F477779
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 284 | 716 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005328|Ga0070676_10006442|Ga0070676_100064425 |
| Length | 138 |
| Sequence | MFDTNYTKHTNYHELRTSMKKLAKREEQIMQVYWDLGKAFIKEVIPHLPDPKPHYNSVATIVKILEEKGFLDHEAIGNVYSYFPKISREEYQKHDMKDIVKKYFDNSYPRMLAFFAKEQNLSEKELKEILEMIKSDKS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 3 | 2643221716 | Flavobacterium sp. Root901 | Isolate | Unclassified |
| 4 | 2643221725 | Flavobacterium sp. Root935 | Isolate | Unclassified |
| 5 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 6 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 7 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 8 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 9 | 2857613821 | Flavobacterium sp. R-72247 | Isolate | Unclassified |
| 10 | 2904419702 | Flavobacterium sp. 1355 | Isolate | Rhizosphere |
| 11 | 2904555929 | Flavobacterium sp. 1750 | Isolate | Rhizosphere |
| 12 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 13 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 195 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 206 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 207 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 214 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 222 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 249 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 250 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 251 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 252 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 260 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 262 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 263 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 264 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 265 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 273 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 275 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 276 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 277 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 278 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 279 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 280 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 284 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 0 |
| Isolates | 1.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.06 |
| Nodule | 0 |
| Rhizoplane | 1.92 |
| Rhizosphere | 91.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F6ESG4R02GKPM1 | 2088090002 | Bacteria | 507 |
| 2 | JGI25406J46586_10160090 | 3300003203 | Unclassified | 657 |
| 3 | rootH2_10340456 | 3300003320 | Unclassified | 1630 |
| 4 | rootH1_10388672 | 3300003323 | Unclassified | 1586 |
| 5 | Ga0065714_10002780 | 3300005288 | Bacteria | 12386 |
| 6 | Ga0065714_10008400 | 3300005288 | Bacteria | 2987 |
| 7 | Ga0065704_10018505 | 3300005289 | Bacteria | 2054 |
| 8 | Ga0065704_10495783 | 3300005289 | Bacteria | 670 |
| 9 | Ga0065712_10153950 | 3300005290 | Bacteria | 1348 |
| 10 | Ga0065712_10512818 | 3300005290 | Bacteria | 641 |
| 11 | Ga0065712_10834097 | 3300005290 | Unclassified | 502 |
