F477798
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 425 | 1456 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10242354|Ga0105239_102423542 |
| Length | 174 |
| Sequence | VAGGVVDVSGDGAPQPDALDGSSLAVAIVAARWHEEITDALLAGAQRALAEVNAGSVTVLRVPGAFELPVATKVLADTGADAVVALGVVIRGGTPHFEYVCSAATDGLTRVAVETGIPVGFGLLTCDTAEQAFDRAGVPGSSEDKGWEAAMAAVETALTLRAHRDASHGQADGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 146 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 147 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 150 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 151 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 152 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 162 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 163 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 164 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 165 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 168 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 173 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 174 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 175 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 179 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 186 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 187 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 190 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 191 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 192 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 195 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 196 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 201 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 204 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 327 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 335 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 342 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 343 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 344 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 345 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 346 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 347 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 348 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 349 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 350 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 351 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 352 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 354 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 355 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 358 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 359 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 363 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 364 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 365 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 366 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 367 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 368 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 369 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 370 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 371 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 372 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 373 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 374 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 375 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 376 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 377 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 378 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 379 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 380 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 381 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 382 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 383 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 384 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 385 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 386 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 387 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 388 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 389 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 390 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 391 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 392 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 393 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 394 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 395 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 396 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 397 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 398 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 399 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 400 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 401 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 402 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 403 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 404 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 405 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 406 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 407 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 408 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 409 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 410 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 411 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 412 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 413 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 414 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 415 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 416 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 417 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 418 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 419 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 420 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 421 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 422 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 423 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 424 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 425 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.52 |
| Metatranscriptomes | 0.69 |
| Isolates | 8.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 0 |
| Rhizoplane | 10.16 |
| Rhizosphere | 71.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10242354 | 3300010375 | Bacteria | 2024 |
| 2 | 2214964665 | 2209111006 | Bacteria | 533 |
| 3 | LJQas_1007539 | 3300000549 | Bacteria | 1336 |
| 4 | JGI24735J21928_10008034 | 3300002067 | Bacteria | 3426 |
| 5 | Ga0006562J51391_1107219 | 3300003578 | Bacteria | 1172 |
| 6 | Ga0070658_10034972 | 3300005327 | Bacteria | 4045 |
| 7 | Ga0070683_100007790 | 3300005329 | Bacteria | 9069 |
| 8 | Ga0070683_100140777 | 3300005329 | Bacteria | 2286 |
| 9 | Ga0070683_100526419 | 3300005329 | Bacteria | 1130 |
| 10 | Ga0070683_100709016 | 3300005329 | Bacteria | 964 |
| 11 | Ga0070683_101760421 | 3300005329 | Bacteria | 596 |
| 12 | Ga0070690_100277045 | 3300005330 | Bacteria | 1195 |
| 13 | Ga0070670_100389809 | 3300005331 | Bacteria | 1228 |
| 14 | Ga0068869_100085219 | 3300005334 | Bacteria | 2366 |
| 15 | Ga0070666_10162889 | 3300005335 | Bacteria | 1559 |
| 16 | Ga0070680_100000593 | 3300005336 | Bacteria | 24998 |
| 17 | Ga0070682_100025365 | 3300005337 | Bacteria | 3536 |
| 18 | Ga0068868_100026638 | 3300005338 | Bacteria | 4408 |
| 19 | Ga0068868_100194069 | 3300005338 | Bacteria | 1690 |
| 20 | Ga0070660_100009401 | 3300005339 | Bacteria | 6873 |
| 21 | Ga0070660_100159722 | 3300005339 | Bacteria | 1816 |
| 22 | Ga0070689_101459351 | 3300005340 | Bacteria | 619 |
| 23 | Ga0070691_10034378 | 3300005341 | Bacteria | 2386 |
| 24 | Ga0070661_100611306 | 3300005344 | Bacteria | 882 |
| 25 | Ga0070675_100225861 | 3300005354 | Bacteria | 1632 |
| 26 | Ga0070675_100612614 | 3300005354 | Bacteria | 988 |
| 27 | Ga0070675_101114470 | 3300005354 | Bacteria | 726 |
| 28 | Ga0070674_101057441 | 3300005356 | Bacteria | 715 |
| 29 | Ga0070659_100030557 | 3300005366 | Bacteria | 4169 |
| 30 | Ga0070659_100093153 | 3300005366 | Bacteria | 2417 |
| 31 | Ga0070659_100844264 | 3300005366 | Bacteria | 798 |
| 32 | Ga0070667_100192339 | 3300005367 | Bacteria | 1808 |
| 33 | Ga0070709_10145341 | 3300005434 | Bacteria | 1633 |
| 34 | Ga0070714_100065950 | 3300005435 | Bacteria | 3119 |
| 35 | Ga0070705_100029828 | 3300005440 | Bacteria | 3005 |
| 36 | Ga0070694_100144643 | 3300005444 | Bacteria | 1730 |
| 37 | Ga0070663_100109932 | 3300005455 | Bacteria | 2070 |
| 38 | Ga0070663_100876897 | 3300005455 | Bacteria | 774 |
| 39 | Ga0070663_101644862 | 3300005455 | Bacteria | 573 |
| 40 | Ga0070678_100074595 | 3300005456 | Bacteria | 2550 |
| 41 | Ga0070678_100224313 | 3300005456 | Bacteria | 1563 |
| 42 | Ga0070662_100059635 | 3300005457 | Bacteria | 2780 |
| 43 | Ga0070681_10000504 | 3300005458 | Bacteria | 31959 |
| 44 | Ga0070681_10786899 | 3300005458 | Bacteria | 868 |
| 45 | Ga0068867_100096945 | 3300005459 | Bacteria | 2246 |
| 46 | Ga0070685_10198648 | 3300005466 | Bacteria | 1302 |
| 47 | Ga0070706_100188277 | 3300005467 | Bacteria | 1929 |
| 48 | Ga0070679_100000687 | 3300005530 | Bacteria | 29007 |
