300061734 | Bacteria | 14863 |
| 724 | Ga0530510_0002879 | 3300061734 | Bacteria | 11818 |
| 725 | Ga0530510_0009891 | 3300061734 | Bacteria | 6692 |
| 726 | Ga0530510_0025027 | 3300061734 | Bacteria | 4267 |
| 727 | Ga0530510_0256253 | 3300061734 | Bacteria | 1304 |
| 728 | Ga0530510_0359200 | 3300061734 | Bacteria | 1095 |
| 729 | Ga0466958_0011049 | |||
| 730 | JGI25407J50210_10018035 | |||
| 731 | Ga0070658_10007689 | |||
| 732 | Ga0070658_10013409 | |||
| 733 | Ga0070658_10042251 | |||
| 734 | Ga0070658_10080437 | |||
| 735 | Ga0070658_10207738 | |||
| 736 | Ga0070683_100006231 | |||
| 737 | Ga0070680_100002965 | |||
| 738 | Ga0070680_100052761 | |||
| 739 | Ga0070680_100082986 | |||
| 740 | Ga0070682_100016550 | |||
| 741 | Ga0070660_100001406 | |||
| 742 | Ga0070660_100007008 | |||
| 743 | Ga0070660_100009642 | |||
| 744 | Ga0070660_100027063 | |||
| 745 | Ga0070660_100039348 | |||
| 746 | Ga0070660_100313841 | |||
| 747 | Ga0070661_100005203 | |||
| 748 | Ga0070661_100084952 | |||
| 749 | Ga0070671_100360681 | |||
| 750 | Ga0070667_100184539 | |||
| 751 | Ga0070709_10034067 | |||
| 752 | Ga0070714_100008279 | |||
| 753 | Ga0070714_100030493 | |||
| 754 | Ga0070713_100030257 | |||
| 755 | Ga0070713_100077580 | |||
| 756 | Ga0070710_10139696 | |||
| 757 | Ga0070711_100128960 | |||
| 758 | Ga0070700_100199087 | |||
| 759 | Ga0070708_100268755 | |||
| 760 | Ga0070678_100123885 | |||
| 761 | Ga0070681_10004535 | |||
| 762 | Ga0070681_10007722 | |||
| 763 | Ga0070681_10049708 | |||
| 764 | Ga0070681_10072047 | |||
| 765 | Ga0070681_10119255 | |||
| 766 | Ga0070681_10151071 | |||
| 767 | Ga0070706_100075099 | |||
| 768 | Ga0070707_100127307 | |||
| 769 | Ga0070707_100136216 | |||
| 770 | Ga0070707_100245467 | |||
| 771 | Ga0070698_100068103 | |||
| 772 | Ga0070698_100154850 | |||
| 773 | Ga0070698_100251549 | |||
| 774 | Ga0070698_100285514 | |||
| 775 | Ga0070679_100002527 | |||
| 776 | Ga0070679_100049305 | |||
| 777 | Ga0070679_100050852 | |||
| 778 | Ga0070679_100083069 | |||
| 779 | Ga0070679_100088755 | |||
| 780 | Ga0070679_100119300 | |||
| 781 | Ga0070684_100001220 | |||
| 782 | Ga0070684_100052240 | |||
| 783 | Ga0070684_100177347 | |||
| 784 | Ga0070672_100184256 | |||
| 785 | Ga0070695_100000523 | |||
| 786 | Ga0070704_100238959 | |||
| 787 | Ga0068855_100006830 | |||
| 788 | Ga0068855_100008162 | |||
| 789 | Ga0068855_100096520 | |||
| 790 | Ga0068855_100199760 | |||
| 791 | Ga0068855_100227387 | |||
| 792 | Ga0068857_100120340 | |||
| 793 | Ga0068857_100379300 | |||
| 794 | Ga0068856_100213124 | |||
| 795 | Ga0081455_10009231 | |||
| 796 | Ga0081455_10035388 | |||
| 797 | Ga0081455_10077751 | |||
| 798 | Ga0081538_10001387 | |||
| 799 | Ga0081538_10002772 | |||
| 800 | Ga0081538_10021267 | |||
| 801 | Ga0081540_1025693 | |||
| 802 | Ga0081539_10000363 | |||
| 803 | Ga0081539_10004020 | |||
| 804 | Ga0081539_10034906 | |||
| 805 | Ga0070717_10013843 | |||
| 806 | Ga0070717_10014834 | |||
| 807 | Ga0070717_10021296 | |||
| 808 | Ga0070717_10022330 | |||
| 809 | Ga0070717_10040148 | |||
| 810 | Ga0070717_10227893 | |||
| 811 | Ga0075365_10001885 | |||
| 812 | Ga0070715_10015217 | |||
| 813 | Ga0070716_100018341 | |||
| 814 | Ga0070712_100007705 | |||
| 815 | Ga0070712_100320253 | |||
| 816 | Ga0075431_100264568 | |||