| 12 | Ga0065715_10027975 | 3300005293 | Bacteria | 1634 |
| 13 | Ga0065715_10277504 | 3300005293 | Bacteria | 1095 |
| 14 | Ga0065715_10551731 | 3300005293 | Bacteria | 740 |
| 15 | Ga0065707_10103348 | 3300005295 | Bacteria | 2753 |
| 16 | Ga0065707_10420512 | 3300005295 | Bacteria | 831 |
| 17 | Ga0065707_10597090 | 3300005295 | Unclassified | 692 |
| 18 | Ga0070658_10383727 | 3300005327 | Bacteria | 1206 |
| 19 | Ga0070676_10006442 | 3300005328 | Bacteria | 6275 |
| 20 | Ga0070676_10683586 | 3300005328 | Bacteria | 748 |
| 21 | Ga0070683_100047424 | 3300005329 | Bacteria | 3970 |
| 22 | Ga0070683_100161092 | 3300005329 | Bacteria | 2129 |
| 23 | Ga0070683_100334253 | 3300005329 | Bacteria | 1442 |
| 24 | Ga0070683_101961349 | 3300005329 | Bacteria | 563 |
| 25 | Ga0070690_100172724 | 3300005330 | Bacteria | 1488 |
| 26 | Ga0070690_100578841 | 3300005330 | Bacteria | 850 |
| 27 | Ga0070670_100065566 | 3300005331 | Bacteria | 3116 |
| 28 | Ga0070670_100108062 | 3300005331 | Bacteria | 2397 |
| 29 | Ga0070670_100129781 | 3300005331 | Bacteria | 2176 |
| 30 | Ga0070670_100185011 | 3300005331 | Bacteria | 1809 |
| 31 | Ga0070670_100448539 | 3300005331 | Bacteria | 1143 |
| 32 | Ga0070670_100664206 | 3300005331 | Bacteria | 936 |
| 33 | Ga0070670_101796862 | 3300005331 | Unclassified | 564 |
| 34 | Ga0070677_10133241 | 3300005333 | Bacteria | 1137 |
| 35 | Ga0070677_10400039 | 3300005333 | Bacteria | 724 |
| 36 | Ga0068869_100037066 | 3300005334 | Bacteria | 3465 |
| 37 | Ga0068869_100248166 | 3300005334 | Bacteria | 1421 |
| 38 | Ga0068869_100439429 | 3300005334 | Bacteria | 1079 |
| 39 | Ga0068869_100873849 | 3300005334 | Bacteria | 777 |
| 40 | Ga0070666_10056032 | 3300005335 | Bacteria | 2661 |
| 41 | Ga0070666_11222892 | 3300005335 | Bacteria | 560 |
| 42 | Ga0070682_100341267 | 3300005337 | Bacteria | 1113 |
| 43 | Ga0068868_100091600 | 3300005338 | Bacteria | 2450 |
| 44 | Ga0068868_100267123 | 3300005338 | Bacteria | 1444 |
| 45 | Ga0068868_100620658 | 3300005338 | Bacteria | 960 |
| 46 | Ga0068868_100926826 | 3300005338 | Bacteria | 793 |
| 47 | Ga0070660_100903612 | 3300005339 | Bacteria | 745 |
| 48 | Ga0070689_100007532 | 3300005340 | Bacteria | 7620 |
| 49 | Ga0070689_100099742 | 3300005340 | Bacteria | 2297 |
| 50 | Ga0070689_100231672 | 3300005340 | Bacteria | 1518 |
| 51 | Ga0070689_100471164 | 3300005340 | Bacteria | 1071 |
| 52 | Ga0070687_100699987 | 3300005343 | Bacteria | 708 |
| 53 | Ga0070661_100057494 | 3300005344 | Bacteria | 2850 |
| 54 | Ga0070668_102092002 | 3300005347 | Unclassified | 523 |
| 55 | Ga0070669_100156596 | 3300005353 | Unclassified | 1767 |
| 56 | Ga0070669_100363299 | 3300005353 | Bacteria | 1178 |
| 57 | Ga0070669_100593254 | 3300005353 | Bacteria | 927 |
| 58 | Ga0070669_101764539 | 3300005353 | Unclassified | 540 |
| 59 | Ga0070669_101984101 | 3300005353 | Unclassified | 509 |
| 60 | Ga0070675_100055526 | 3300005354 | Bacteria | 3260 |
| 61 | Ga0070675_100119203 | 3300005354 | Bacteria | 2241 |
| 62 | Ga0070675_100153456 | 3300005354 | Bacteria | 1976 |
| 63 | Ga0070675_100331730 | 3300005354 | Unclassified | 1346 |
| 64 | Ga0070671_100056167 | 3300005355 | Unclassified | 3275 |