| 49 | Ga0070679_100008338 | 3300005530 | Bacteria | 9748 |
| 50 | Ga0070684_100002606 | 3300005535 | Bacteria | 13316 |
| 51 | Ga0068853_100077565 | 3300005539 | Bacteria | 2902 |
| 52 | Ga0068853_100194816 | 3300005539 | Bacteria | 1842 |
| 53 | Ga0070672_100028388 | 3300005543 | Bacteria | 4185 |
| 54 | Ga0070672_100266335 | 3300005543 | Bacteria | 1446 |
| 55 | Ga0070686_100060660 | 3300005544 | Bacteria | 2441 |
| 56 | Ga0070695_100058717 | 3300005545 | Bacteria | 2488 |
| 57 | Ga0070693_100026612 | 3300005547 | Bacteria | 3125 |
| 58 | Ga0070665_100000703 | 3300005548 | Bacteria | 44593 |
| 59 | Ga0070665_100186523 | 3300005548 | Bacteria | 2075 |
| 60 | Ga0070665_100501290 | 3300005548 | Bacteria | 1225 |
| 61 | Ga0070665_101226403 | 3300005548 | Bacteria | 761 |
| 62 | Ga0070704_100029607 | 3300005549 | Bacteria | 3658 |
| 63 | Ga0068855_100270211 | 3300005563 | Bacteria | 1891 |
| 64 | Ga0070664_100068013 | 3300005564 | Bacteria | 3045 |
| 65 | Ga0070664_101723283 | 3300005564 | Bacteria | 594 |
| 66 | Ga0068857_100007505 | 3300005577 | Bacteria | 9382 |
| 67 | Ga0068857_100083301 | 3300005577 | Bacteria | 2857 |
| 68 | Ga0068857_100366615 | 3300005577 | Bacteria | 1336 |
| 69 | Ga0068857_100932410 | 3300005577 | Bacteria | 834 |
| 70 | Ga0068854_100129036 | 3300005578 | Bacteria | 1928 |
| 71 | Ga0068854_100672106 | 3300005578 | Bacteria | 891 |
| 72 | Ga0068856_100056603 | 3300005614 | Bacteria | 3870 |
| 73 | Ga0068856_100740294 | 3300005614 | Bacteria | 1003 |
| 74 | Ga0068852_100127865 | 3300005616 | Bacteria | 2336 |
| 75 | Ga0068852_101837419 | 3300005616 | Bacteria | 628 |
| 76 | Ga0068864_100033841 | 3300005618 | Bacteria | 4345 |
| 77 | Ga0068864_100042022 | 3300005618 | Bacteria | 3911 |
| 78 | Ga0068864_100796013 | 3300005618 | Bacteria | 929 |
| 79 | Ga0068861_100165353 | 3300005719 | Bacteria | 1829 |
| 80 | Ga0068851_10111964 | 3300005834 | Bacteria | 1458 |
| 81 | Ga0068870_10659440 | 3300005840 | Bacteria | 718 |
| 82 | Ga0068870_11162251 | 3300005840 | Bacteria | 557 |
| 83 | Ga0068863_100068894 | 3300005841 | Bacteria | 3346 |
| 84 | Ga0068863_100086465 | 3300005841 | Bacteria | 2971 |
| 85 | Ga0068863_101608887 | 3300005841 | Bacteria | 659 |
| 86 | Ga0068858_100297884 | 3300005842 | Bacteria | 1538 |
| 87 | Ga0068858_100468871 | 3300005842 | Bacteria | 1214 |
| 88 | Ga0068860_100005003 | 3300005843 | Bacteria | 13499 |
| 89 | Ga0068860_100378829 | 3300005843 | Bacteria | 1396 |
| 90 | Ga0075365_10023605 | 3300006038 | Bacteria | 3870 |
| 91 | Ga0075363_100065067 | 3300006048 | Bacteria | 1970 |
| 92 | Ga0075364_10034074 | 3300006051 | Bacteria | 3282 |
| 93 | Ga0075364_10072370 | 3300006051 | Bacteria | 2272 |
| 94 | Ga0075364_10207127 | 3300006051 | Bacteria | 1330 |
| 95 | Ga0075364_10479906 | 3300006051 | Bacteria | 850 |
| 96 | Ga0075432_10048893 | 3300006058 | Bacteria | 1489 |
| 97 | Ga0070715_10286760 | 3300006163 | Bacteria | 875 |
| 98 | Ga0075367_10006308 | 3300006178 | Bacteria | 5979 |
| 99 | Ga0075367_10083551 | 3300006178 | Bacteria | 1935 |
| 100 | Ga0097621_100126174 | 3300006237 | Bacteria | 2174 |
| 101 | Ga0097621_100893827 | 3300006237 | Bacteria | 827 |
| 102 | Ga0075370_10067849 | 3300006353 | Bacteria | 2036 |
| 103 | Ga0075370_10085291 | 3300006353 | Bacteria | 1818 |
| 104 | Ga0075370_10163656 | 3300006353 | Bacteria | 1306 |
| 105 | Ga0075433_10153316 | 3300006852 | Bacteria | 2050 |
| 106 | Ga0068865_100115854 | 3300006881 | Bacteria | 1984 |
| 107 | Ga0075436_100009906 | 3300006914 | Bacteria | 6515 |
| 108 | Ga0075435_100065264 | 3300007076 | Bacteria | 2959 |
| 109 | Ga0105240_10196575 | 3300009093 | Bacteria | 2367 |
| 110 | Ga0111539_11151905 | 3300009094 | Bacteria | 901 |
| 111 | Ga0105245_10003498 | 3300009098 | Bacteria | 14055 |
| 112 | Ga0105245_10524530 | 3300009098 | Bacteria | 1203 |
| 113 | Ga0105245_10763041 | 3300009098 | Bacteria | 1004 |
| 114 | Ga0105245_12164064 | 3300009098 | Bacteria | 610 |
| 115 | Ga0105243_10462636 | 3300009148 | Bacteria | 1193 |
| 116 | Ga0105243_10487382 | 3300009148 | Bacteria | 1165 |
| 117 | Ga0105241_10687076 | 3300009174 | Bacteria | 933 |
| 118 | Ga0105242_10069312 | 3300009176 | Bacteria | 2921 |
| 119 | Ga0105248_10002772 | 3300009177 | Bacteria | 19481 |
| 120 | Ga0105248_10126438 | 3300009177 | Bacteria | 2883 |
| 121 | Ga0105248_12831332 | 3300009177 | Bacteria | 553 |
| 122 | Ga0105237_10064422 | 3300009545 | Bacteria | 3661 |
| 123 | Ga0105237_11108714 | 3300009545 | Bacteria | 798 |
| 124 | Ga0105238_10025846 | 3300009551 | Bacteria | 5986 |
| 125 | Ga0105238_10522660 | 3300009551 | Bacteria | 1189 |
| 126 | Ga0105249_10061625 | 3300009553 | Bacteria | 3443 |
| 127 | Ga0105249_10105374 | 3300009553 | Bacteria | 2658 |
| 128 | Ga0105239_10000854 | 3300010375 | Bacteria | 43307 |
| 129 | Ga0105239_10128075 | 3300010375 | Bacteria | 2822 |
| 130 | Ga0105246_10000321 | 3300011119 | Bacteria | 25383 |
| 131 | Ga0105246_10015065 | 3300011119 | Bacteria | 4873 |
| 132 | Ga0105246_10288691 | 3300011119 | Bacteria | 1319 |
| 133 | Ga0157317_1002508 | 3300012475 | Bacteria | 1088 |
| 134 | Ga0157370_10052698 | 3300013104 | Bacteria | 3884 |
| 135 | Ga0157370_10596927 | 3300013104 | Bacteria | 1011 |
| 136 | Ga0157370_11165035 | 3300013104 | Bacteria | 696 |
| 137 | Ga0157369_10015379 | 3300013105 | Bacteria | 8627 |
| 138 | Ga0157369_10047355 | 3300013105 | Bacteria | 4669 |
| 139 | Ga0157374_10043202 | 3300013296 | Bacteria | 4162 |
| 140 | Ga0157374_10062773 | 3300013296 | Bacteria | 3484 |
| 141 | Ga0157374_10164325 | 3300013296 | Bacteria | 2163 |
| 142 | Ga0157374_10256296 | 3300013296 | Bacteria | 1722 |
| 143 | Ga0157378_10378832 | 3300013297 | Bacteria | 1389 |
| 144 | Ga0163162_10039940 | 3300013306 | Bacteria | 4690 |
| 145 | Ga0163162_10113883 | 3300013306 | Bacteria | 2803 |
| 146 | Ga0163162_10842657 | 3300013306 | Bacteria | 1032 |
| 147 | Ga0157372_10010217 | 3300013307 | Bacteria | 9965 |
| 148 | Ga0157372_10078432 | 3300013307 | Bacteria | 3732 |
| 149 | Ga0157372_10434212 | 3300013307 | Bacteria | 1531 |
| 150 | Ga0157372_10658802 | 3300013307 | Bacteria | 1219 |
| 151 | Ga0157375_10188890 | 3300013308 | Bacteria | 2214 |
| 152 | Ga0157375_10248446 | 3300013308 | Bacteria | 1939 |
| 153 | Ga0157375_10352470 | 3300013308 | Bacteria | 1638 |
| 154 | Ga0157375_10563565 | 3300013308 | Bacteria | 1300 |
| 155 | Ga0157375_10818875 | 3300013308 | Bacteria | 1079 |
| 156 | Ga0157375_10922979 | 3300013308 | Bacteria | 1016 |
| 157 | Ga0157375_11317520 | 3300013308 | Bacteria | 849 |
| 158 | Ga0163163_10059413 | 3300014325 | Bacteria | 3782 |
| 159 | Ga0163163_10075698 | 3300014325 | Bacteria | 3359 |
| 160 | Ga0163163_10158307 | 3300014325 | Bacteria | 2310 |
| 161 | Ga0163163_10171195 | 3300014325 | Bacteria | 2218 |
| 162 | Ga0163163_10173676 | 3300014325 | Bacteria | 2201 |
| 163 | Ga0163163_10303329 | 3300014325 | Bacteria | 1649 |
| 164 | Ga0157377_10219547 | 3300014745 | Bacteria | 1216 |
| 165 | Ga0157377_10326490 | 3300014745 | Bacteria | 1021 |
| 166 | Ga0157377_10687357 | 3300014745 | Bacteria | 741 |
| 167 | Ga0157379_10091568 | 3300014968 | Bacteria | 2728 |
| 168 | Ga0157379_10467167 | 3300014968 | Bacteria | 1167 |
| 169 | Ga0157376_10191829 | 3300014969 | Bacteria | 1874 |
| 170 | Ga0157376_11193776 | 3300014969 | Bacteria | 789 |
| 171 | Ga0157376_11533871 | 3300014969 | Bacteria | 700 |
| 172 | Ga0163161_10018311 | 3300017792 | Bacteria | 4908 |
| 173 | Ga0206354_11136565 | 3300020081 | Bacteria | 1104 |
| 174 | Ga0206353_11561753 | 3300020082 | Bacteria | 1373 |
| 175 | Ga0206353_11575633 | 3300020082 | Bacteria | 2566 |
| 176 | Ga0209646_1000092 | 3300025246 | Bacteria | 185930 |
| 177 | Ga0207688_10025250 | 3300025901 | Bacteria | 3262 |
| 178 | Ga0207688_10032534 | 3300025901 | Bacteria | 2883 |
| 179 | Ga0207647_10099630 | 3300025904 | Bacteria | 1725 |
| 180 | Ga0207647_10306389 | 3300025904 | Bacteria | 904 |
| 181 | Ga0207699_10039748 | 3300025906 | Bacteria | 2705 |
| 182 | Ga0207643_10634940 | 3300025908 | Bacteria | 688 |
| 183 | Ga0207705_10017670 | 3300025909 | Bacteria | 5103 |
| 184 | Ga0207705_10356207 | 3300025909 | Bacteria | 1128 |
| 185 | Ga0207705_11147420 | 3300025909 | Bacteria | 597 |
| 186 | Ga0207684_10163935 | 3300025910 | Bacteria | 1915 |
| 187 | Ga0207654_10173529 | 3300025911 | Bacteria | 1402 |
| 188 | Ga0207707_10001138 | 3300025912 | Bacteria | 25201 |
| 189 | Ga0207707_10650073 | 3300025912 | Bacteria | 889 |
| 190 | Ga0207671_10032200 | 3300025914 | Bacteria | 3903 |
| 191 | Ga0207660_10000439 | 3300025917 | Bacteria | 27487 |
| 192 | Ga0207657_10006341 | 3300025919 | Bacteria | 12287 |
| 193 | Ga0207657_10011446 | 3300025919 | Bacteria | 8809 |
| 194 | Ga0207657_10050721 | 3300025919 | Bacteria | 3609 |
| 195 | Ga0207657_10052371 | 3300025919 | Bacteria | 3542 |
| 196 | Ga0207649_10141054 | 3300025920 | Bacteria | 1649 |
| 197 | Ga0207652_10004366 | 3300025921 | Bacteria | 11522 |
| 198 | Ga0207652_10190362 | 3300025921 | Bacteria | 1845 |
| 199 | Ga0207694_10079308 | 3300025924 | Bacteria | 2575 |
| 200 | Ga0207659_10415169 | 3300025926 | Bacteria | 1128 |
| 201 | Ga0207687_10004541 | 3300025927 | Bacteria | 9235 |
| 202 | Ga0207687_10163401 | 3300025927 | Bacteria | 1711 |
| 203 | Ga0207687_10167298 | 3300025927 | Bacteria | 1693 |
| 204 | Ga0207700_10390618 | 3300025928 | Bacteria | 1218 |
| 205 | Ga0207664_10769970 | 3300025929 | Bacteria | 866 |