| 817 | Ga0075431_100391268 | |||
| 818 | Ga0075433_10106529 | |||
| 819 | Ga0075434_100045954 | |||
| 820 | Ga0075435_100056779 | |||
| 821 | Ga0075435_100116197 | |||
| 822 | Ga0105240_10047915 | |||
| 823 | Ga0105240_10071608 | |||
| 824 | Ga0105240_10174177 | |||
| 825 | Ga0111539_10231466 | |||
| 826 | Ga0111539_10272509 | |||
| 827 | Ga0111539_10499941 | |||
| 828 | Ga0114129_10003327 | |||
| 829 | Ga0114129_10125486 | |||
| 830 | Ga0114129_10813930 | |||
| 831 | Ga0105242_10118680 | |||
| 832 | Ga0105248_10097248 | |||
| 833 | Ga0105237_10015062 | |||
| 834 | Ga0105238_10344305 | |||
| 835 | Ga0157370_10017228 | |||
| 836 | Ga0157370_10026911 | |||
| 837 | Ga0157370_10035895 | |||
| 838 | Ga0157370_10078696 | |||
| 839 | Ga0157370_10101032 | |||
| 840 | Ga0157369_10016730 | |||
| 841 | Ga0157369_10022561 | |||
| 842 | Ga0157369_10027914 | |||
| 843 | Ga0157369_10032906 | |||
| 844 | Ga0157369_10033935 | |||
| 845 | Ga0157369_10056062 | |||
| 846 | Ga0157374_10093193 | |||
| 847 | Ga0157374_10325773 | |||
| 848 | Ga0157372_10015478 | |||
| 849 | Ga0157375_10042331 | |||
| 850 | Ga0182008_10003086 | |||
| 851 | Ga0157379_10142190 | |||
| 852 | Ga0182006_1008684 | |||
| 853 | Ga0197907_10553097 | |||
| 854 | Ga0197907_10959694 | |||
| 855 | Ga0206356_10339530 | |||
| 856 | Ga0206356_10731890 | |||
| 857 | Ga0206356_10833043 | |||
| 858 | Ga0206354_10694068 | |||
| 859 | Ga0206354_11254550 | |||
| 860 | Ga0206353_10332968 | |||
| 861 | Ga0206353_10594941 | |||
| 862 | Ga0206353_11926521 | |||
| 863 | Ga0213871_10028995 | |||
| 864 | Ga0224712_10023780 | |||
| 865 | Ga0207699_10181356 | |||
| 866 | Ga0207699_10188883 | |||
| 867 | Ga0207705_10010429 | |||
| 868 | Ga0207705_10011584 | |||
| 869 | Ga0207705_10055179 | |||
| 870 | Ga0207705_10059091 | |||
| 871 | Ga0207705_10127433 | |||
| 872 | Ga0207705_10230544 | |||
| 873 | Ga0207684_10046425 | |||
| 874 | Ga0207707_10020828 | |||
| 875 | Ga0207707_10031096 | |||
| 876 | Ga0207707_10036735 | |||
| 877 | Ga0207707_10051691 | |||
| 878 | Ga0207707_10129501 | |||
| 879 | Ga0207695_10018456 | |||
| 880 | Ga0207695_10288440 | |||
| 881 | Ga0207693_10003301 | |||
| 882 | Ga0207693_10020537 | |||
| 883 | Ga0207693_10228461 | |||
| 884 | Ga0207663_10038991 | |||
| 885 | Ga0207660_10005633 | |||
| 886 | Ga0207657_10000397 | |||
| 887 | Ga0207657_10012919 | |||
| 888 | Ga0207657_10020516 | |||
| 889 | Ga0207657_10049893 | |||
| 890 | Ga0207657_10057049 | |||
| 891 | Ga0207657_10185384 | |||
| 892 | Ga0207649_10010018 | |||
| 893 | Ga0207649_10044164 | |||
| 894 | Ga0207649_10101071 | |||
| 895 | Ga0207652_10016307 | |||
| 896 | Ga0207652_10100066 | |||
| 897 | Ga0207652_10105562 | |||
| 898 | Ga0207646_10000149 | |||
| 899 | Ga0207646_10074675 | |||
| 900 | Ga0207646_10126983 | |||
| 901 | Ga0207694_10011242 | |||
| 902 | Ga0207694_10041047 | |||
| 903 | Ga0207694_10310124 | |||
| 904 | Ga0207687_10045549 | |||
| 905 | Ga0207700_10000004 | |||
| 906 | Ga0207700_10131998 | |||
| 907 | Ga0207664_10003350 | |||
| 908 | Ga0207664_10046369 | |||
| 909 | Ga0207664_10063835 | |||
| 910 | Ga0207690_10110439 | |||
| 911 | Ga0207686_10093958 | |||
| 912 | Ga0207665_10005604 | |||
| 913 | Ga0207691_10143036 | |||
| 914 | Ga0207661_10008939 | |||
| 915 | Ga0207661_10009294 | |||
| 916 | Ga0207661_10045618 | |||