| 65 | Ga0070671_100261210 | 3300005355 | Bacteria | 1472 |
| 66 | Ga0070671_100538350 | 3300005355 | Bacteria | 1006 |
| 67 | Ga0070671_101412243 | 3300005355 | Bacteria | 615 |
| 68 | Ga0070674_100031187 | 3300005356 | Bacteria | 3530 |
| 69 | Ga0070674_100382789 | 3300005356 | Unclassified | 1145 |
| 70 | Ga0070674_100649687 | 3300005356 | Bacteria | 896 |
| 71 | Ga0070673_100074023 | 3300005364 | Bacteria | 2743 |
| 72 | Ga0070673_100220363 | 3300005364 | Bacteria | 1642 |
| 73 | Ga0070673_100592469 | 3300005364 | Unclassified | 1010 |
| 74 | Ga0070673_100654566 | 3300005364 | Bacteria | 962 |
| 75 | Ga0070673_101144362 | 3300005364 | Bacteria | 728 |
| 76 | Ga0070673_101559123 | 3300005364 | Bacteria | 623 |
| 77 | Ga0070673_101631829 | 3300005364 | Bacteria | 609 |
| 78 | Ga0070688_100093127 | 3300005365 | Bacteria | 1972 |
| 79 | Ga0070688_100301395 | 3300005365 | Unclassified | 1159 |
| 80 | Ga0070688_101508146 | 3300005365 | Unclassified | 547 |
| 81 | Ga0070659_100069554 | 3300005366 | Bacteria | 2795 |
| 82 | Ga0070667_100059036 | 3300005367 | Unclassified | 3244 |
| 83 | Ga0070667_100083177 | 3300005367 | Unclassified | 2742 |
| 84 | Ga0070667_100120350 | 3300005367 | Unclassified | 2283 |
| 85 | Ga0070667_100229768 | 3300005367 | Unclassified | 1654 |
| 86 | Ga0070667_100808260 | 3300005367 | Bacteria | 871 |
| 87 | Ga0070667_100819935 | 3300005367 | Bacteria | 864 |
| 88 | Ga0070667_101815569 | 3300005367 | Unclassified | 574 |
| 89 | Ga0070709_11368966 | 3300005434 | Unclassified | 572 |
| 90 | Ga0070713_101030656 | 3300005436 | Bacteria | 794 |
| 91 | Ga0070701_10946258 | 3300005438 | Bacteria | 598 |
| 92 | Ga0070700_100106015 | 3300005441 | Bacteria | 1860 |
| 93 | Ga0070700_101734848 | 3300005441 | Bacteria | 536 |
| 94 | Ga0070663_100439828 | 3300005455 | Unclassified | 1073 |
| 95 | Ga0070663_101334453 | 3300005455 | Unclassified | 634 |
| 96 | Ga0070678_101300074 | 3300005456 | Bacteria | 677 |
| 97 | Ga0070678_101500547 | 3300005456 | Bacteria | 631 |
| 98 | Ga0070662_100380875 | 3300005457 | Unclassified | 1161 |
| 99 | Ga0070662_101072637 | 3300005457 | Bacteria | 691 |
| 100 | Ga0070662_101714678 | 3300005457 | Unclassified | 542 |
| 101 | Ga0068867_100141751 | 3300005459 | Bacteria | 1879 |
| 102 | Ga0068867_100583220 | 3300005459 | Bacteria | 973 |
| 103 | Ga0068867_101468170 | 3300005459 | Bacteria | 634 |
| 104 | Ga0070685_10024602 | 3300005466 | Unclassified | 3309 |
| 105 | Ga0070685_10086939 | 3300005466 | Bacteria | 1885 |
| 106 | Ga0070685_10109046 | 3300005466 | Bacteria | 1702 |
| 107 | Ga0070685_10545990 | 3300005466 | Unclassified | 826 |
| 108 | Ga0070698_100005484 | 3300005471 | Bacteria | 13851 |
| 109 | Ga0070698_100022480 | 3300005471 | Bacteria | 6597 |
| 110 | Ga0070698_100031347 | 3300005471 | Bacteria | 5512 |
| 111 | Ga0070679_100554036 | 3300005530 | Bacteria | 1093 |
| 112 | Ga0070684_100002669 | 3300005535 | Bacteria | 13168 |
| 113 | Ga0070684_100118730 | 3300005535 | Unclassified | 2378 |
| 114 | Ga0068853_100917433 | 3300005539 | Bacteria | 842 |
| 115 | Ga0068853_101122854 | 3300005539 | Bacteria | 758 |
| 116 | Ga0070672_100141813 | 3300005543 | Unclassified | 1982 |