| 206 | Ga0207644_10478957 | 3300025931 | Bacteria | 1025 |
| 207 | Ga0207644_10861506 | 3300025931 | Bacteria | 759 |
| 208 | Ga0207690_10047915 | 3300025932 | Bacteria | 2838 |
| 209 | Ga0207690_10626709 | 3300025932 | Bacteria | 880 |
| 210 | Ga0207690_11113561 | 3300025932 | Bacteria | 658 |
| 211 | Ga0207706_10029258 | 3300025933 | Bacteria | 4919 |
| 212 | Ga0207686_10541169 | 3300025934 | Bacteria | 909 |
| 213 | Ga0207709_10046459 | 3300025935 | Bacteria | 2635 |
| 214 | Ga0207709_10409907 | 3300025935 | Bacteria | 1038 |
| 215 | Ga0207669_10394756 | 3300025937 | Bacteria | 1082 |
| 216 | Ga0207669_10666905 | 3300025937 | Bacteria | 852 |
| 217 | Ga0207704_10207127 | 3300025938 | Bacteria | 1440 |
| 218 | Ga0207691_10125963 | 3300025940 | Bacteria | 2267 |
| 219 | Ga0207691_10150892 | 3300025940 | Bacteria | 2043 |
| 220 | Ga0207691_10285212 | 3300025940 | Bacteria | 1420 |
| 221 | Ga0207711_10002845 | 3300025941 | Bacteria | 15187 |
| 222 | Ga0207711_10106349 | 3300025941 | Bacteria | 2490 |
| 223 | Ga0207689_10012347 | 3300025942 | Bacteria | 7308 |
| 224 | Ga0207661_10005367 | 3300025944 | Bacteria | 9032 |
| 225 | Ga0207661_10031845 | 3300025944 | Bacteria | 4079 |
| 226 | Ga0207661_10059579 | 3300025944 | Bacteria | 3077 |
| 227 | Ga0207661_10103468 | 3300025944 | Bacteria | 2396 |
| 228 | Ga0207661_10424400 | 3300025944 | Bacteria | 1208 |
| 229 | Ga0207661_10838965 | 3300025944 | Bacteria | 846 |
| 230 | Ga0207661_11468887 | 3300025944 | Bacteria | 625 |
| 231 | Ga0207667_10273630 | 3300025949 | Bacteria | 1726 |
| 232 | Ga0207667_10458980 | 3300025949 | Bacteria | 1294 |
| 233 | Ga0207667_10724077 | 3300025949 | Bacteria | 996 |
| 234 | Ga0207712_10054346 | 3300025961 | Bacteria | 2813 |
| 235 | Ga0207640_10100925 | 3300025981 | Bacteria | 2023 |
| 236 | Ga0207658_10083803 | 3300025986 | Bacteria | 2452 |
| 237 | Ga0207677_10203174 | 3300026023 | Bacteria | 1576 |
| 238 | Ga0207677_10885559 | 3300026023 | Bacteria | 804 |
| 239 | Ga0207703_10406433 | 3300026035 | Bacteria | 1264 |
| 240 | Ga0207639_10338843 | 3300026041 | Bacteria | 1340 |
| 241 | Ga0207678_10012055 | 3300026067 | Bacteria | 7592 |
| 242 | Ga0207678_10514296 | 3300026067 | Bacteria | 1044 |
| 243 | Ga0207702_10814260 | 3300026078 | Bacteria | 923 |
| 244 | Ga0207641_10021123 | 3300026088 | Bacteria | 5351 |
| 245 | Ga0207641_10978552 | 3300026088 | Bacteria | 842 |
| 246 | Ga0207641_11617280 | 3300026088 | Bacteria | 650 |
| 247 | Ga0207641_11628497 | 3300026088 | Bacteria | 647 |
| 248 | Ga0207648_10597713 | 3300026089 | Bacteria | 1017 |
| 249 | Ga0207676_10022186 | 3300026095 | Bacteria | 4668 |
| 250 | Ga0207674_10012449 | 3300026116 | Bacteria | 9507 |
| 251 | Ga0207674_10220239 | 3300026116 | Bacteria | 1846 |
| 252 | Ga0207674_10342989 | 3300026116 | Bacteria | 1444 |
| 253 | Ga0207675_100042929 | 3300026118 | Bacteria | 4222 |
| 254 | Ga0207683_10824348 | 3300026121 | Bacteria | 861 |
| 255 | Ga0207683_11170330 | 3300026121 | Bacteria | 713 |
| 256 | Ga0207698_11445498 | 3300026142 | Bacteria | 703 |
| 257 | Ga0207428_10089096 | 3300027907 | Bacteria | 2398 |
| 258 | Ga0207428_10248189 | 3300027907 | Bacteria | 1328 |
| 259 | Ga0268266_10001679 | 3300028379 | Bacteria | 25483 |
| 260 | Ga0268266_10106176 | 3300028379 | Bacteria | 2482 |
| 261 | Ga0268266_11783696 | 3300028379 | Bacteria | 590 |
| 262 | Ga0268264_10001670 | 3300028381 | Bacteria | 20420 |
| 263 | Ga0307517_10013215 | 3300028786 | Bacteria | 11240 |
| 264 | Ga0307511_10059381 | 3300030521 | Bacteria | 2942 |
| 265 | Ga0316177_1033974 | 3300030731 | Bacteria | 4941 |
| 266 | Ga0314311_1204030 | 3300030733 | Bacteria | 752 |
| 267 | Ga0316181_1066740 | 3300030744 | Bacteria | 833 |
| 268 | Ga0307509_10554750 | 3300031507 | Bacteria | 826 |
| 269 | Ga0307508_10009221 | 3300031616 | Bacteria | 9090 |
| 270 | Ga0307514_10029647 | 3300031649 | Bacteria | 4397 |
| 271 | Ga0307514_10073002 | 3300031649 | Bacteria | 2567 |
| 272 | Ga0307514_10179282 | 3300031649 | Bacteria | 1368 |
| 273 | Ga0316576_10121777 | 3300031727 | Bacteria | 1959 |
| 274 | Ga0316578_10229823 | 3300031728 | Bacteria | 1114 |
| 275 | Ga0307516_10027823 | 3300031730 | Bacteria | 5729 |
| 276 | Ga0316577_10451297 | 3300031733 | Bacteria | 731 |
| 277 | Ga0307413_11039975 | 3300031824 | Bacteria | 704 |
| 278 | Ga0307406_10022279 | 3300031901 | Bacteria | 3756 |
| 279 | Ga0307412_10223491 | 3300031911 | Bacteria | 1445 |
| 280 | Ga0307409_100329281 | 3300031995 | Bacteria | 1433 |
| 281 | Ga0307409_100786929 | 3300031995 | Bacteria | 958 |
| 282 | Ga0307416_100692600 | 3300032002 | Bacteria | 1107 |
| 283 | Ga0307414_10841091 | 3300032004 | Bacteria | 839 |
| 284 | Ga0307414_11084688 | 3300032004 | Bacteria | 739 |
| 285 | Ga0307415_100029484 | 3300032126 | Bacteria | 3508 |
| 286 | Ga0307415_100756440 | 3300032126 | Bacteria | 883 |
| 287 | Ga0307510_10344117 | 3300033180 | Bacteria | 943 |
| 288 | Ga0373938_0081763 | 3300034957 | Bacteria | 787 |
| 289 | Ga0373928_0008556 | 3300035084 | Bacteria | 1988 |
| 290 | Ga0373951_0177960 | 3300035091 | Bacteria | 609 |
| 291 | Ga0373932_0048535 | 3300035112 | Bacteria | 1251 |
| 292 | Ga0373939_0109014 | 3300035114 | Bacteria | 961 |
| 293 | Ga0373941_0230041 | 3300035115 | Bacteria | 716 |
| 294 | Ga0373942_0018109 | 3300035207 | Bacteria | 1744 |
| 295 | Ga0373961_0250033 | 3300035241 | Bacteria | 641 |
| 296 | Ga0373962_0017092 | 3300035242 | Bacteria | 1877 |
| 297 | Ga0316574_0002391 | 3300035398 | Bacteria | 9394 |
| 298 | Ga0373931_0006896 | 3300035691 | Bacteria | 5342 |
| 299 | Ga0310109_000028 | 3300036534 | Bacteria | 7045 |
| 300 | Ga0316584_0083328 | 3300036712 | Bacteria | 2395 |
| 301 | Ga0395900_1382251 | 3300037418 | Bacteria | 617 |
| 302 | Ga0395898_1555242 | 3300037466 | Bacteria | 586 |
| 303 | Ga0436365_0349873 | 3300039437 | Bacteria | 799 |
| 304 | Ga0451787_466674 | 3300041441 | Bacteria | 661 |
| 305 | Ga0451787_547381 | 3300041441 | Bacteria | 736 |
| 306 | Ga0451789_0816307 | 3300041443 | Bacteria | 587 |
| 307 | Ga0451791_1203085 | 3300041451 | Bacteria | 652 |
| 308 | Ga0451793_1028755 | 3300041452 | Bacteria | 1132 |
| 309 | Ga0451793_1615984 | 3300041452 | Bacteria | 821 |
| 310 | Ga0451797_0561444 | 3300041453 | Bacteria | 823 |
| 311 | Ga0451800_0964045 | 3300041459 | Bacteria | 1320 |
| 312 | Ga0451806_433624 | 3300041462 | Bacteria | 1071 |
| 313 | Ga0451837_0396473 | 3300041494 | Bacteria | 966 |
| 314 | Ga0451837_1265856 | 3300041494 | Bacteria | 973 |
| 315 | Ga0451841_0599155 | 3300041498 | Bacteria | 963 |
| 316 | Ga0451853_0805780 | 3300041512 | Bacteria | 2764 |
| 317 | Ga0451853_3314615 | 3300041512 | Bacteria | 563 |
| 318 | Ga0451853_3503667 | 3300041512 | Bacteria | 531 |
| 319 | Ga0451853_3681975 | 3300041512 | Bacteria | 1972 |
| 320 | Ga0439448_0367376 | 3300042005 | Bacteria | 514 |
| 321 | Ga0450903_047872 | 3300042138 | Bacteria | 628 |
| 322 | Ga0450901_013889 | 3300042533 | Bacteria | 844 |
| 323 | Ga0466972_0013770 | 3300044658 | Bacteria | 4059 |
| 324 | Ga0466972_0022464 | 3300044658 | Bacteria | 3142 |
| 325 | Ga0466972_0096863 | 3300044658 | Bacteria | 1397 |
| 326 | Ga0466965_0024665 | 3300044683 | Bacteria | 2910 |
| 327 | Ga0466961_0004088 | 3300044693 | Bacteria | 9114 |
| 328 | Ga0466961_0110198 | 3300044693 | Bacteria | 1732 |
| 329 | Ga0466961_0260256 | 3300044693 | Bacteria | 1064 |
| 330 | Ga0466963_0001540 | 3300044694 | Bacteria | 12487 |
| 331 | Ga0466963_0011856 | 3300044694 | Bacteria | 5320 |
| 332 | Ga0466963_0023851 | 3300044694 | Bacteria | 3891 |
| 333 | Ga0466963_0199041 | 3300044694 | Bacteria | 1401 |
| 334 | Ga0466963_0213958 | 3300044694 | Bacteria | 1349 |
| 335 | Ga0466963_0372912 | 3300044694 | Bacteria | 1006 |
| 336 | Ga0466964_0012077 | 3300044706 | Bacteria | 3268 |
| 337 | Ga0466970_0019511 | 3300044765 | Bacteria | 3516 |
| 338 | Ga0466957_0041339 | 3300044842 | Bacteria | 2788 |
| 339 | Ga0466957_0237023 | 3300044842 | Bacteria | 1210 |
| 340 | Ga0466960_0238828 | 3300044901 | Bacteria | 1005 |
| 341 | Ga0466960_0387659 | 3300044901 | Bacteria | 803 |
| 342 | Ga0466959_0748438 | 3300045049 | Bacteria | 654 |
| 343 | Ga0451576_0213552 | 3300045051 | Bacteria | 2015 |
| 344 | Ga0466958_0003380 | 3300045836 | Bacteria | 8276 |
| 345 | Ga0466958_0082845 | 3300045836 | Bacteria | 1976 |
| 346 | Ga0466958_0198050 | 3300045836 | Bacteria | 1278 |
| 347 | Ga0466967_0008714 | 3300045976 | Bacteria | 7468 |
| 348 | Ga0466967_0021229 | 3300045976 | Bacteria | 5268 |
| 349 | Ga0466967_0036042 | 3300045976 | Bacteria | 4219 |
| 350 | Ga0466967_0094812 | 3300045976 | Bacteria | 2718 |
| 351 | Ga0466967_0111733 | 3300045976 | Bacteria | 2511 |
| 352 | Ga0466967_0168580 | 3300045976 | Bacteria | 2059 |
| 353 | Ga0466967_0282535 | 3300045976 | Bacteria | 1593 |
| 354 | Ga0466967_0517392 | 3300045976 | Bacteria | 1172 |
| 355 | Ga0466967_0704018 | 3300045976 | Bacteria | 1000 |
| 356 | Ga0466967_1697806 | 3300045976 | Bacteria | 629 |
| 357 | Ga0466967_1986649 | 3300045976 | Bacteria | 578 |
| 358 | Ga0495617_093731 | 3300046452 | Bacteria | 979 |
| 359 | Ga0495627_000262 | 3300046453 | Bacteria | 53953 |
| 360 | Ga0495627_027396 | 3300046453 | Bacteria | 1829 |
| 361 | Ga0495603_0000374 | 3300046455 | Bacteria | 24270 |
| 362 | Ga0495603_0005398 | 3300046455 | Bacteria | 7628 |
| 363 | Ga0495603_0055067 | 3300046455 | Bacteria | 2357 |
| 364 | Ga0495590_0040527 | 3300046457 | Bacteria | 1624 |