| 917 | Ga0207661_10272261 | |||
| 918 | Ga0207667_10011350 | |||
| 919 | Ga0207667_10015984 | |||
| 920 | Ga0207667_10118531 | |||
| 921 | Ga0207658_10062336 | |||
| 922 | Ga0207678_10262314 | |||
| 923 | Ga0207708_10310556 | |||
| 924 | Ga0207674_10063065 | |||
| 925 | Ga0207674_10394601 | |||
| 926 | Ga0207683_10233261 | |||
| 927 | Ga0207698_10044833 | |||
| 928 | Ga0268266_10262087 | |||
| 929 | Ga0265337_1025549 | |||
| 930 | Ga0265319_1000431 | |||
| 931 | Ga0265319_1023407 | |||
| 932 | Ga0265334_10005458 | |||
| 933 | Ga0265334_10010540 | |||
| 934 | Ga0265334_10019919 | |||
| 935 | Ga0265334_10033378 | |||
| 936 | Ga0265318_10001185 | |||
| 937 | Ga0265318_10002390 | |||
| 938 | Ga0265323_10006962 | |||
| 939 | Ga0265323_10031565 | |||
| 940 | Ga0265322_10001626 | |||
| 941 | Ga0265322_10006716 | |||
| 942 | Ga0265338_10002622 | |||
| 943 | Ga0265338_10007766 | |||
| 944 | Ga0265338_10009902 | |||
| 945 | Ga0265338_10016969 | |||
| 946 | Ga0265338_10024447 | |||
| 947 | Ga0265338_10032702 | |||
| 948 | Ga0265338_10144910 | |||
| 949 | Ga0265324_10016115 | |||
| 950 | Ga0265324_10045962 | |||
| 951 | Ga0265330_10000883 | |||
| 952 | Ga0265332_10059673 | |||
| 953 | Ga0265328_10002844 | |||
| 954 | Ga0265328_10043214 | |||
| 955 | Ga0265320_10033179 | |||
| 956 | Ga0265320_10056266 | |||
| 957 | Ga0265325_10004991 | |||
| 958 | Ga0265329_10023454 | |||
| 959 | Ga0265339_10017629 | |||
| 960 | Ga0265339_10036750 | |||
| 961 | Ga0265339_10053262 | |||
| 962 | Ga0265331_10010004 | |||
| 963 | Ga0265331_10020900 | |||
| 964 | Ga0265327_10006964 | |||
| 965 | Ga0265327_10029296 | |||
| 966 | Ga0265316_10011096 | |||
| 967 | Ga0265316_10011765 | |||
| 968 | Ga0265316_10040833 | |||
| 969 | Ga0265313_10007900 | |||
| 970 | Ga0265313_10020198 | |||
| 971 | Ga0265313_10023831 | |||
| 972 | Ga0265313_10056813 | |||
| 973 | Ga0265314_10005549 | |||
| 974 | Ga0265314_10012186 | |||
| 975 | Ga0265314_10013264 | |||
| 976 | Ga0265314_10019953 | |||
| 977 | Ga0265314_10162396 | |||
| 978 | Ga0265342_10025478 | |||
| 979 | Ga0265342_10027315 | |||
| 980 | Ga0307405_10012074 | |||
| 981 | Ga0307406_10141511 | |||
| 982 | Ga0307416_100115114 | |||
| 983 | Ga0307414_10100235 | |||
| 984 | Ga0307411_10126551 | |||
| 985 | Ga0307415_100118963 | |||
| 986 | Ga0373944_0013612 | |||
| 987 | Ga0373945_0011842 | |||
| 988 | Ga0373956_0053987 | |||
| 989 | Ga0373943_0051076 | |||
| 990 | Ga0373946_0086542 | |||
| 991 | Ga0373955_0065460 | |||
| 992 | Ga0373935_0050969 | |||
| 993 | Ga0373933_0041737 | |||
| 994 | Ga0373947_0001423 | |||
| 995 | Ga0373937_0001607 | |||
| 996 | Ga0373937_0031621 | |||
| 997 | Ga0373925_0000937 | |||
| 998 | Ga0373925_0026889 | |||
| 999 | Ga0373925_0215341 | |||
| 1000 | Ga0373925_0368818 | |||
| 1001 | Ga0395899_0003146 | |||
| 1002 | Ga0395899_0008109 | |||
| 1003 | Ga0395899_0023971 | |||
| 1004 | Ga0395899_0032725 | |||
| 1005 | Ga0395899_0035879 | |||
| 1006 | Ga0395899_0058748 | |||
| 1007 | Ga0395899_0058896 | |||
| 1008 | Ga0395899_0090536 | |||
| 1009 | Ga0395899_0093795 | |||
| 1010 | Ga0395900_0001650 | |||
| 1011 | Ga0395900_0011838 | |||
| 1012 | Ga0395900_0013401 | |||
| 1013 | Ga0395900_0014506 | |||
| 1014 | Ga0395900_0014600 | |||
| 1015 | Ga0395900_0017415 | |||
| 1016 | Ga0395900_0023124 | |||