| 117 | Ga0070672_100354266 | 3300005543 | Bacteria | 1252 |
| 118 | Ga0070672_100621451 | 3300005543 | Unclassified | 942 |
| 119 | Ga0070672_100799900 | 3300005543 | Bacteria | 830 |
| 120 | Ga0070686_100842835 | 3300005544 | Bacteria | 742 |
| 121 | Ga0070686_101392866 | 3300005544 | Bacteria | 588 |
| 122 | Ga0070693_100290458 | 3300005547 | Bacteria | 1098 |
| 123 | Ga0070665_100064660 | 3300005548 | Unclassified | 3669 |
| 124 | Ga0070665_100337642 | 3300005548 | Unclassified | 1511 |
| 125 | Ga0070665_100757338 | 3300005548 | Bacteria | 984 |
| 126 | Ga0070665_102004070 | 3300005548 | Bacteria | 584 |
| 127 | Ga0070704_100528198 | 3300005549 | Unclassified | 1028 |
| 128 | Ga0070664_100087600 | 3300005564 | Bacteria | 2692 |
| 129 | Ga0070664_100165434 | 3300005564 | Bacteria | 1960 |
| 130 | Ga0070664_100184399 | 3300005564 | Bacteria | 1856 |
| 131 | Ga0070664_100197470 | 3300005564 | Bacteria | 1794 |
| 132 | Ga0070664_100491359 | 3300005564 | Unclassified | 1130 |
| 133 | Ga0070664_100549610 | 3300005564 | Bacteria | 1068 |
| 134 | Ga0070664_100719467 | 3300005564 | Unclassified | 931 |
| 135 | Ga0068857_100073434 | 3300005577 | Bacteria | 3048 |
| 136 | Ga0068857_100719268 | 3300005577 | Bacteria | 949 |
| 137 | Ga0068857_100901152 | 3300005577 | Bacteria | 848 |
| 138 | Ga0068857_102171205 | 3300005577 | Bacteria | 545 |
| 139 | Ga0068854_100571855 | 3300005578 | Bacteria | 961 |
| 140 | Ga0068854_100841276 | 3300005578 | Bacteria | 803 |
| 141 | Ga0070702_100289838 | 3300005615 | Bacteria | 1128 |
| 142 | Ga0070702_101155166 | 3300005615 | Bacteria | 622 |
| 143 | Ga0068852_100080524 | 3300005616 | Bacteria | 2888 |
| 144 | Ga0068852_100406241 | 3300005616 | Unclassified | 1340 |
| 145 | Ga0068852_100505890 | 3300005616 | Unclassified | 1203 |
| 146 | Ga0068859_100013562 | 3300005617 | Bacteria | 8172 |
| 147 | Ga0068859_100013830 | 3300005617 | Bacteria | 8093 |
| 148 | Ga0068859_100042847 | 3300005617 | Bacteria | 4547 |
| 149 | Ga0068859_100145417 | 3300005617 | Bacteria | 2445 |
| 150 | Ga0068859_100268908 | 3300005617 | Bacteria | 1796 |
| 151 | Ga0068859_100355209 | 3300005617 | Bacteria | 1560 |
| 152 | Ga0068859_100516580 | 3300005617 | Bacteria | 1289 |
| 153 | Ga0068859_100555425 | 3300005617 | Bacteria | 1242 |
| 154 | Ga0068859_100609294 | 3300005617 | Bacteria | 1185 |
| 155 | Ga0068859_100759746 | 3300005617 | Bacteria | 1058 |
| 156 | Ga0068859_100786647 | 3300005617 | Bacteria | 1039 |
| 157 | Ga0068859_101419754 | 3300005617 | Bacteria | 766 |
| 158 | Ga0068859_101489715 | 3300005617 | Bacteria | 747 |
| 159 | Ga0068859_102338479 | 3300005617 | Unclassified | 589 |
| 160 | Ga0068859_102854114 | 3300005617 | Unclassified | 530 |
| 161 | Ga0068864_100010460 | 3300005618 | Bacteria | 7667 |
| 162 | Ga0068864_100192211 | 3300005618 | Bacteria | 1872 |
| 163 | Ga0068864_100950092 | 3300005618 | Bacteria | 850 |
| 164 | Ga0068864_101938783 | 3300005618 | Unclassified | 595 |
| 165 | Ga0068866_10074811 | 3300005718 | Bacteria | 1802 |
| 166 | Ga0068866_10305692 | 3300005718 | Bacteria | 995 |
| 167 | Ga0068866_10787442 | 3300005718 | Unclassified | 660 |
| 168 | Ga0068861_100051340 | 3300005719 | Bacteria | 3130 |