| 365 | Ga0495629_0000666 | 3300046459 | Bacteria | 27787 |
| 366 | Ga0495629_0007639 | 3300046459 | Bacteria | 7960 |
| 367 | Ga0495629_0273742 | 3300046459 | Bacteria | 1159 |
| 368 | Ga0495629_0359176 | 3300046459 | Bacteria | 993 |
| 369 | Ga0495638_0300118 | 3300046460 | Bacteria | 866 |
| 370 | Ga0495641_0054811 | 3300046461 | Bacteria | 1811 |
| 371 | Ga0495641_0349522 | 3300046461 | Bacteria | 668 |
| 372 | Ga0495651_0055979 | 3300046462 | Bacteria | 3029 |
| 373 | Ga0495653_0091515 | 3300046463 | Bacteria | 2223 |
| 374 | Ga0495650_0001841 | 3300046471 | Bacteria | 18974 |
| 375 | Ga0495580_0110901 | 3300046472 | Bacteria | 1905 |
| 376 | Ga0495582_0068881 | 3300046473 | Bacteria | 1956 |
| 377 | Ga0495605_0461208 | 3300046474 | Bacteria | 522 |
| 378 | Ga0495639_0009678 | 3300046475 | Bacteria | 4136 |
| 379 | Ga0495664_0251553 | 3300046477 | Bacteria | 1068 |
| 380 | Ga0495664_0524454 | 3300046477 | Bacteria | 707 |
| 381 | Ga0495584_0061402 | 3300046491 | Bacteria | 1889 |
| 382 | Ga0495585_0035759 | 3300046492 | Bacteria | 2805 |
| 383 | Ga0495585_0119935 | 3300046492 | Bacteria | 1392 |
| 384 | Ga0495594_0001394 | 3300046499 | Bacteria | 12546 |
| 385 | Ga0495594_0010757 | 3300046499 | Bacteria | 4749 |
| 386 | Ga0495594_0039157 | 3300046499 | Bacteria | 2590 |
| 387 | Ga0495596_0291009 | 3300046500 | Bacteria | 635 |
| 388 | Ga0495607_0112750 | 3300046501 | Bacteria | 1439 |
| 389 | Ga0495607_0197867 | 3300046501 | Bacteria | 997 |
| 390 | Ga0495583_0083525 | 3300046506 | Bacteria | 1384 |
| 391 | Ga0495606_0287796 | 3300046507 | Bacteria | 895 |
| 392 | Ga0495608_0907421 | 3300046511 | Bacteria | 516 |
| 393 | Ga0495610_0187979 | 3300046512 | Bacteria | 854 |
| 394 | Ga0495618_0121679 | 3300046514 | Bacteria | 1671 |
| 395 | Ga0495620_0294001 | 3300046515 | Bacteria | 617 |
| 396 | Ga0495630_0549004 | 3300046517 | Bacteria | 886 |
| 397 | Ga0495630_0709237 | 3300046517 | Bacteria | 770 |
| 398 | Ga0495631_0034279 | 3300046518 | Bacteria | 2276 |
| 399 | Ga0495632_0022589 | 3300046519 | Bacteria | 3370 |
| 400 | Ga0495632_0470511 | 3300046519 | Bacteria | 544 |
| 401 | Ga0495643_0004976 | 3300046522 | Bacteria | 9113 |
| 402 | Ga0495643_0007753 | 3300046522 | Bacteria | 6873 |
| 403 | Ga0495644_0037629 | 3300046523 | Bacteria | 1826 |
| 404 | Ga0495642_0051154 | 3300046528 | Bacteria | 1699 |
| 405 | Ga0495652_0161750 | 3300046529 | Bacteria | 1737 |
| 406 | Ga0495654_0022177 | 3300046530 | Bacteria | 3300 |
| 407 | Ga0495640_0063440 | 3300046533 | Bacteria | 2502 |
| 408 | Ga0495640_0576531 | 3300046533 | Bacteria | 681 |
| 409 | Ga0495586_0037565 | 3300046535 | Bacteria | 2600 |
| 410 | Ga0495587_0323031 | 3300046536 | Bacteria | 862 |
| 411 | Ga0495609_0010370 | 3300046538 | Bacteria | 4472 |
| 412 | Ga0495622_0155517 | 3300046557 | Bacteria | 1033 |
| 413 | Ga0495633_0054791 | 3300046558 | Bacteria | 1876 |
| 414 | Ga0495667_0106588 | 3300046559 | Bacteria | 1811 |
| 415 | Ga0495668_0177377 | 3300046616 | Bacteria | 1167 |
| 416 | Ga0495634_0023050 | 3300046642 | Bacteria | 4381 |
| 417 | Ga0495611_0231109 | 3300046648 | Bacteria | 859 |
| 418 | Ga0495661_0016082 | 3300046665 | Bacteria | 4971 |
| 419 | Ga0495661_0442295 | 3300046665 | Bacteria | 627 |
| 420 | Ga0495588_0026378 | 3300046674 | Bacteria | 2900 |
| 421 | Ga0495588_0187470 | 3300046674 | Bacteria | 1092 |
| 422 | Ga0495657_0048192 | 3300046675 | Bacteria | 2875 |
| 423 | Ga0495657_0146748 | 3300046675 | Bacteria | 1467 |
| 424 | Ga0495669_0010746 | 3300046684 | Bacteria | 3875 |
| 425 | Ga0495613_0002942 | 3300046689 | Bacteria | 12748 |
| 426 | Ga0495613_0170534 | 3300046689 | Bacteria | 1544 |
| 427 | Ga0495670_0005482 | 3300046691 | Bacteria | 6226 |
| 428 | Ga0495670_0243656 | 3300046691 | Bacteria | 957 |
| 429 | Ga0495589_0070168 | 3300046794 | Bacteria | 1713 |
| 430 | Ga0495589_0300985 | 3300046794 | Bacteria | 743 |
| 431 | Ga0495600_0011710 | 3300046809 | Bacteria | 5473 |
| 432 | Ga0495581_0043085 | 3300047315 | Bacteria | 2611 |
| 433 | Ga0495581_0233917 | 3300047315 | Bacteria | 1075 |
| 434 | Ga0495604_0058037 | 3300047317 | Bacteria | 2973 |
| 435 | Ga0495636_0271274 | 3300047318 | Bacteria | 788 |
| 436 | Ga0495674_0432979 | 3300047319 | Bacteria | 1058 |
| 437 | Ga0495676_0003574 | 3300047321 | Bacteria | 14103 |
| 438 | Ga0495676_0013762 | 3300047321 | Bacteria | 7254 |
| 439 | Ga0495680_0007843 | 3300047322 | Bacteria | 9746 |
| 440 | Ga0495683_0121766 | 3300047323 | Bacteria | 1237 |
| 441 | Ga0495687_056721 | 3300047443 | Bacteria | 1632 |
| 442 | Ga0495687_155422 | 3300047443 | Bacteria | 776 |
| 443 | Ga0495679_023223 | 3300047446 | Bacteria | 2106 |
| 444 | Ga0495685_000996 | 3300047447 | Bacteria | 8619 |
| 445 | Ga0495681_0001704 | 3300047470 | Bacteria | 16276 |
| 446 | Ga0495684_0108341 | 3300047471 | Bacteria | 2098 |
| 447 | Ga0495686_0089247 | 3300047472 | Bacteria | 1873 |
| 448 | Ga0495686_0433329 | 3300047472 | Bacteria | 701 |
| 449 | Ga0495602_0354394 | 3300048088 | Bacteria | 1058 |
| 450 | Ga0495614_0000213 | 3300048089 | Bacteria | 22483 |
| 451 | Ga0496101_0082388 | 3300048904 | Bacteria | 2381 |
| 452 | Ga0496101_0372183 | 3300048904 | Bacteria | 1123 |
| 453 | Ga0496102_0000739 | 3300048905 | Bacteria | 32093 |
| 454 | Ga0496102_0186854 | 3300048905 | Bacteria | 1953 |
| 455 | Ga0496102_0210045 | 3300048905 | Bacteria | 1835 |
| 456 | Ga0496102_0406045 | 3300048905 | Bacteria | 1280 |
| 457 | Ga0496102_0539400 | 3300048905 | Bacteria | 1089 |
| 458 | Ga0496103_0294185 | 3300048906 | Bacteria | 1044 |
| 459 | Ga0496103_0398302 | 3300048906 | Bacteria | 884 |
| 460 | Ga0496103_0594050 | 3300048906 | Bacteria | 705 |
| 461 | Ga0496103_0825674 | 3300048906 | Bacteria | 584 |
| 462 | Ga0496104_0009991 | 3300048907 | Bacteria | 8472 |
| 463 | Ga0496104_0102398 | 3300048907 | Bacteria | 2743 |
| 464 | Ga0496104_0621517 | 3300048907 | Bacteria | 990 |
| 465 | Ga0496104_0639970 | 3300048907 | Bacteria | 972 |
| 466 | Ga0496105_0002612 | 3300048908 | Bacteria | 13107 |
| 467 | Ga0496105_0221541 | 3300048908 | Bacteria | 1540 |
| 468 | Ga0496105_0515615 | 3300048908 | Bacteria | 937 |
| 469 | Ga0496106_0024661 | 3300048909 | Bacteria | 4472 |
| 470 | Ga0496106_0082222 | 3300048909 | Bacteria | 2475 |
| 471 | Ga0496107_0161336 | 3300048910 | Bacteria | 1661 |
| 472 | Ga0496108_0127201 | 3300048911 | Bacteria | 2188 |
| 473 | Ga0496108_0188289 | 3300048911 | Bacteria | 1788 |
| 474 | Ga0496108_0228823 | 3300048911 | Bacteria | 1616 |
| 475 | Ga0496108_0297779 | 3300048911 | Bacteria | 1405 |
| 476 | Ga0496108_0327998 | 3300048911 | Bacteria | 1334 |
| 477 | Ga0496108_0501433 | 3300048911 | Bacteria | 1060 |
| 478 | Ga0496108_0825410 | 3300048911 | Bacteria | 799 |
| 479 | Ga0496108_1109716 | 3300048911 | Bacteria | 672 |
| 480 | Ga0496108_1259714 | 3300048911 | Bacteria | 623 |
| 481 | Ga0496109_0037150 | 3300048912 | Bacteria | 4400 |
| 482 | Ga0496109_0040361 | 3300048912 | Bacteria | 4227 |
| 483 | Ga0496109_0052015 | 3300048912 | Bacteria | 3732 |
| 484 | Ga0496109_0172056 | 3300048912 | Bacteria | 2032 |
| 485 | Ga0496109_0239266 | 3300048912 | Bacteria | 1708 |
| 486 | Ga0496109_0292156 | 3300048912 | Bacteria | 1537 |
| 487 | Ga0496109_0300912 | 3300048912 | Bacteria | 1512 |
| 488 | Ga0496109_0476115 | 3300048912 | Bacteria | 1179 |
| 489 | Ga0496109_0666749 | 3300048912 | Bacteria | 977 |
| 490 | Ga0496109_1257659 | 3300048912 | Bacteria | 676 |
| 491 | Ga0496109_1607354 | 3300048912 | Bacteria | 584 |
| 492 | Ga0496110_0012071 | 3300048913 | Bacteria | 7097 |
| 493 | Ga0496110_0074988 | 3300048913 | Bacteria | 3005 |
| 494 | Ga0496110_0230700 | 3300048913 | Bacteria | 1684 |
| 495 | Ga0496110_0314821 | 3300048913 | Bacteria | 1425 |
| 496 | Ga0496110_0399360 | 3300048913 | Bacteria | 1253 |
| 497 | Ga0496110_1232256 | 3300048913 | Bacteria | 657 |
| 498 | Ga0496111_0009271 | 3300048914 | Bacteria | 6561 |
| 499 | Ga0496111_0016882 | 3300048914 | Bacteria | 5038 |
| 500 | Ga0496111_0066209 | 3300048914 | Bacteria | 2623 |
| 501 | Ga0496111_0214663 | 3300048914 | Bacteria | 1429 |
| 502 | Ga0496112_0769622 | 3300048915 | Bacteria | 888 |
| 503 | Ga0496112_0882567 | 3300048915 | Bacteria | 817 |
| 504 | Ga0496113_0466445 | 3300048916 | Bacteria | 1015 |
| 505 | Ga0496113_0895868 | 3300048916 | Bacteria | 702 |
| 506 | Ga0496113_1138364 | 3300048916 | Bacteria | 611 |
| 507 | Ga0496114_0021416 | 3300048917 | Bacteria | 5260 |
| 508 | Ga0496114_0033306 | 3300048917 | Bacteria | 4245 |
| 509 | Ga0496114_0036911 | 3300048917 | Bacteria | 4039 |
| 510 | Ga0496114_0095695 | 3300048917 | Bacteria | 2527 |
| 511 | Ga0496114_0495805 | 3300048917 | Bacteria | 1080 |
| 512 | Ga0496114_0902991 | 3300048917 | Bacteria | 765 |
| 513 | Ga0496115_0009937 | 3300048918 | Bacteria | 7089 |
| 514 | Ga0496115_0016627 | 3300048918 | Bacteria | 5605 |
| 515 | Ga0496115_0334040 | 3300048918 | Bacteria | 1238 |
| 516 | Ga0496117_0001853 | 3300048920 | Bacteria | 28519 |
| 517 | Ga0496117_0034524 | 3300048920 | Bacteria | 3809 |
| 518 | Ga0496117_0065438 | 3300048920 | Bacteria | 2472 |
| 519 | Ga0496117_0323378 | 3300048920 | Bacteria | 807 |
| 520 | Ga0496118_0019417 | 3300048921 | Bacteria | 6075 |
| 521 | Ga0496118_0045177 | 3300048921 | Bacteria | 3442 |
| 522 | Ga0496118_0448561 | 3300048921 | Bacteria | 656 |
| 523 | Ga0496119_0012349 | 3300048922 | Bacteria | 6946 |
| 524 | Ga0496119_0039464 | 3300048922 | Bacteria | 3034 |