| 1017 | Ga0395900_0028224 | |||
| 1018 | Ga0395900_0028823 | |||
| 1019 | Ga0395900_0035682 | |||
| 1020 | Ga0395900_0043702 | |||
| 1021 | Ga0395900_0055941 | |||
| 1022 | Ga0395900_0080057 | |||
| 1023 | Ga0395900_0123003 | |||
| 1024 | Ga0395900_0198691 | |||
| 1025 | Ga0395900_0288524 | |||
| 1026 | Ga0395898_0003199 | |||
| 1027 | Ga0395898_0003920 | |||
| 1028 | Ga0395898_0004513 | |||
| 1029 | Ga0395898_0017628 | |||
| 1030 | Ga0395898_0033886 | |||
| 1031 | Ga0395898_0038341 | |||
| 1032 | Ga0395898_0063672 | |||
| 1033 | Ga0395898_0101394 | |||
| 1034 | Ga0395898_0105135 | |||
| 1035 | Ga0395898_0211022 | |||
| 1036 | Ga0395905_0005878 | |||
| 1037 | Ga0395905_0015302 | |||
| 1038 | Ga0395905_0018302 | |||
| 1039 | Ga0395905_0024516 | |||
| 1040 | Ga0395905_0025607 | |||
| 1041 | Ga0395905_0040690 | |||
| 1042 | Ga0395905_0066983 | |||
| 1043 | Ga0395905_0107317 | |||
| 1044 | Ga0395905_0179675 | |||
| 1045 | Ga0395905_0225359 | |||
| 1046 | Ga0395905_0271592 | |||
| 1047 | Ga0395905_0448171 | |||
| 1048 | Ga0395901_0001109 | |||
| 1049 | Ga0395901_0001415 | |||
| 1050 | Ga0395901_0003315 | |||
| 1051 | Ga0395901_0006987 | |||
| 1052 | Ga0395901_0011644 | |||
| 1053 | Ga0395901_0011863 | |||
| 1054 | Ga0395901_0017655 | |||
| 1055 | Ga0395901_0022326 | |||
| 1056 | Ga0395901_0032209 | |||
| 1057 | Ga0395901_0035300 | |||
| 1058 | Ga0395901_0045563 | |||
| 1059 | Ga0395901_0113112 | |||
| 1060 | Ga0395901_0128672 | |||
| 1061 | Ga0395901_0156638 | |||
| 1062 | Ga0395901_0506882 | |||
| 1063 | Ga0436360_0905733 | |||
| 1064 | Ga0451797_0707371 | |||
| 1065 | Ga0451839_0968295 | |||
| 1066 | Ga0451847_0641130 | |||
| 1067 | Ga0451849_1223099 | |||
| 1068 | Ga0439431_0001608 | |||
| 1069 | Ga0439442_006856 | |||
| 1070 | Ga0439451_001811 | |||
| 1071 | Ga0439454_000463 | |||
| 1072 | Ga0439462_0008036 | |||
| 1073 | Ga0439446_0001720 | |||
| 1074 | Ga0439446_0002494 | |||
| 1075 | Ga0439434_0007533 | |||
| 1076 | Ga0466969_0009470 | |||
| 1077 | Ga0466965_0030776 | |||
| 1078 | Ga0466966_0003226 | |||
| 1079 | Ga0466966_0030929 | |||
| 1080 | Ga0466966_0086862 | |||
| 1081 | Ga0466961_0018936 | |||
| 1082 | Ga0466961_0049490 | |||
| 1083 | Ga0466961_0096658 | |||
| 1084 | Ga0466963_0000081 | |||
| 1085 | Ga0466963_0000205 | |||
| 1086 | Ga0466963_0001379 | |||
| 1087 | Ga0466963_0001591 | |||
| 1088 | Ga0466963_0004538 | |||
| 1089 | Ga0466963_0005886 | |||
| 1090 | Ga0466963_0018010 | |||
| 1091 | Ga0466963_0025761 | |||
| 1092 | Ga0466963_0027451 | |||
| 1093 | Ga0466963_0041099 | |||
| 1094 | Ga0466963_0079646 | |||
| 1095 | Ga0466963_0085424 | |||
| 1096 | Ga0466963_0153019 | |||
| 1097 | Ga0466964_0000776 | |||
| 1098 | Ga0466964_0002319 | |||
| 1099 | Ga0466964_0004317 | |||
| 1100 | Ga0466964_0040879 | |||
| 1101 | Ga0466971_0000381 | |||
| 1102 | Ga0466971_0008589 | |||
| 1103 | Ga0466968_0011582 | |||
| 1104 | Ga0466968_0022463 | |||
| 1105 | Ga0466968_0073675 | |||
| 1106 | Ga0466968_0101113 | |||
| 1107 | Ga0466957_0003329 | |||
| 1108 | Ga0466957_0041323 | |||
| 1109 | Ga0466957_0045670 | |||
| 1110 | Ga0466960_0005225 | |||
| 1111 | Ga0466960_0018744 | |||
| 1112 | Ga0466959_0006265 | |||
| 1113 | Ga0466959_0020299 | |||
| 1114 | Ga0466959_0105453 | |||
| 1115 | Ga0466959_0169696 | |||
| 1116 | Ga0451576_0072860 | |||