| 169 | Ga0068861_100054764 | 3300005719 | Bacteria | 3040 |
| 170 | Ga0068861_100087878 | 3300005719 | Bacteria | 2446 |
| 171 | Ga0068861_100649976 | 3300005719 | Unclassified | 974 |
| 172 | Ga0068861_101132408 | 3300005719 | Unclassified | 753 |
| 173 | Ga0068861_102501786 | 3300005719 | Bacteria | 520 |
| 174 | Ga0068851_10424510 | 3300005834 | Bacteria | 786 |
| 175 | Ga0068870_10780175 | 3300005840 | Bacteria | 666 |
| 176 | Ga0068870_11237958 | 3300005840 | Bacteria | 542 |
| 177 | Ga0068863_100001966 | 3300005841 | Bacteria | 20422 |
| 178 | Ga0068863_100145776 | 3300005841 | Bacteria | 2264 |
| 179 | Ga0068863_101051708 | 3300005841 | Unclassified | 818 |
| 180 | Ga0068863_101170353 | 3300005841 | Bacteria | 774 |
| 181 | Ga0068863_102580928 | 3300005841 | Unclassified | 517 |
| 182 | Ga0068858_100221633 | 3300005842 | Unclassified | 1791 |
| 183 | Ga0068858_100355511 | 3300005842 | Bacteria | 1404 |
| 184 | Ga0068858_100703032 | 3300005842 | Bacteria | 984 |
| 185 | Ga0068860_100004009 | 3300005843 | Bacteria | 15116 |
| 186 | Ga0068860_100005881 | 3300005843 | Bacteria | 12349 |
| 187 | Ga0068860_100195525 | 3300005843 | Bacteria | 1959 |
| 188 | Ga0068860_100239146 | 3300005843 | Bacteria | 1766 |
| 189 | Ga0068860_101104792 | 3300005843 | Unclassified | 812 |
| 190 | Ga0068860_102568950 | 3300005843 | Bacteria | 529 |
| 191 | Ga0068862_100415963 | 3300005844 | Bacteria | 1260 |
| 192 | Ga0068862_100849258 | 3300005844 | Unclassified | 895 |
| 193 | Ga0068862_101346236 | 3300005844 | Bacteria | 716 |
| 194 | Ga0068862_101412879 | 3300005844 | Unclassified | 699 |
| 195 | Ga0081539_10001794 | 3300005985 | Bacteria | 33997 |
| 196 | Ga0070717_11221272 | 3300006028 | Unclassified | 684 |
| 197 | Ga0075432_10312819 | 3300006058 | Unclassified | 655 |
| 198 | Ga0075432_10494114 | 3300006058 | Bacteria | 544 |
| 199 | Ga0070715_10540631 | 3300006163 | Unclassified | 674 |
| 200 | Ga0070716_100271747 | 3300006173 | Bacteria | 1165 |
| 201 | Ga0097621_100005069 | 3300006237 | Bacteria | 9257 |
| 202 | Ga0097621_100204497 | 3300006237 | Bacteria | 1715 |
| 203 | Ga0097621_100343939 | 3300006237 | Unclassified | 1325 |
| 204 | Ga0097621_100460416 | 3300006237 | Bacteria | 1147 |
| 205 | Ga0097621_100568195 | 3300006237 | Unclassified | 1034 |
| 206 | Ga0097621_101572586 | 3300006237 | Bacteria | 625 |
| 207 | Ga0075370_10874260 | 3300006353 | Bacteria | 549 |
| 208 | Ga0068871_100008961 | 3300006358 | Bacteria | 7221 |
| 209 | Ga0068871_100017013 | 3300006358 | Bacteria | 5491 |
| 210 | Ga0068871_100327403 | 3300006358 | Unclassified | 1351 |
| 211 | Ga0068871_100827830 | 3300006358 | Bacteria | 855 |
| 212 | Ga0068871_101024414 | 3300006358 | Bacteria | 770 |
| 213 | Ga0075428_100012494 | 3300006844 | Bacteria | 9444 |
| 214 | Ga0075428_102595621 | 3300006844 | Bacteria | 518 |
| 215 | Ga0075430_100817277 | 3300006846 | Bacteria | 768 |
| 216 | Ga0075431_100055186 | 3300006847 | Bacteria | 4098 |
| 217 | Ga0075431_101566198 | 3300006847 | Unclassified | 617 |
| 218 | Ga0075429_100006150 | 3300006880 | Bacteria | 10376 |
| 219 | Ga0075429_100313024 | 3300006880 | Bacteria | 1374 |
| 220 | Ga0075429_100463541 | 3300006880 | Unclassified | 1110 |