| 525 | Ga0496121_0143607 | 3300048924 | Bacteria | 1767 |
| 526 | Ga0496122_0019660 | 3300048925 | Bacteria | 6156 |
| 527 | Ga0496122_0056200 | 3300048925 | Bacteria | 2936 |
| 528 | Ga0496122_0209329 | 3300048925 | Bacteria | 1131 |
| 529 | Ga0496123_0029342 | 3300048926 | Bacteria | 4052 |
| 530 | Ga0496124_0173679 | 3300048927 | Bacteria | 1666 |
| 531 | Ga0496125_0078822 | 3300048928 | Bacteria | 2530 |
| 532 | Ga0496125_0103555 | 3300048928 | Bacteria | 2088 |
| 533 | Ga0496126_0006742 | 3300048929 | Bacteria | 12749 |
| 534 | Ga0496126_0022779 | 3300048929 | Bacteria | 6084 |
| 535 | Ga0496126_0041606 | 3300048929 | Bacteria | 4250 |
| 536 | Ga0496126_0784239 | 3300048929 | Bacteria | 733 |
| 537 | Ga0495678_040989 | 3300049459 | Bacteria | 1856 |
| 538 | Ga0501031_0149396 | 3300049568 | Bacteria | 1526 |
| 539 | Ga0501031_0438701 | 3300049568 | Bacteria | 844 |
| 540 | Ga0501032_0239816 | 3300049569 | Bacteria | 1178 |
| 541 | Ga0501032_0732361 | 3300049569 | Bacteria | 626 |
| 542 | Ga0501033_1028352 | 3300049570 | Bacteria | 550 |
| 543 | Ga0501034_0062190 | 3300049571 | Bacteria | 3749 |
| 544 | Ga0501034_0233932 | 3300049571 | Bacteria | 1785 |
| 545 | Ga0501034_1314728 | 3300049571 | Bacteria | 599 |
| 546 | Ga0501036_0129355 | 3300049572 | Bacteria | 2132 |
| 547 | Ga0501036_0168651 | 3300049572 | Bacteria | 1845 |
| 548 | Ga0501036_0237257 | 3300049572 | Bacteria | 1530 |
| 549 | Ga0501036_0356525 | 3300049572 | Bacteria | 1221 |
| 550 | Ga0501036_0585103 | 3300049572 | Bacteria | 927 |
| 551 | Ga0501037_0013100 | 3300049573 | Bacteria | 6115 |
| 552 | Ga0501037_0727668 | 3300049573 | Bacteria | 659 |
| 553 | Ga0501037_0838148 | 3300049573 | Bacteria | 605 |
| 554 | Ga0501037_0894403 | 3300049573 | Bacteria | 582 |
| 555 | Ga0501038_0052956 | 3300049574 | Bacteria | 3497 |
| 556 | Ga0501038_0581409 | 3300049574 | Bacteria | 849 |
| 557 | Ga0501040_0160456 | 3300049576 | Bacteria | 1589 |
| 558 | Ga0501040_0241842 | 3300049576 | Bacteria | 1287 |
| 559 | Ga0501041_0055884 | 3300049577 | Bacteria | 2411 |
| 560 | Ga0501041_0448170 | 3300049577 | Bacteria | 819 |
| 561 | Ga0501043_0011638 | 3300049579 | Bacteria | 6885 |
| 562 | Ga0501046_0174114 | 3300049580 | Bacteria | 1613 |
| 563 | Ga0501046_0273569 | 3300049580 | Bacteria | 1238 |
| 564 | Ga0501047_0113842 | 3300049581 | Bacteria | 2587 |
| 565 | Ga0501047_0313217 | 3300049581 | Bacteria | 1410 |
| 566 | Ga0501048_0172096 | 3300049582 | Bacteria | 1534 |
| 567 | Ga0501048_0341983 | 3300049582 | Bacteria | 1067 |
| 568 | Ga0501067_0014980 | 3300049583 | Bacteria | 4290 |
| 569 | Ga0501068_0017609 | 3300049584 | Bacteria | 4134 |
| 570 | Ga0501069_0002444 | 3300049585 | Bacteria | 9470 |
| 571 | Ga0501069_0034320 | 3300049585 | Bacteria | 2794 |
| 572 | Ga0501069_0204483 | 3300049585 | Bacteria | 1145 |
| 573 | Ga0501070_0002470 | 3300049586 | Bacteria | 16196 |
| 574 | Ga0501070_0024886 | 3300049586 | Bacteria | 5020 |
| 575 | Ga0501070_0497569 | 3300049586 | Bacteria | 979 |
| 576 | Ga0501070_0555461 | 3300049586 | Bacteria | 919 |
| 577 | Ga0501070_0785183 | 3300049586 | Bacteria | 749 |
| 578 | Ga0501071_0019149 | 3300049587 | Bacteria | 4749 |
| 579 | Ga0501071_0020309 | 3300049587 | Bacteria | 4615 |
| 580 | Ga0501071_0211177 | 3300049587 | Bacteria | 1459 |
| 581 | Ga0501072_0209287 | 3300049588 | Bacteria | 1554 |
| 582 | Ga0501072_0332237 | 3300049588 | Bacteria | 1207 |
| 583 | Ga0501072_0647870 | 3300049588 | Bacteria | 832 |
| 584 | Ga0501073_0000012 | 3300049589 | Bacteria | 161319 |
| 585 | Ga0501073_0036514 | 3300049589 | Bacteria | 3491 |
| 586 | Ga0501073_0077203 | 3300049589 | Bacteria | 2318 |
| 587 | Ga0501073_0884815 | 3300049589 | Bacteria | 615 |
| 588 | Ga0501074_1087797 | 3300049590 | Bacteria | 561 |
| 589 | Ga0501075_0141592 | 3300049591 | Bacteria | 1833 |
| 590 | Ga0501075_0874742 | 3300049591 | Bacteria | 683 |
| 591 | Ga0501076_0118667 | 3300049592 | Bacteria | 2142 |
| 592 | Ga0501076_0616941 | 3300049592 | Bacteria | 895 |
| 593 | Ga0501076_0623191 | 3300049592 | Bacteria | 890 |
| 594 | Ga0501077_0004783 | 3300049593 | Bacteria | 8229 |
| 595 | Ga0501079_0144926 | 3300049741 | Bacteria | 1851 |
| 596 | Ga0501079_0803949 | 3300049741 | Bacteria | 740 |
| 597 | Ga0501080_0000025 | 3300049742 | Bacteria | 89908 |
| 598 | Ga0501080_0054066 | 3300049742 | Bacteria | 3739 |
| 599 | Ga0501080_0110634 | 3300049742 | Bacteria | 2546 |
| 600 | Ga0501080_0654118 | 3300049742 | Bacteria | 930 |
| 601 | Ga0501083_0021277 | 3300049744 | Bacteria | 4506 |
| 602 | Ga0501083_1124837 | 3300049744 | Bacteria | 511 |
| 603 | Ga0501035_0405810 | 3300049822 | Bacteria | 1133 |
| 604 | Ga0501044_0127600 | 3300049823 | Bacteria | 2540 |
| 605 | Ga0501045_0079459 | 3300049824 | Bacteria | 2418 |
| 606 | nmdc:mga00v17_40931_c2 | 3300050491 | Bacteria | 919 |
| 607 | nmdc:mga00v17_499105_c1 | 3300050491 | Bacteria | 789 |
| 608 | nmdc:mga00v17_50005_c1 | 3300050491 | Bacteria | 2538 |
| 609 | nmdc:mga0yw44_28393_c1 | 3300050492 | Bacteria | 3217 |
| 610 | nmdc:mga0yw44_425117_c1 | 3300050492 | Bacteria | 900 |
| 611 | nmdc:mga0yw44_86031_c1 | 3300050492 | Bacteria | 1979 |
| 612 | nmdc:mga06z11_3085_c1 | 3300050494 | Bacteria | 6420 |
| 613 | nmdc:mga06z11_344411_c1 | 3300050494 | Bacteria | 891 |
| 614 | nmdc:mga08y16_475533_c1 | 3300050511 | Bacteria | 1272 |
| 615 | nmdc:mga0n895_486885_c1 | 3300050512 | Bacteria | 1244 |
| 616 | nmdc:mga0rr50_43836_c1 | 3300050513 | Bacteria | 3277 |
| 617 | nmdc:mga08x19_522649_c1 | 3300050514 | Bacteria | 839 |
| 618 | nmdc:mga0a205_383857_c1 | 3300050515 | Bacteria | 1270 |
| 619 | Ga0500635_0000004 | 3300053080 | Bacteria | 210675 |
| 620 | Ga0500635_0027571 | 3300053080 | Bacteria | 1807 |
| 621 | Ga0495655_0047544 | 3300053083 | Bacteria | 1123 |
| 622 | Ga0495619_0051317 | 3300053085 | Bacteria | 2725 |
| 623 | Ga0495619_0382325 | 3300053085 | Bacteria | 973 |
| 624 | Ga0495619_0743776 | 3300053085 | Bacteria | 665 |
| 625 | Ga0500578_0012628 | 3300053086 | Bacteria | 5446 |
| 626 | Ga0500646_0027144 | 3300053090 | Bacteria | 1556 |
| 627 | Ga0500566_0202319 | 3300053094 | Bacteria | 1001 |
| 628 | Ga0500654_013375 | 3300053099 | Bacteria | 5495 |
| 629 | Ga0500553_024647 | 3300053101 | Bacteria | 3033 |
| 630 | Ga0500554_024750 | 3300053102 | Bacteria | 1704 |
| 631 | Ga0500560_049264 | 3300053107 | Bacteria | 1347 |
| 632 | Ga0500569_003105 | 3300053109 | Bacteria | 3355 |
| 633 | Ga0500628_001225 | 3300053129 | Bacteria | 4440 |
| 634 | Ga0500658_0001007 | 3300053134 | Bacteria | 11492 |
| 635 | Ga0500561_0012243 | 3300053137 | Bacteria | 1825 |
| 636 | Ga0500573_0009227 | 3300053140 | Bacteria | 5465 |
| 637 | Ga0500573_0059430 | 3300053140 | Bacteria | 2191 |
| 638 | Ga0500573_0064224 | 3300053140 | Bacteria | 2100 |
| 639 | Ga0500573_0064225 | 3300053140 | Bacteria | 2100 |
| 640 | Ga0500573_0272957 | 3300053140 | Bacteria | 860 |
| 641 | Ga0500573_0289973 | 3300053140 | Bacteria | 823 |
| 642 | Ga0500573_0369965 | 3300053140 | Bacteria | 689 |
| 643 | Ga0500577_0001752 | 3300053142 | Bacteria | 5553 |
| 644 | Ga0500577_0005114 | 3300053142 | Bacteria | 3511 |
| 645 | Ga0500577_0021406 | 3300053142 | Bacteria | 2131 |
| 646 | Ga0500579_055233 | 3300053143 | Bacteria | 2399 |
| 647 | Ga0500600_0014464 | 3300053149 | Bacteria | 4799 |
| 648 | Ga0500600_0211700 | 3300053149 | Bacteria | 903 |
| 649 | Ga0500603_005445 | 3300053150 | Bacteria | 2737 |
| 650 | Ga0500616_0039693 | 3300053153 | Bacteria | 2536 |
| 651 | Ga0500633_0002479 | 3300053160 | Bacteria | 3809 |
| 652 | Ga0500634_0003502 | 3300053161 | Bacteria | 6994 |
| 653 | Ga0500636_0296382 | 3300053177 | Bacteria | 799 |
| 654 | Ga0500645_020515 | 3300053730 | Bacteria | 2048 |
| 655 | Ga0500587_001002 | 3300053739 | Bacteria | 3815 |
| 656 | Ga0501084_0026450 | 3300054114 | Bacteria | 4842 |
| 657 | Ga0501084_0055720 | 3300054114 | Bacteria | 3307 |
| 658 | Ga0501084_0083088 | 3300054114 | Bacteria | 2688 |
| 659 | Ga0501084_1046738 | 3300054114 | Bacteria | 685 |
| 660 | Ga0501082_0048009 | 3300060353 | Bacteria | 3679 |
| 661 | Ga0501082_0292836 | 3300060353 | Bacteria | 1417 |
| 662 | Ga0501082_0580646 | 3300060353 | Bacteria | 981 |
| 663 | Ga0466962_0017206 | 3300061719 | Bacteria | 3483 |
| 664 | Ga0466962_0022723 | 3300061719 | Bacteria | 3014 |
| 665 | 2554259603 | 2554235005 | Bacteria | 6457341 |
| 666 | 2585300945 | 2582581312 | Bacteria | 7308206 |
| 667 | 2616695551 | 2616644814 | Bacteria | 11555299 |
| 668 | 2616906360 | 2616644941 | Bacteria | 8510691 |
| 669 | 2643753157 | 2643221546 | Bacteria | 2910897 |
| 670 | 2643760270 | 2643221548 | Bacteria | 8053412 |
| 671 | 2643785062 | 2643221553 | Bacteria | 3544260 |
| 672 | 2643874535 | 2643221572 | Bacteria | 3614809 |
| 673 | 2643904433 | 2643221578 | Bacteria | 9213798 |
| 674 | 2644083348 | 2643221613 | Bacteria | 4622396 |
| 675 | 2644093959 | 2643221615 | Bacteria | 5487866 |
| 676 | 2644323803 | 2643221657 | Bacteria | 5490246 |
| 677 | 2644381591 | 2643221669 | Bacteria | 3611286 |
| 678 | 2644406299 | 2643221673 | Bacteria | 9196637 |
| 679 | 2644460034 | 2643221682 | Bacteria | 6743283 |
| 680 | 2644666367 | 2643221721 | Bacteria | 4486924 |
| 681 | 2644679400 | 2643221724 | Bacteria | 3593515 |
| 682 | 2730228909 | 2728369380 | Bacteria | 3620317 |
| 683 | 2738695719 | 2738541272 | Bacteria | 6848551 |
| 684 | 2739326140 | 2738543027 | Bacteria | 6409078 |