| 1117 | Ga0466958_0009888 | |||
| 1118 | Ga0466958_0016769 | |||
| 1119 | Ga0466958_0040401 | |||
| 1120 | Ga0466958_0132631 | |||
| 1121 | Ga0466967_0000577 | |||
| 1122 | Ga0466967_0005190 | |||
| 1123 | Ga0466967_0013499 | |||
| 1124 | Ga0466967_0017100 | |||
| 1125 | Ga0466967_0021530 | |||
| 1126 | Ga0466967_0022511 | |||
| 1127 | Ga0466967_0040428 | |||
| 1128 | Ga0466967_0042369 | |||
| 1129 | Ga0466967_0045629 | |||
| 1130 | Ga0466967_0046176 | |||
| 1131 | Ga0466967_0046347 | |||
| 1132 | Ga0466967_0064101 | |||
| 1133 | Ga0466967_0067766 | |||
| 1134 | Ga0466967_0073132 | |||
| 1135 | Ga0466967_0101318 | |||
| 1136 | Ga0466967_0123891 | |||
| 1137 | Ga0466967_0196850 | |||
| 1138 | Ga0466967_0243103 | |||
| 1139 | Ga0466967_0281271 | |||
| 1140 | Ga0466967_0329904 | |||
| 1141 | Ga0495592_0000048 | |||
| 1142 | Ga0495603_0008192 | |||
| 1143 | Ga0495629_0001775 | |||
| 1144 | Ga0495629_0095647 | |||
| 1145 | Ga0495641_0001166 | |||
| 1146 | Ga0495641_0029476 | |||
| 1147 | Ga0495641_0033022 | |||
| 1148 | Ga0495651_0000276 | |||
| 1149 | Ga0495651_0001012 | |||
| 1150 | Ga0495651_0026947 | |||
| 1151 | Ga0495651_0082018 | |||
| 1152 | Ga0495653_0002971 | |||
| 1153 | Ga0495653_0010213 | |||
| 1154 | Ga0495653_0041275 | |||
| 1155 | Ga0495653_0041550 | |||
| 1156 | Ga0495653_0046090 | |||
| 1157 | Ga0495582_0000476 | |||
| 1158 | Ga0495639_0003394 | |||
| 1159 | Ga0495662_0002104 | |||
| 1160 | Ga0495662_0082208 | |||
| 1161 | Ga0495664_0022031 | |||
| 1162 | Ga0495664_0044924 | |||
| 1163 | Ga0495608_0044375 | |||
| 1164 | Ga0495608_0048227 | |||
| 1165 | Ga0495618_0007437 | |||
| 1166 | Ga0495618_0017828 | |||
| 1167 | Ga0495628_0000026 | |||
| 1168 | Ga0495628_0035138 | |||
| 1169 | Ga0495628_0104176 | |||
| 1170 | Ga0495630_0019207 | |||
| 1171 | Ga0495630_0161830 | |||
| 1172 | Ga0495644_0001935 | |||
| 1173 | Ga0495644_0065073 | |||
| 1174 | Ga0495666_0031133 | |||
| 1175 | Ga0495652_0001333 | |||
| 1176 | Ga0495652_0034698 | |||
| 1177 | Ga0495652_0072827 | |||
| 1178 | Ga0495652_0108856 | |||
| 1179 | Ga0495665_0001189 | |||
| 1180 | Ga0495665_0094806 | |||
| 1181 | Ga0495640_0082518 | |||
| 1182 | Ga0495640_0098390 | |||
| 1183 | Ga0495640_0141289 | |||
| 1184 | Ga0495640_0181414 | |||
| 1185 | Ga0495586_0015445 | |||
| 1186 | Ga0495587_0000080 | |||
| 1187 | Ga0495587_0022930 | |||
| 1188 | Ga0495645_0000016 | |||
| 1189 | Ga0495645_0022823 | |||
| 1190 | Ga0495645_0039892 | |||
| 1191 | Ga0495645_0146125 | |||
| 1192 | Ga0495645_0186227 | |||
| 1193 | Ga0495667_0002615 | |||
| 1194 | Ga0495667_0003931 | |||
| 1195 | Ga0495667_0013954 | |||
| 1196 | Ga0495667_0059328 | |||
| 1197 | Ga0495667_0103592 | |||
| 1198 | Ga0495656_0014083 | |||
| 1199 | Ga0495634_0090378 | |||
| 1200 | Ga0495635_0054874 | |||
| 1201 | Ga0495635_0075671 | |||
| 1202 | Ga0495635_0100044 | |||
| 1203 | Ga0495657_0003925 | |||
| 1204 | Ga0495657_0011872 | |||
| 1205 | Ga0495657_0066480 | |||
| 1206 | Ga0495657_0149893 | |||
| 1207 | Ga0495599_0000016 | |||
| 1208 | Ga0495599_0024318 | |||
| 1209 | Ga0495599_0071639 | |||
| 1210 | Ga0495623_0000385 | |||
| 1211 | Ga0495623_0020335 | |||
| 1212 | Ga0495623_0075522 | |||
| 1213 | Ga0495646_0000472 | |||
| 1214 | Ga0495646_0045298 | |||
| 1215 | Ga0495646_0050214 | |||
| 1216 | Ga0495647_0005421 | |||