| 221 | Ga0068865_100359529 | 3300006881 | Bacteria | 1182 |
| 222 | Ga0097620_100013560 | 3300006931 | Bacteria | 8172 |
| 223 | Ga0097620_100013830 | 3300006931 | Bacteria | 8093 |
| 224 | Ga0097620_100042845 | 3300006931 | Bacteria | 4547 |
| 225 | Ga0097620_100145418 | 3300006931 | Bacteria | 2445 |
| 226 | Ga0097620_100268914 | 3300006931 | Bacteria | 1796 |
| 227 | Ga0097620_100355215 | 3300006931 | Bacteria | 1560 |
| 228 | Ga0097620_100516578 | 3300006931 | Bacteria | 1289 |
| 229 | Ga0097620_100555436 | 3300006931 | Bacteria | 1242 |
| 230 | Ga0097620_100609262 | 3300006931 | Bacteria | 1185 |
| 231 | Ga0097620_100759728 | 3300006931 | Bacteria | 1058 |
| 232 | Ga0097620_100786663 | 3300006931 | Bacteria | 1039 |
| 233 | Ga0097620_101419866 | 3300006931 | Bacteria | 766 |
| 234 | Ga0097620_101489543 | 3300006931 | Bacteria | 747 |
| 235 | Ga0097620_102339664 | 3300006931 | Unclassified | 589 |
| 236 | Ga0097620_102855217 | 3300006931 | Unclassified | 530 |
| 237 | Ga0105251_10053057 | 3300009011 | Bacteria | 1928 |
| 238 | Ga0105251_10065440 | 3300009011 | Bacteria | 1701 |
| 239 | Ga0105244_10000004 | 3300009036 | Bacteria | 492478 |
| 240 | Ga0105240_10669872 | 3300009093 | Bacteria | 1135 |
| 241 | Ga0105240_12165303 | 3300009093 | Bacteria | 577 |
| 242 | Ga0111539_10041924 | 3300009094 | Bacteria | 5500 |
| 243 | Ga0111539_10054398 | 3300009094 | Unclassified | 4763 |
| 244 | Ga0111539_10433793 | 3300009094 | Bacteria | 1530 |
| 245 | Ga0111539_11018641 | 3300009094 | Bacteria | 963 |
| 246 | Ga0111539_11388357 | 3300009094 | Unclassified | 815 |
| 247 | Ga0111539_11414666 | 3300009094 | Unclassified | 807 |
| 248 | Ga0111539_13476687 | 3300009094 | Bacteria | 506 |
| 249 | Ga0105247_10001409 | 3300009101 | Bacteria | 17436 |
| 250 | Ga0105247_10240118 | 3300009101 | Bacteria | 1234 |
| 251 | Ga0114129_10069169 | 3300009147 | Unclassified | 4921 |
| 252 | Ga0114129_10085559 | 3300009147 | Bacteria | 4374 |
| 253 | Ga0114129_11658103 | 3300009147 | Bacteria | 781 |
| 254 | Ga0114129_13124094 | 3300009147 | Unclassified | 541 |
| 255 | Ga0114129_13378419 | 3300009147 | Unclassified | 514 |
| 256 | Ga0105243_11763213 | 3300009148 | Bacteria | 649 |
| 257 | Ga0105241_10200544 | 3300009174 | Unclassified | 1666 |
| 258 | Ga0105241_10358736 | 3300009174 | Bacteria | 1268 |
| 259 | Ga0105241_11591563 | 3300009174 | Unclassified | 632 |
| 260 | Ga0105241_11725373 | 3300009174 | Unclassified | 609 |
| 261 | Ga0105242_10002507 | 3300009176 | Bacteria | 14401 |
| 262 | Ga0105242_10016969 | 3300009176 | Bacteria | 5667 |
| 263 | Ga0105242_10236415 | 3300009176 | Unclassified | 1640 |
| 264 | Ga0105242_10523942 | 3300009176 | Bacteria | 1131 |
| 265 | Ga0105242_11902181 | 3300009176 | Bacteria | 635 |
| 266 | Ga0105242_13009761 | 3300009176 | Unclassified | 522 |
| 267 | Ga0105248_10390555 | 3300009177 | Bacteria | 1567 |
| 268 | Ga0105248_11002871 | 3300009177 | Bacteria | 943 |
| 269 | Ga0105237_10797586 | 3300009545 | Bacteria | 951 |
| 270 | Ga0105237_11305305 | 3300009545 | Bacteria | 732 |
| 271 | Ga0105237_12220334 | 3300009545 | Unclassified | 558 |
| 272 | Ga0105249_10001319 | 3300009553 | Bacteria | 21718 |