| 685 | 2739605017 | 2739367654 | Bacteria | 6049412 |
| 686 | 2747955013 | 2747842429 | Bacteria | 3914386 |
| 687 | 2774383558 | 2773857759 | Bacteria | 2963774 |
| 688 | 2808884931 | 2808606368 | Bacteria | 3174172 |
| 689 | 2809028226 | 2808606394 | Bacteria | 6248540 |
| 690 | 2811846906 | 2808606982 | Bacteria | 7791042 |
| 691 | 2812322321 | 2811994872 | Bacteria | 4121241 |
| 692 | 2819699798 | 2818991463 | Bacteria | 7948711 |
| 693 | 2821269244 | 2821268502 | Bacteria | 3750023 |
| 694 | 2835189148 | 2835188231 | Bacteria | 3476928 |
| 695 | 2839987242 | 2839986021 | Bacteria | 3685650 |
| 696 | 2842889354 | 2842888712 | Bacteria | 4279094 |
| 697 | 2852646643 | 2852646457 | Bacteria | 3408613 |
| 698 | 2857722237 | 2857720070 | Bacteria | 3189373 |
| 699 | 2857732110 | 2857729791 | Bacteria | 4040535 |
| 700 | 2857736053 | 2857733635 | Bacteria | 3532004 |
| 701 | 2862186311 | 2862178590 | Bacteria | 8583590 |
| 702 | 2862292401 | 2862290372 | Bacteria | 7471434 |
| 703 | 2870624686 | 2870622029 | Bacteria | 3643329 |
| 704 | 2873157737 | 2873151551 | Bacteria | 8625867 |
| 705 | 2875392638 | 2875391855 | Bacteria | 7600475 |
| 706 | 2883821861 | 2883821847 | Bacteria | 5121194 |
| 707 | 2895663450 | 2895660088 | Bacteria | 3782833 |
| 708 | 2919396712 | 2919395869 | Bacteria | 3704152 |
| 709 | 2928091081 | 2928090899 | Bacteria | 3158267 |
| 710 | 2932431906 | 2932431166 | Bacteria | 4215299 |
| 711 | 2935393669 | 2935390628 | Bacteria | 7043367 |
| 712 | 2939660269 | 2939657138 | Bacteria | 3740283 |
| 713 | 2945971055 | 2945968032 | Bacteria | 4111363 |
| 714 | 2946052076 | 2946045630 | Bacteria | 8527308 |
| 715 | 2946081658 | 2946080515 | Bacteria | 4310960 |
| 716 | 2966604474 | 2966598605 | Bacteria | 7676064 |
| 717 | 2974298173 | 2974294766 | Bacteria | 3767688 |
| 718 | 2974325592 | 2974324384 | Bacteria | 3750535 |
| 719 | 2984582160 | 2984580707 | Bacteria | 3351387 |
| 720 | 2990093776 | 2990088156 | Bacteria | 6657676 |
| 721 | 2997453950 | 2997451912 | Bacteria | 8492419 |
| 722 | 3006399503 | 3006393351 | Bacteria | 6615579 |
| 723 | 3006488361 | 3006486233 | Bacteria | 8157040 |
| 724 | 8004183745 | 8004182704 | Bacteria | 3391155 |
| 725 | 8008580806 | 8008574985 | Bacteria | 7815457 |
| 726 | 8025414873 | 8025413630 | Bacteria | 7014048 |
| 727 | 8025478898 | 8025478263 | Bacteria | 8209203 |
| 728 | 8056582261 | 8056579771 | Bacteria | 5840325 |
| 729 | Ga0105239_10242354 | |||
| 730 | 2214964665 | |||
| 731 | LJQas_1007539 | |||
| 732 | JGI24735J21928_10008034 | |||
| 733 | Ga0006562J51391_1107219 | |||
| 734 | Ga0070658_10034972 | |||
| 735 | Ga0070683_100007790 | |||
| 736 | Ga0070683_100140777 | |||
| 737 | Ga0070683_100526419 | |||
| 738 | Ga0070683_100709016 | |||
| 739 | Ga0070683_101760421 | |||
| 740 | Ga0070690_100277045 | |||
| 741 | Ga0070670_100389809 | |||
| 742 | Ga0068869_100085219 | |||
| 743 | Ga0070666_10162889 | |||
| 744 | Ga0070680_100000593 | |||
| 745 | Ga0070682_100025365 | |||
| 746 | Ga0068868_100026638 | |||
| 747 | Ga0068868_100194069 | |||
| 748 | Ga0070660_100009401 | |||
| 749 | Ga0070660_100159722 | |||
| 750 | Ga0070689_101459351 | |||
| 751 | Ga0070691_10034378 | |||
| 752 | Ga0070661_100611306 | |||
| 753 | Ga0070675_100225861 | |||
| 754 | Ga0070675_100612614 | |||
| 755 | Ga0070675_101114470 | |||
| 756 | Ga0070674_101057441 | |||
| 757 | Ga0070659_100030557 | |||
| 758 | Ga0070659_100093153 | |||
| 759 | Ga0070659_100844264 | |||
| 760 | Ga0070667_100192339 | |||
| 761 | Ga0070709_10145341 | |||
| 762 | Ga0070714_100065950 | |||
| 763 | Ga0070705_100029828 | |||
| 764 | Ga0070694_100144643 | |||
| 765 | Ga0070663_100109932 | |||
| 766 | Ga0070663_100876897 | |||
| 767 | Ga0070663_101644862 | |||
| 768 | Ga0070678_100074595 | |||
| 769 | Ga0070678_100224313 | |||
| 770 | Ga0070662_100059635 | |||
| 771 | Ga0070681_10000504 | |||
| 772 | Ga0070681_10786899 | |||
| 773 | Ga0068867_100096945 | |||
| 774 | Ga0070685_10198648 | |||
| 775 | Ga0070706_100188277 | |||
| 776 | Ga0070679_100000687 | |||
| 777 | Ga0070679_100008338 | |||
| 778 | Ga0070684_100002606 | |||
| 779 | Ga0068853_100077565 | |||
| 780 | Ga0068853_100194816 | |||
| 781 | Ga0070672_100028388 | |||
| 782 | Ga0070672_100266335 | |||
| 783 | Ga0070686_100060660 | |||
| 784 | Ga0070695_100058717 | |||
| 785 | Ga0070693_100026612 | |||
| 786 | Ga0070665_100000703 | |||
| 787 | Ga0070665_100186523 | |||
| 788 | Ga0070665_100501290 | |||
| 789 | Ga0070665_101226403 | |||
| 790 | Ga0070704_100029607 | |||
| 791 | Ga0068855_100270211 | |||
| 792 | Ga0070664_100068013 | |||
| 793 | Ga0070664_101723283 | |||
| 794 | Ga0068857_100007505 | |||
| 795 | Ga0068857_100083301 | |||
| 796 | Ga0068857_100366615 | |||
| 797 | Ga0068857_100932410 | |||
| 798 | Ga0068854_100129036 | |||
| 799 | Ga0068854_100672106 | |||
| 800 | Ga0068856_100056603 | |||
| 801 | Ga0068856_100740294 | |||
| 802 | Ga0068852_100127865 | |||
| 803 | Ga0068852_101837419 | |||
| 804 | Ga0068864_100033841 | |||
| 805 | Ga0068864_100042022 | |||
| 806 | Ga0068864_100796013 | |||
| 807 | Ga0068861_100165353 | |||
| 808 | Ga0068851_10111964 | |||
| 809 | Ga0068870_10659440 | |||
| 810 | Ga0068870_11162251 | |||
| 811 | Ga0068863_100068894 | |||
| 812 | Ga0068863_100086465 | |||
| 813 | Ga0068863_101608887 | |||
| 814 | Ga0068858_100297884 | |||
| 815 | Ga0068858_100468871 | |||
| 816 | Ga0068860_100005003 | |||
| 817 | Ga0068860_100378829 | |||
| 818 | Ga0075365_10023605 | |||
| 819 | Ga0075363_100065067 | |||
| 820 | Ga0075364_10034074 | |||
| 821 | Ga0075364_10072370 | |||
| 822 | Ga0075364_10207127 | |||
| 823 | Ga0075364_10479906 | |||
| 824 | Ga0075432_10048893 | |||
| 825 | Ga0070715_10286760 | |||
| 826 | Ga0075367_10006308 | |||
| 827 | Ga0075367_10083551 | |||
| 828 | Ga0097621_100126174 | |||
| 829 | Ga0097621_100893827 | |||
| 830 | Ga0075370_10067849 | |||
| 831 | Ga0075370_10085291 | |||
| 832 | Ga0075370_10163656 | |||
| 833 | Ga0075433_10153316 | |||
| 834 | Ga0068865_100115854 | |||
| 835 | Ga0075436_100009906 | |||
| 836 | Ga0075435_100065264 | |||
| 837 | Ga0105240_10196575 | |||
| 838 | Ga0111539_11151905 | |||
| 839 | Ga0105245_10003498 | |||
| 840 | Ga0105245_10524530 | |||
| 841 | Ga0105245_10763041 | |||
| 842 | Ga0105245_12164064 | |||
| 843 | Ga0105243_10462636 | |||
| 844 | Ga0105243_10487382 | |||
| 845 | Ga0105241_10687076 | |||
| 846 | Ga0105242_10069312 | |||
| 847 | Ga0105248_10002772 | |||
| 848 | Ga0105248_10126438 | |||
| 849 | Ga0105248_12831332 | |||
| 850 | Ga0105237_10064422 | |||
| 851 | Ga0105237_11108714 | |||
| 852 | Ga0105238_10025846 | |||
| 853 | Ga0105238_10522660 | |||
| 854 | Ga0105249_10061625 | |||
| 855 | Ga0105249_10105374 | |||
| 856 | Ga0105239_10000854 | |||
| 857 | Ga0105239_10128075 | |||
| 858 | Ga0105246_10000321 | |||
| 859 | Ga0105246_10015065 | |||
| 860 | Ga0105246_10288691 | |||
| 861 | Ga0157317_1002508 | |||
| 862 | Ga0157370_10052698 | |||
| 863 | Ga0157370_10596927 | |||
| 864 | Ga0157370_11165035 | |||
| 865 | Ga0157369_10015379 | |||
| 866 | Ga0157369_10047355 | |||
| 867 | Ga0157374_10043202 | |||
| 868 | Ga0157374_10062773 | |||
| 869 | Ga0157374_10164325 | |||
| 870 | Ga0157374_10256296 | |||
| 871 | Ga0157378_10378832 | |||
| 872 | Ga0163162_10039940 | |||
| 873 | Ga0163162_10113883 | |||
| 874 | Ga0163162_10842657 | |||
| 875 | Ga0157372_10010217 | |||
| 876 | Ga0157372_10078432 | |||
| 877 | Ga0157372_10434212 | |||
| 878 | Ga0157372_10658802 | |||
| 879 | Ga0157375_10188890 | |||
| 880 | Ga0157375_10248446 | |||
| 881 | Ga0157375_10352470 | |||
| 882 | Ga0157375_10563565 | |||
| 883 | Ga0157375_10818875 | |||
| 884 | Ga0157375_10922979 | |||
| 885 | Ga0157375_11317520 | |||
| 886 | Ga0163163_10059413 | |||
| 887 | Ga0163163_10075698 | |||
| 888 | Ga0163163_10158307 | |||
| 889 | Ga0163163_10171195 | |||
| 890 | Ga0163163_10173676 | |||
| 891 | Ga0163163_10303329 | |||
| 892 | Ga0157377_10219547 | |||
| 893 | Ga0157377_10326490 | |||
| 894 | Ga0157377_10687357 | |||
| 895 | Ga0157379_10091568 | |||
| 896 | Ga0157379_10467167 | |||
| 897 | Ga0157376_10191829 | |||
| 898 | Ga0157376_11193776 | |||
| 899 | Ga0157376_11533871 | |||
| 900 | Ga0163161_10018311 | |||
| 901 | Ga0206354_11136565 | |||
| 902 | Ga0206353_11561753 | |||
| 903 | Ga0206353_11575633 | |||
| 904 | Ga0209646_1000092 | |||
| 905 | Ga0207688_10025250 | |||
| 906 | Ga0207688_10032534 | |||
| 907 | Ga0207647_10099630 | |||
| 908 | Ga0207647_10306389 | |||
| 909 | Ga0207699_10039748 | |||
| 910 | Ga0207643_10634940 | |||
| 911 | Ga0207705_10017670 | |||
| 912 | Ga0207705_10356207 | |||
| 913 | Ga0207705_11147420 | |||
| 914 | Ga0207684_10163935 | |||
| 915 | Ga0207654_10173529 | |||
| 916 | Ga0207707_10001138 | |||
| 917 | Ga0207707_10650073 | |||
| 918 | Ga0207671_10032200 | |||
| 919 | Ga0207660_10000439 | |||
| 920 | Ga0207657_10006341 | |||
| 921 | Ga0207657_10011446 | |||
| 922 | Ga0207657_10050721 | |||
| 923 | Ga0207657_10052371 | |||
| 924 | Ga0207649_10141054 | |||
| 925 | Ga0207652_10004366 | |||
| 926 | Ga0207652_10190362 | |||
| 927 | Ga0207694_10079308 | |||
| 928 | Ga0207659_10415169 | |||
| 929 | Ga0207687_10004541 | |||
| 930 | Ga0207687_10163401 | |||
| 931 | Ga0207687_10167298 | |||
| 932 | Ga0207700_10390618 | |||
| 933 | Ga0207664_10769970 | |||
| 934 | Ga0207644_10478957 | |||
| 935 | Ga0207644_10861506 | |||
| 936 | Ga0207690_10047915 | |||
| 937 | Ga0207690_10626709 | |||
| 938 | Ga0207690_11113561 | |||