| 1217 | Ga0495658_0004076 | |||
| 1218 | Ga0495658_0023607 | |||
| 1219 | Ga0495613_0002526 | |||
| 1220 | Ga0495613_0016591 | |||
| 1221 | Ga0495624_0079438 | |||
| 1222 | Ga0495589_0029426 | |||
| 1223 | Ga0495600_0005580 | |||
| 1224 | Ga0495600_0019762 | |||
| 1225 | Ga0495600_0048595 | |||
| 1226 | Ga0495600_0087142 | |||
| 1227 | Ga0495600_0125537 | |||
| 1228 | Ga0495581_0000403 | |||
| 1229 | Ga0495604_0000004 | |||
| 1230 | Ga0495604_0040336 | |||
| 1231 | Ga0495604_0040491 | |||
| 1232 | Ga0495604_0074049 | |||
| 1233 | Ga0495636_0068590 | |||
| 1234 | Ga0495674_0015212 | |||
| 1235 | Ga0495674_0015273 | |||
| 1236 | Ga0495674_0059705 | |||
| 1237 | Ga0495674_0069086 | |||
| 1238 | Ga0495674_0294105 | |||
| 1239 | Ga0495680_0004050 | |||
| 1240 | Ga0495680_0006021 | |||
| 1241 | Ga0495680_0007620 | |||
| 1242 | Ga0495680_0024898 | |||
| 1243 | Ga0495680_0027388 | |||
| 1244 | Ga0495680_0081914 | |||
| 1245 | Ga0495680_0086669 | |||
| 1246 | Ga0495680_0134119 | |||
| 1247 | Ga0495675_0000033 | |||
| 1248 | Ga0495675_0191207 | |||
| 1249 | Ga0495684_0005124 | |||
| 1250 | Ga0495684_0006551 | |||
| 1251 | Ga0495684_0009586 | |||
| 1252 | Ga0495684_0206465 | |||
| 1253 | Ga0495593_0019262 | |||
| 1254 | Ga0495602_0000036 | |||
| 1255 | Ga0495602_0055723 | |||
| 1256 | Ga0495602_0061488 | |||
| 1257 | Ga0495614_0015782 | |||
| 1258 | Ga0496100_0002064 | |||
| 1259 | Ga0496100_0019468 | |||
| 1260 | Ga0496100_0021678 | |||
| 1261 | Ga0496100_0048585 | |||
| 1262 | Ga0496100_0222465 | |||
| 1263 | Ga0496101_0002824 | |||
| 1264 | Ga0496101_0004739 | |||
| 1265 | Ga0496101_0046568 | |||
| 1266 | Ga0496102_0027053 | |||
| 1267 | Ga0496103_0013530 | |||
| 1268 | Ga0496103_0059315 | |||
| 1269 | Ga0496104_0017338 | |||
| 1270 | Ga0496104_0044090 | |||
| 1271 | Ga0496104_0068084 | |||
| 1272 | Ga0496104_0136242 | |||
| 1273 | Ga0496104_0234161 | |||
| 1274 | Ga0496104_0245132 | |||
| 1275 | Ga0496105_0085250 | |||
| 1276 | Ga0496105_0183740 | |||
| 1277 | Ga0496105_0183835 | |||
| 1278 | Ga0496105_0184108 | |||
| 1279 | Ga0496106_0000377 | |||
| 1280 | Ga0496106_0003866 | |||
| 1281 | Ga0496106_0024495 | |||
| 1282 | Ga0496106_0084243 | |||
| 1283 | Ga0496106_0236022 | |||
| 1284 | Ga0496107_0001149 | |||
| 1285 | Ga0496107_0016875 | |||
| 1286 | Ga0496107_0051131 | |||
| 1287 | Ga0496107_0247817 | |||
| 1288 | Ga0496108_0076387 | |||
| 1289 | Ga0496108_0374266 | |||
| 1290 | Ga0496109_0000875 | |||
| 1291 | Ga0496109_0098583 | |||
| 1292 | Ga0496109_0203286 | |||
| 1293 | Ga0496110_0020073 | |||
| 1294 | Ga0496110_0060311 | |||
| 1295 | Ga0496110_0082620 | |||
| 1296 | Ga0496110_0442666 | |||
| 1297 | Ga0496111_0002365 | |||
| 1298 | Ga0496111_0046669 | |||
| 1299 | Ga0496111_0240054 | |||
| 1300 | Ga0496112_0004337 | |||
| 1301 | Ga0496112_0016789 | |||
| 1302 | Ga0496112_0044766 | |||
| 1303 | Ga0496112_0132399 | |||
| 1304 | Ga0496112_0151358 | |||
| 1305 | Ga0496112_0299694 | |||
| 1306 | Ga0496113_0000570 | |||
| 1307 | Ga0496113_0019703 | |||
| 1308 | Ga0496113_0231084 | |||
| 1309 | Ga0496113_0347271 | |||
| 1310 | Ga0496114_0015496 | |||
| 1311 | Ga0496114_0015865 | |||
| 1312 | Ga0496114_0035357 | |||
| 1313 | Ga0496114_0060683 | |||
| 1314 | Ga0496114_0074887 | |||
| 1315 | Ga0496114_0202105 | |||
| 1316 | Ga0496115_0015705 | |||