| 939 | Ga0207706_10029258 | |||
| 940 | Ga0207686_10541169 | |||
| 941 | Ga0207709_10046459 | |||
| 942 | Ga0207709_10409907 | |||
| 943 | Ga0207669_10394756 | |||
| 944 | Ga0207669_10666905 | |||
| 945 | Ga0207704_10207127 | |||
| 946 | Ga0207691_10125963 | |||
| 947 | Ga0207691_10150892 | |||
| 948 | Ga0207691_10285212 | |||
| 949 | Ga0207711_10002845 | |||
| 950 | Ga0207711_10106349 | |||
| 951 | Ga0207689_10012347 | |||
| 952 | Ga0207661_10005367 | |||
| 953 | Ga0207661_10031845 | |||
| 954 | Ga0207661_10059579 | |||
| 955 | Ga0207661_10103468 | |||
| 956 | Ga0207661_10424400 | |||
| 957 | Ga0207661_10838965 | |||
| 958 | Ga0207661_11468887 | |||
| 959 | Ga0207667_10273630 | |||
| 960 | Ga0207667_10458980 | |||
| 961 | Ga0207667_10724077 | |||
| 962 | Ga0207712_10054346 | |||
| 963 | Ga0207640_10100925 | |||
| 964 | Ga0207658_10083803 | |||
| 965 | Ga0207677_10203174 | |||
| 966 | Ga0207677_10885559 | |||
| 967 | Ga0207703_10406433 | |||
| 968 | Ga0207639_10338843 | |||
| 969 | Ga0207678_10012055 | |||
| 970 | Ga0207678_10514296 | |||
| 971 | Ga0207702_10814260 | |||
| 972 | Ga0207641_10021123 | |||
| 973 | Ga0207641_10978552 | |||
| 974 | Ga0207641_11617280 | |||
| 975 | Ga0207641_11628497 | |||
| 976 | Ga0207648_10597713 | |||
| 977 | Ga0207676_10022186 | |||
| 978 | Ga0207674_10012449 | |||
| 979 | Ga0207674_10220239 | |||
| 980 | Ga0207674_10342989 | |||
| 981 | Ga0207675_100042929 | |||
| 982 | Ga0207683_10824348 | |||
| 983 | Ga0207683_11170330 | |||
| 984 | Ga0207698_11445498 | |||
| 985 | Ga0207428_10089096 | |||
| 986 | Ga0207428_10248189 | |||
| 987 | Ga0268266_10001679 | |||
| 988 | Ga0268266_10106176 | |||
| 989 | Ga0268266_11783696 | |||
| 990 | Ga0268264_10001670 | |||
| 991 | Ga0307517_10013215 | |||
| 992 | Ga0307511_10059381 | |||
| 993 | Ga0316177_1033974 | |||
| 994 | Ga0314311_1204030 | |||
| 995 | Ga0316181_1066740 | |||
| 996 | Ga0307509_10554750 | |||
| 997 | Ga0307508_10009221 | |||
| 998 | Ga0307514_10029647 | |||
| 999 | Ga0307514_10073002 | |||
| 1000 | Ga0307514_10179282 | |||
| 1001 | Ga0316576_10121777 | |||
| 1002 | Ga0316578_10229823 | |||
| 1003 | Ga0307516_10027823 | |||
| 1004 | Ga0316577_10451297 | |||
| 1005 | Ga0307413_11039975 | |||
| 1006 | Ga0307406_10022279 | |||
| 1007 | Ga0307412_10223491 | |||
| 1008 | Ga0307409_100329281 | |||
| 1009 | Ga0307409_100786929 | |||
| 1010 | Ga0307416_100692600 | |||
| 1011 | Ga0307414_10841091 | |||
| 1012 | Ga0307414_11084688 | |||
| 1013 | Ga0307415_100029484 | |||
| 1014 | Ga0307415_100756440 | |||
| 1015 | Ga0307510_10344117 | |||
| 1016 | Ga0373938_0081763 | |||
| 1017 | Ga0373928_0008556 | |||
| 1018 | Ga0373951_0177960 | |||
| 1019 | Ga0373932_0048535 | |||
| 1020 | Ga0373939_0109014 | |||
| 1021 | Ga0373941_0230041 | |||
| 1022 | Ga0373942_0018109 | |||
| 1023 | Ga0373961_0250033 | |||
| 1024 | Ga0373962_0017092 | |||
| 1025 | Ga0316574_0002391 | |||
| 1026 | Ga0373931_0006896 | |||
| 1027 | Ga0310109_000028 | |||
| 1028 | Ga0316584_0083328 | |||
| 1029 | Ga0395900_1382251 | |||
| 1030 | Ga0395898_1555242 | |||
| 1031 | Ga0436365_0349873 | |||
| 1032 | Ga0451787_466674 | |||
| 1033 | Ga0451787_547381 | |||
| 1034 | Ga0451789_0816307 | |||
| 1035 | Ga0451791_1203085 | |||
| 1036 | Ga0451793_1028755 | |||
| 1037 | Ga0451793_1615984 | |||
| 1038 | Ga0451797_0561444 | |||
| 1039 | Ga0451800_0964045 | |||
| 1040 | Ga0451806_433624 | |||
| 1041 | Ga0451837_0396473 | |||
| 1042 | Ga0451837_1265856 | |||
| 1043 | Ga0451841_0599155 | |||
| 1044 | Ga0451853_0805780 | |||
| 1045 | Ga0451853_3314615 | |||
| 1046 | Ga0451853_3503667 | |||
| 1047 | Ga0451853_3681975 | |||
| 1048 | Ga0439448_0367376 | |||
| 1049 | Ga0450903_047872 | |||
| 1050 | Ga0450901_013889 | |||
| 1051 | Ga0466972_0013770 | |||
| 1052 | Ga0466972_0022464 | |||
| 1053 | Ga0466972_0096863 | |||
| 1054 | Ga0466965_0024665 | |||
| 1055 | Ga0466961_0004088 | |||
| 1056 | Ga0466961_0110198 | |||
| 1057 | Ga0466961_0260256 | |||
| 1058 | Ga0466963_0001540 | |||
| 1059 | Ga0466963_0011856 | |||
| 1060 | Ga0466963_0023851 | |||
| 1061 | Ga0466963_0199041 | |||
| 1062 | Ga0466963_0213958 | |||
| 1063 | Ga0466963_0372912 | |||
| 1064 | Ga0466964_0012077 | |||
| 1065 | Ga0466970_0019511 | |||
| 1066 | Ga0466957_0041339 | |||
| 1067 | Ga0466957_0237023 | |||
| 1068 | Ga0466960_0238828 | |||
| 1069 | Ga0466960_0387659 | |||
| 1070 | Ga0466959_0748438 | |||
| 1071 | Ga0451576_0213552 | |||
| 1072 | Ga0466958_0003380 | |||
| 1073 | Ga0466958_0082845 | |||
| 1074 | Ga0466958_0198050 | |||
| 1075 | Ga0466967_0008714 | |||
| 1076 | Ga0466967_0021229 | |||
| 1077 | Ga0466967_0036042 | |||
| 1078 | Ga0466967_0094812 | |||
| 1079 | Ga0466967_0111733 | |||
| 1080 | Ga0466967_0168580 | |||
| 1081 | Ga0466967_0282535 | |||
| 1082 | Ga0466967_0517392 | |||
| 1083 | Ga0466967_0704018 | |||
| 1084 | Ga0466967_1697806 | |||
| 1085 | Ga0466967_1986649 | |||
| 1086 | Ga0495617_093731 | |||
| 1087 | Ga0495627_000262 | |||
| 1088 | Ga0495627_027396 | |||
| 1089 | Ga0495603_0000374 | |||
| 1090 | Ga0495603_0005398 | |||
| 1091 | Ga0495603_0055067 | |||
| 1092 | Ga0495590_0040527 | |||
| 1093 | Ga0495629_0000666 | |||
| 1094 | Ga0495629_0007639 | |||
| 1095 | Ga0495629_0273742 | |||
| 1096 | Ga0495629_0359176 | |||
| 1097 | Ga0495638_0300118 | |||
| 1098 | Ga0495641_0054811 | |||
| 1099 | Ga0495641_0349522 | |||
| 1100 | Ga0495651_0055979 | |||
| 1101 | Ga0495653_0091515 | |||
| 1102 | Ga0495650_0001841 | |||
| 1103 | Ga0495580_0110901 | |||
| 1104 | Ga0495582_0068881 | |||
| 1105 | Ga0495605_0461208 | |||
| 1106 | Ga0495639_0009678 | |||
| 1107 | Ga0495664_0251553 | |||
| 1108 | Ga0495664_0524454 | |||
| 1109 | Ga0495584_0061402 | |||
| 1110 | Ga0495585_0035759 | |||
| 1111 | Ga0495585_0119935 | |||
| 1112 | Ga0495594_0001394 | |||
| 1113 | Ga0495594_0010757 | |||
| 1114 | Ga0495594_0039157 | |||
| 1115 | Ga0495596_0291009 | |||
| 1116 | Ga0495607_0112750 | |||
| 1117 | Ga0495607_0197867 | |||
| 1118 | Ga0495583_0083525 | |||
| 1119 | Ga0495606_0287796 | |||
| 1120 | Ga0495608_0907421 | |||
| 1121 | Ga0495610_0187979 | |||
| 1122 | Ga0495618_0121679 | |||
| 1123 | Ga0495620_0294001 | |||
| 1124 | Ga0495630_0549004 | |||
| 1125 | Ga0495630_0709237 | |||
| 1126 | Ga0495631_0034279 | |||
| 1127 | Ga0495632_0022589 | |||
| 1128 | Ga0495632_0470511 | |||
| 1129 | Ga0495643_0004976 | |||
| 1130 | Ga0495643_0007753 | |||
| 1131 | Ga0495644_0037629 | |||
| 1132 | Ga0495642_0051154 | |||
| 1133 | Ga0495652_0161750 | |||
| 1134 | Ga0495654_0022177 | |||
| 1135 | Ga0495640_0063440 | |||
| 1136 | Ga0495640_0576531 | |||
| 1137 | Ga0495586_0037565 | |||
| 1138 | Ga0495587_0323031 | |||
| 1139 | Ga0495609_0010370 | |||
| 1140 | Ga0495622_0155517 | |||
| 1141 | Ga0495633_0054791 | |||
| 1142 | Ga0495667_0106588 | |||
| 1143 | Ga0495668_0177377 | |||
| 1144 | Ga0495634_0023050 | |||
| 1145 | Ga0495611_0231109 | |||
| 1146 | Ga0495661_0016082 | |||
| 1147 | Ga0495661_0442295 | |||
| 1148 | Ga0495588_0026378 | |||
| 1149 | Ga0495588_0187470 | |||
| 1150 | Ga0495657_0048192 | |||
| 1151 | Ga0495657_0146748 | |||
| 1152 | Ga0495669_0010746 | |||
| 1153 | Ga0495613_0002942 | |||
| 1154 | Ga0495613_0170534 | |||
| 1155 | Ga0495670_0005482 | |||
| 1156 | Ga0495670_0243656 | |||
| 1157 | Ga0495589_0070168 | |||
| 1158 | Ga0495589_0300985 | |||
| 1159 | Ga0495600_0011710 | |||
| 1160 | Ga0495581_0043085 | |||
| 1161 | Ga0495581_0233917 | |||
| 1162 | Ga0495604_0058037 | |||
| 1163 | Ga0495636_0271274 | |||
| 1164 | Ga0495674_0432979 | |||
| 1165 | Ga0495676_0003574 | |||
| 1166 | Ga0495676_0013762 | |||
| 1167 | Ga0495680_0007843 | |||
| 1168 | Ga0495683_0121766 | |||
| 1169 | Ga0495687_056721 | |||
| 1170 | Ga0495687_155422 | |||
| 1171 | Ga0495679_023223 | |||
| 1172 | Ga0495685_000996 | |||
| 1173 | Ga0495681_0001704 | |||
| 1174 | Ga0495684_0108341 | |||
| 1175 | Ga0495686_0089247 | |||
| 1176 | Ga0495686_0433329 | |||
| 1177 | Ga0495602_0354394 | |||
| 1178 | Ga0495614_0000213 | |||
| 1179 | Ga0496101_0082388 | |||
| 1180 | Ga0496101_0372183 | |||
| 1181 | Ga0496102_0000739 | |||
| 1182 | Ga0496102_0186854 | |||
| 1183 | Ga0496102_0210045 | |||
| 1184 | Ga0496102_0406045 | |||
| 1185 | Ga0496102_0539400 | |||
| 1186 | Ga0496103_0294185 | |||
| 1187 | Ga0496103_0398302 | |||
| 1188 | Ga0496103_0594050 | |||
| 1189 | Ga0496103_0825674 | |||
| 1190 | Ga0496104_0009991 | |||
| 1191 | Ga0496104_0102398 | |||
| 1192 | Ga0496104_0621517 | |||
| 1193 | Ga0496104_0639970 | |||
| 1194 | Ga0496105_0002612 | |||
| 1195 | Ga0496105_0221541 | |||
| 1196 | Ga0496105_0515615 | |||
| 1197 | Ga0496106_0024661 | |||
| 1198 | Ga0496106_0082222 | |||
| 1199 | Ga0496107_0161336 | |||
| 1200 | Ga0496108_0127201 | |||
| 1201 | Ga0496108_0188289 | |||
| 1202 | Ga0496108_0228823 | |||
| 1203 | Ga0496108_0297779 | |||
| 1204 | Ga0496108_0327998 | |||
| 1205 | Ga0496108_0501433 | |||
| 1206 | Ga0496108_0825410 | |||
| 1207 | Ga0496108_1109716 | |||
| 1208 | Ga0496108_1259714 | |||
| 1209 | Ga0496109_0037150 | |||
| 1210 | Ga0496109_0040361 | |||
| 1211 | Ga0496109_0052015 | |||
| 1212 | Ga0496109_0172056 | |||
| 1213 | Ga0496109_0239266 | |||
| 1214 | Ga0496109_0292156 | |||
| 1215 | Ga0496109_0300912 | |||
| 1216 | Ga0496109_0476115 | |||
| 1217 | Ga0496109_0666749 | |||
| 1218 | Ga0496109_1257659 | |||
| 1219 | Ga0496109_1607354 | |||
| 1220 | Ga0496110_0012071 | |||
| 1221 | Ga0496110_0074988 | |||
| 1222 | Ga0496110_0230700 | |||
| 1223 | Ga0496110_0314821 | |||
| 1224 | Ga0496110_0399360 | |||
| 1225 | Ga0496110_1232256 | |||
| 1226 | Ga0496111_0009271 | |||
| 1227 | Ga0496111_0016882 | |||
| 1228 | Ga0496111_0066209 | |||
| 1229 | Ga0496111_0214663 | |||
| 1230 | Ga0496112_0769622 | |||
| 1231 | Ga0496112_0882567 | |||
| 1232 | Ga0496113_0466445 | |||
| 1233 | Ga0496113_0895868 | |||
| 1234 | Ga0496113_1138364 | |||
| 1235 | Ga0496114_0021416 | |||
| 1236 | Ga0496114_0033306 | |||
| 1237 | Ga0496114_0036911 | |||
| 1238 | Ga0496114_0095695 | |||
| 1239 | Ga0496114_0495805 | |||
| 1240 | Ga0496114_0902991 | |||
| 1241 | Ga0496115_0009937 | |||
| 1242 | Ga0496115_0016627 | |||
| 1243 | Ga0496115_0334040 | |||
| 1244 | Ga0496117_0001853 | |||
| 1245 | Ga0496117_0034524 | |||
| 1246 | Ga0496117_0065438 | |||
| 1247 | Ga0496117_0323378 | |||
| 1248 | Ga0496118_0019417 | |||
| 1249 | Ga0496118_0045177 | |||
| 1250 | Ga0496118_0448561 | |||
| 1251 | Ga0496119_0012349 | |||
| 1252 | Ga0496119_0039464 | |||
| 1253 | Ga0496121_0143607 | |||
| 1254 | Ga0496122_0019660 | |||
| 1255 | Ga0496122_0056200 | |||
| 1256 | Ga0496122_0209329 | |||
| 1257 | Ga0496123_0029342 | |||
| 1258 | Ga0496124_0173679 | |||
| 1259 | Ga0496125_0078822 | |||
| 1260 | Ga0496125_0103555 | |||
| 1261 | Ga0496126_0006742 | |||
| 1262 | Ga0496126_0022779 | |||
| 1263 | Ga0496126_0041606 | |||
| 1264 | Ga0496126_0784239 | |||
| 1265 | Ga0495678_040989 | |||
| 1266 | Ga0501031_0149396 | |||
| 1267 | Ga0501031_0438701 | |||
| 1268 | Ga0501032_0239816 | |||
| 1269 | Ga0501032_0732361 | |||
| 1270 | Ga0501033_1028352 | |||
| 1271 | Ga0501034_0062190 | |||
| 1272 | Ga0501034_0233932 | |||
| 1273 | Ga0501034_1314728 | |||
| 1274 | Ga0501036_0129355 | |||
| 1275 | Ga0501036_0168651 | |||
| 1276 | Ga0501036_0237257 | |||
| 1277 | Ga0501036_0356525 | |||
| 1278 | Ga0501036_0585103 | |||
| 1279 | Ga0501037_0013100 | |||
| 1280 | Ga0501037_0727668 | |||
| 1281 | Ga0501037_0838148 | |||
| 1282 | Ga0501037_0894403 | |||
| 1283 | Ga0501038_0052956 | |||
| 1284 | Ga0501038_0581409 | |||
| 1285 | Ga0501040_0160456 | |||
| 1286 | Ga0501040_0241842 | |||
| 1287 | Ga0501041_0055884 | |||
| 1288 | Ga0501041_0448170 | |||
| 1289 | Ga0501043_0011638 | |||
| 1290 | Ga0501046_0174114 | |||
| 1291 | Ga0501046_0273569 | |||
| 1292 | Ga0501047_0113842 | |||
| 1293 | Ga0501047_0313217 | |||
| 1294 | Ga0501048_0172096 | |||
| 1295 | Ga0501048_0341983 | |||
| 1296 | Ga0501067_0014980 | |||
| 1297 | Ga0501068_0017609 | |||
| 1298 | Ga0501069_0002444 | |||
| 1299 | Ga0501069_0034320 | |||
| 1300 | Ga0501069_0204483 | |||
| 1301 | Ga0501070_0002470 | |||
| 1302 | Ga0501070_0024886 | |||
| 1303 | Ga0501070_0497569 | |||
| 1304 | Ga0501070_0555461 | |||
| 1305 | Ga0501070_0785183 | |||
| 1306 | Ga0501071_0019149 | |||
| 1307 | Ga0501071_0020309 | |||
| 1308 | Ga0501071_0211177 | |||
| 1309 | Ga0501072_0209287 | |||
| 1310 | Ga0501072_0332237 | |||
| 1311 | Ga0501072_0647870 | |||
| 1312 | Ga0501073_0000012 | |||
| 1313 | Ga0501073_0036514 | |||
| 1314 | Ga0501073_0077203 | |||
| 1315 | Ga0501073_0884815 | |||
| 1316 | Ga0501074_1087797 | |||
| 1317 | Ga0501075_0141592 | |||
| 1318 | Ga0501075_0874742 | |||
| 1319 | Ga0501076_0118667 | |||
| 1320 | Ga0501076_0616941 | |||
| 1321 | Ga0501076_0623191 | |||
| 1322 | Ga0501077_0004783 | |||
| 1323 | Ga0501079_0144926 | |||
| 1324 | Ga0501079_0803949 | |||
| 1325 | Ga0501080_0000025 | |||
| 1326 | Ga0501080_0054066 | |||
| 1327 | Ga0501080_0110634 | |||
| 1328 | Ga0501080_0654118 | |||
| 1329 | Ga0501083_0021277 | |||
| 1330 | Ga0501083_1124837 | |||
| 1331 | Ga0501035_0405810 | |||
| 1332 | Ga0501044_0127600 | |||
| 1333 | Ga0501045_0079459 | |||
| 1334 | nmdc:mga00v17_40931_c2 | |||
| 1335 | nmdc:mga00v17_499105_c1 | |||
| 1336 | nmdc:mga00v17_50005_c1 | |||
| 1337 | nmdc:mga0yw44_28393_c1 | |||
| 1338 | nmdc:mga0yw44_425117_c1 | |||
| 1339 | nmdc:mga0yw44_86031_c1 | |||
| 1340 | nmdc:mga06z11_3085_c1 | |||
| 1341 | nmdc:mga06z11_344411_c1 | |||
| 1342 | nmdc:mga08y16_475533_c1 | |||
| 1343 | nmdc:mga0n895_486885_c1 | |||
| 1344 | nmdc:mga0rr50_43836_c1 | |||
| 1345 | nmdc:mga08x19_522649_c1 | |||
| 1346 | nmdc:mga0a205_383857_c1 | |||
| 1347 | Ga0500635_0000004 | |||
| 1348 | Ga0500635_0027571 | |||
| 1349 | Ga0495655_0047544 | |||
| 1350 | Ga0495619_0051317 | |||
| 1351 | Ga0495619_0382325 | |||
| 1352 | Ga0495619_0743776 | |||
| 1353 | Ga0500578_0012628 | |||
| 1354 | Ga0500646_0027144 | |||
| 1355 | Ga0500566_0202319 | |||
| 1356 | Ga0500654_013375 | |||
| 1357 | Ga0500553_024647 | |||
| 1358 | Ga0500554_024750 | |||
| 1359 | Ga0500560_049264 | |||
| 1360 | Ga0500569_003105 | |||
| 1361 | Ga0500628_001225 | |||
| 1362 | Ga0500658_0001007 | |||
| 1363 | Ga0500561_0012243 | |||
| 1364 | Ga0500573_0009227 | |||
| 1365 | Ga0500573_0059430 | |||
| 1366 | Ga0500573_0064224 | |||
| 1367 | Ga0500573_0064225 | |||
| 1368 | Ga0500573_0272957 | |||
| 1369 | Ga0500573_0289973 | |||
| 1370 | Ga0500573_0369965 | |||
| 1371 | Ga0500577_0001752 | |||
| 1372 | Ga0500577_0005114 | |||
| 1373 | Ga0500577_0021406 | |||
| 1374 | Ga0500579_055233 | |||
| 1375 | Ga0500600_0014464 | |||
| 1376 | Ga0500600_0211700 | |||
| 1377 | Ga0500603_005445 | |||
| 1378 | Ga0500616_0039693 | |||
| 1379 | Ga0500633_0002479 | |||
| 1380 | Ga0500634_0003502 | |||
| 1381 | Ga0500636_0296382 | |||
| 1382 | Ga0500645_020515 | |||
| 1383 | Ga0500587_001002 | |||
| 1384 | Ga0501084_0026450 | |||
| 1385 | Ga0501084_0055720 | |||
| 1386 | Ga0501084_0083088 | |||
| 1387 | Ga0501084_1046738 | |||
| 1388 | Ga0501082_0048009 | |||
| 1389 | Ga0501082_0292836 | |||
| 1390 | Ga0501082_0580646 | |||
| 1391 | Ga0466962_0017206 | |||
| 1392 | Ga0466962_0022723 | |||
| 1393 | 2554259603 | |||
| 1394 | 2585300945 | |||
| 1395 | 2616695551 | |||
| 1396 | 2616906360 | |||
| 1397 | 2643753157 | |||
| 1398 | 2643760270 | |||
| 1399 | 2643785062 | |||
| 1400 | 2643874535 | |||
| 1401 | 2643904433 | |||
| 1402 | 2644083348 | |||
| 1403 | 2644093959 | |||
| 1404 | 2644323803 | |||
| 1405 | 2644381591 | |||
| 1406 | 2644406299 | |||
| 1407 | 2644460034 | |||
| 1408 | 2644666367 | |||
| 1409 | 2644679400 | |||
| 1410 | 2730228909 | |||
| 1411 | 2738695719 | |||
| 1412 | 2739326140 | |||
| 1413 | 2739605017 | |||
| 1414 | 2747955013 | |||
| 1415 | 2774383558 | |||
| 1416 | 2808884931 | |||
| 1417 | 2809028226 | |||
| 1418 | 2811846906 | |||
| 1419 | 2812322321 | |||
| 1420 | 2819699798 | |||
| 1421 | 2821269244 | |||
| 1422 | 2835189148 | |||
| 1423 | 2839987242 | |||
| 1424 | 2842889354 | |||
| 1425 | 2852646643 | |||
| 1426 | 2857722237 | |||
| 1427 | 2857732110 | |||
| 1428 | 2857736053 | |||
| 1429 | 2862186311 | |||
| 1430 | 2862292401 | |||
| 1431 | 2870624686 | |||
| 1432 | 2873157737 | |||
| 1433 | 2875392638 | |||
| 1434 | 2883821861 | |||
| 1435 | 2895663450 | |||
| 1436 | 2919396712 | |||
| 1437 | 2928091081 | |||
| 1438 | 2932431906 | |||
| 1439 | 2935393669 | |||
| 1440 | 2939660269 | |||
| 1441 | 2945971055 | |||
| 1442 | 2946052076 | |||
| 1443 | 2946081658 | |||
| 1444 | 2966604474 | |||
| 1445 | 2974298173 | |||
| 1446 | 2974325592 | |||
| 1447 | 2984582160 | |||
| 1448 | 2990093776 | |||
| 1449 | 2997453950 | |||
| 1450 | 3006399503 | |||
| 1451 | 3006488361 | |||
| 1452 | 8004183745 | |||
| 1453 | 8008580806 | |||
| 1454 | 8025414873 | |||
| 1455 | 8025478898 | |||
| 1456 | 8056582261 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j07-assembly1.cif.gz_B | crystal structure of a probable riboflavin synthase, beta chain ribh (6,7-dimethyl-8-ribityllumazine synthase, dmrl synthase, lumazine synthase) from mycobacterium leprae | 0.9565 | 12 | 135 |
| 2c9b-assembly2.cif.gz_G | lumazine synthase from mycobacterium tuberculosus bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl) | 0.9534 | 13 | 135 |
| 8f25-assembly1.cif.gz_A | cryo-em structure of lumazine synthase nanoparticle linked to vp8* antigen | 0.9528 | 12 | 129 |
| 2f59-assembly1.cif.gz_D | lumazine synthase ribh1 from brucella abortus (gene bruab1_0785, swiss-prot entry q57dy1) complexed with inhibitor 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione | 0.9336 | 17 | 128 |
| 1c2y-assembly1.cif.gz_A | crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly | 0.9335 | 10 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2vi5I00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9534 | 10 | 135 | 3.40.50.960 |
| 2f59D00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9336 | 17 | 128 | 3.40.50.960 |
| 4kq6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.933 | 10 | 132 | 3.40.50.960 |
| 1xn1F00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.924 | 17 | 117 | 3.40.50.960 |
| 1nqwC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase | 0.9219 | 11 | 131 | 3.40.50.960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H6A6D7-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9632 | 17 | 129 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A1G1LMQ8-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9624 | 17 | 129 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-A0A7Y1X8K5-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9622 | 13 | 128 |
GO:0000906
GO:0009231 GO:0009349 |
| AF-A0A7V4NMH6-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9618 | 17 | 129 |
GO:0000906
GO:0005829 GO:0009231 GO:0009349 |
| AF-Q7UGV1-F1-model_v4 | 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) | 0.9615 | 17 | 129 |
GO:0000906
GO:0005737 GO:0005829 GO:0009231 GO:0009349 |