| 1317 | Ga0496115_0085116 | |||
| 1318 | Ga0496115_0112034 | |||
| 1319 | Ga0496115_0140667 | |||
| 1320 | Ga0496115_0147599 | |||
| 1321 | Ga0501031_0081147 | |||
| 1322 | Ga0501032_0123081 | |||
| 1323 | Ga0501033_0015081 | |||
| 1324 | Ga0501033_0018239 | |||
| 1325 | Ga0501034_0012732 | |||
| 1326 | Ga0501036_0024148 | |||
| 1327 | Ga0501036_0051513 | |||
| 1328 | Ga0501036_0078815 | |||
| 1329 | Ga0501038_0016547 | |||
| 1330 | Ga0501039_0004278 | |||
| 1331 | Ga0501039_0042605 | |||
| 1332 | Ga0501039_0121282 | |||
| 1333 | Ga0501039_0232231 | |||
| 1334 | Ga0501040_0001660 | |||
| 1335 | Ga0501040_0051785 | |||
| 1336 | Ga0501041_0000828 | |||
| 1337 | Ga0501041_0030739 | |||
| 1338 | Ga0501042_0001513 | |||
| 1339 | Ga0501042_0002947 | |||
| 1340 | Ga0501043_0167152 | |||
| 1341 | Ga0501046_0003106 | |||
| 1342 | Ga0501046_0041342 | |||
| 1343 | Ga0501047_0049964 | |||
| 1344 | Ga0501047_0050187 | |||
| 1345 | Ga0501048_0000542 | |||
| 1346 | Ga0501048_0086261 | |||
| 1347 | Ga0501067_0028924 | |||
| 1348 | Ga0501067_0040638 | |||
| 1349 | Ga0501067_0120199 | |||
| 1350 | Ga0501068_0021796 | |||
| 1351 | Ga0501068_0037759 | |||
| 1352 | Ga0501068_0213747 | |||
| 1353 | Ga0501069_0012859 | |||
| 1354 | Ga0501069_0047259 | |||
| 1355 | Ga0501069_0048082 | |||
| 1356 | Ga0501070_0004260 | |||
| 1357 | Ga0501070_0008299 | |||
| 1358 | Ga0501070_0009383 | |||
| 1359 | Ga0501070_0027484 | |||
| 1360 | Ga0501071_0019748 | |||
| 1361 | Ga0501071_0027918 | |||
| 1362 | Ga0501071_0035337 | |||
| 1363 | Ga0501071_0126003 | |||
| 1364 | Ga0501071_0203845 | |||
| 1365 | Ga0501071_0217488 | |||
| 1366 | Ga0501072_0001031 | |||
| 1367 | Ga0501072_0001639 | |||
| 1368 | Ga0501072_0009973 | |||
| 1369 | Ga0501072_0088898 | |||
| 1370 | Ga0501072_0099201 | |||
| 1371 | Ga0501073_0035243 | |||
| 1372 | Ga0501073_0060072 | |||
| 1373 | Ga0501074_0000631 | |||
| 1374 | Ga0501074_0008110 | |||
| 1375 | Ga0501074_0059123 | |||
| 1376 | Ga0501075_0003045 | |||
| 1377 | Ga0501075_0003746 | |||
| 1378 | Ga0501075_0019318 | |||
| 1379 | Ga0501076_0002847 | |||
| 1380 | Ga0501076_0018038 | |||
| 1381 | Ga0501076_0126151 | |||
| 1382 | Ga0501076_0212384 | |||
| 1383 | Ga0501077_0001982 | |||
| 1384 | Ga0501077_0003218 | |||
| 1385 | Ga0501077_0144830 | |||
| 1386 | Ga0501077_0243070 | |||
| 1387 | Ga0501079_0005924 | |||
| 1388 | Ga0501079_0023099 | |||
| 1389 | Ga0501079_0060051 | |||
| 1390 | Ga0501079_0107504 | |||
| 1391 | Ga0501079_0302911 | |||
| 1392 | Ga0501080_0003171 | |||
| 1393 | Ga0501080_0018327 | |||
| 1394 | Ga0501080_0036379 | |||
| 1395 | Ga0501080_0137937 | |||
| 1396 | Ga0501080_0251257 | |||
| 1397 | Ga0501081_0001818 | |||
| 1398 | Ga0501081_0004537 | |||
| 1399 | Ga0501081_0023167 | |||
| 1400 | Ga0501083_0052449 | |||
| 1401 | Ga0501035_0116207 | |||
| 1402 | Ga0501035_0181803 | |||
| 1403 | Ga0501044_0047740 | |||
| 1404 | Ga0501044_0163786 | |||
| 1405 | Ga0501045_0006905 | |||
| 1406 | Ga0501045_0011126 | |||
| 1407 | Ga0501045_0016794 | |||
| 1408 | Ga0501045_0067491 | |||
| 1409 | Ga0501045_0243881 | |||
| 1410 | nmdc:mga03n38_78507_c1 | |||
| 1411 | nmdc:mga05p37_28454_c1 | |||
| 1412 | nmdc:mga05p37_705612_c1 | |||
| 1413 | nmdc:mga08y16_136912_c1 | |||
| 1414 | nmdc:mga08y16_49960_c1 | |||
| 1415 | nmdc:mga0n895_116845_c1 | |||
| 1416 | nmdc:mga0n895_122716_c1 | |||
| 1417 | nmdc:mga0n895_28470_c1 | |||
| 1418 | nmdc:mga0rr50_41123_c1 | |||
| 1419 | nmdc:mga0rr50_82614_c1 | |||
| 1420 | nmdc:mga08x19_141327_c1 | |||
| 1421 | nmdc:mga0a205_47813_c1 | |||
| 1422 | Ga0495601_0000101 | |||
| 1423 | Ga0495601_0023366 | |||
| 1424 | Ga0495601_0033107 | |||
| 1425 | Ga0495601_0046549 | |||
| 1426 | Ga0495601_0071776 | |||
| 1427 | Ga0495612_0051751 | |||
| 1428 | Ga0495595_0027693 | |||
| 1429 | Ga0495619_0000235 | |||
| 1430 | Ga0495619_0001903 | |||
| 1431 | Ga0495619_0014867 | |||
| 1432 | Ga0495619_0020786 | |||
| 1433 | Ga0495619_0038976 | |||
| 1434 | Ga0495619_0062800 | |||
| 1435 | Ga0495619_0076823 | |||
| 1436 | Ga0495619_0082557 | |||
| 1437 | Ga0501084_0009898 | |||
| 1438 | Ga0501084_0049243 | |||
| 1439 | Ga0501084_0054566 | |||
| 1440 | Ga0501084_0075212 | |||
| 1441 | Ga0501084_0176818 | |||
| 1442 | Ga0501082_0017062 | |||
| 1443 | Ga0501082_0023829 | |||
| 1444 | Ga0501082_0047727 | |||
| 1445 | Ga0501082_0074426 | |||
| 1446 | Ga0501082_0184023 | |||
| 1447 | Ga0501082_0315120 | |||
| 1448 | Ga0466962_0011206 | |||
| 1449 | Ga0466962_0020097 | |||
| 1450 | Ga0466962_0028520 | |||
| 1451 | Ga0530510_0001724 | |||
| 1452 | Ga0530510_0002879 | |||
| 1453 | Ga0530510_0009891 | |||
| 1454 | Ga0530510_0025027 | |||
| 1455 | Ga0530510_0256253 | |||
| 1456 | Ga0530510_0359200 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lum-assembly1.cif.gz_Q | structure of mycobacterium smegmatis succinate dehydrogenase 2 | 0.8983 | 1 | 226 |
| 3abv-assembly1.cif.gz_B | crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide | 0.8951 | 2 | 226 |
| 2wp9-assembly3.cif.gz_J | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant | 0.8926 | 1 | 234 |
| 8gs8-assembly1.cif.gz_B | cryo-em structure of the human respiratory complex ii | 0.8921 | 2 | 226 |
| 2acz-assembly1.cif.gz_B | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.8905 | 1 | 234 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53669_2_103_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9366 | 2 | 104 | 3.10.20.30 |
| 4kx6N01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9161 | 1 | 104 | 3.10.20.30 |
| af_O53669_2_103_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9106 | 2 | 104 | 3.10.20.30 |
| af_Q57557_1_93_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9096 | 3 | 104 | 3.10.20.30 |
| af_Q4DKU9_58_161_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.901 | 2 | 100 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1LEK7-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9819 | 1 | 113 |
GO:0006099
GO:0009055 GO:0016491 GO:0022904 GO:0051536 |
| AF-A0A7W1LEK7-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.965 | 1 | 113 |
GO:0006099
GO:0009055 GO:0016491 GO:0022904 GO:0051536 |
| AF-A0A7W0NI69-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9443 | 1 | 155 |
GO:0006099
GO:0009055 GO:0016491 GO:0022904 GO:0051537 GO:0051539 |
| AF-A0A538CFY4-F1-model_v4 | Succinate dehydrogenase/fumarate reductase iron-sulfur subunit | 0.9413 | 1 | 183 |
GO:0006099
GO:0009055 GO:0016491 GO:0022904 GO:0051539 |
| AF-A0A836RW40-F1-model_v4 | 2Fe-2S iron-sulfur cluster binding domain-containing protein | 0.9372 | 1 | 113 |
GO:0006099
GO:0009055 GO:0016491 GO:0022904 GO:0051537 |