| 273 | Ga0105249_10003297 | 3300009553 | Bacteria | 13988 |
| 274 | Ga0105249_10007594 | 3300009553 | Bacteria | 9464 |
| 275 | Ga0105249_10116159 | 3300009553 | Bacteria | 2536 |
| 276 | Ga0105249_10239858 | 3300009553 | Bacteria | 1792 |
| 277 | Ga0105249_10317806 | 3300009553 | Unclassified | 1568 |
| 278 | Ga0105249_10352843 | 3300009553 | Bacteria | 1490 |
| 279 | Ga0105249_11384769 | 3300009553 | Unclassified | 775 |
| 280 | Ga0105249_11389812 | 3300009553 | Bacteria | 774 |
| 281 | Ga0105249_11763330 | 3300009553 | Bacteria | 692 |
| 282 | Ga0105249_11799193 | 3300009553 | Bacteria | 685 |
| 283 | Ga0105249_12793819 | 3300009553 | Unclassified | 560 |
| 284 | Ga0105239_10502842 | 3300010375 | Bacteria | 1378 |
| 285 | Ga0105246_10062756 | 3300011119 | Bacteria | 2590 |
| 286 | Ga0105246_10134559 | 3300011119 | Bacteria | 1851 |
| 287 | Ga0105246_10808700 | 3300011119 | Unclassified | 832 |
| 288 | Ga0157373_10000002 | 3300013100 | Bacteria | 750094 |
| 289 | Ga0157373_10011815 | 3300013100 | Bacteria | 6414 |
| 290 | Ga0157373_10564275 | 3300013100 | Bacteria | 826 |
| 291 | Ga0157373_10605037 | 3300013100 | Bacteria | 798 |
| 292 | Ga0157373_11101378 | 3300013100 | Bacteria | 596 |
| 293 | Ga0157371_10130310 | 3300013102 | Bacteria | 1789 |
| 294 | Ga0157371_10363368 | 3300013102 | Bacteria | 1055 |
| 295 | Ga0157370_10000097 | 3300013104 | Bacteria | 99144 |
| 296 | Ga0157370_10002822 | 3300013104 | Bacteria | 20761 |
| 297 | Ga0157370_10137162 | 3300013104 | Bacteria | 2280 |
| 298 | Ga0157370_10166724 | 3300013104 | Bacteria | 2048 |
| 299 | Ga0157370_10170945 | 3300013104 | Bacteria | 2020 |
| 300 | Ga0157369_10009083 | 3300013105 | Bacteria | 11378 |
| 301 | Ga0157369_10030197 | 3300013105 | Bacteria | 5979 |
| 302 | Ga0157369_10064219 | 3300013105 | Bacteria | 3954 |
| 303 | Ga0157369_11268232 | 3300013105 | Bacteria | 751 |
| 304 | Ga0157374_10008802 | 3300013296 | Bacteria | 8639 |
| 305 | Ga0157374_10027181 | 3300013296 | Bacteria | 5157 |
| 306 | Ga0157374_10137876 | 3300013296 | Bacteria | 2366 |
| 307 | Ga0157374_10182966 | 3300013296 | Bacteria | 2048 |
| 308 | Ga0157374_10420638 | 3300013296 | Bacteria | 1335 |
| 309 | Ga0157374_10537427 | 3300013296 | Bacteria | 1176 |
| 310 | Ga0157374_12280875 | 3300013296 | Bacteria | 568 |
| 311 | Ga0157378_10011051 | 3300013297 | Bacteria | 7902 |
| 312 | Ga0157378_10022058 | 3300013297 | Bacteria | 5601 |
| 313 | Ga0157378_10199073 | 3300013297 | Bacteria | 1894 |
| 314 | Ga0157378_10237076 | 3300013297 | Bacteria | 1741 |
| 315 | Ga0157378_10439418 | 3300013297 | Bacteria | 1293 |
| 316 | Ga0157378_10906581 | 3300013297 | Bacteria | 912 |
| 317 | Ga0157378_11150171 | 3300013297 | Bacteria | 814 |
| 318 | Ga0163162_10019416 | 3300013306 | Bacteria | 6666 |
| 319 | Ga0163162_10026218 | 3300013306 | Bacteria | 5761 |
| 320 | Ga0163162_10034614 | 3300013306 | Bacteria | 5027 |
| 321 | Ga0163162_10093233 | 3300013306 | Bacteria | 3096 |
| 322 | Ga0163162_10124962 | 3300013306 | Bacteria | 2678 |
| 323 | Ga0163162_10204595 | 3300013306 | Bacteria | 2103 |
| 324 | Ga0163162_10301734 | 3300013306 | Bacteria | 1733 |
| 325 | Ga0163162_10676330 | 3300013306 | Bacteria | 1155 |
| 326 | Ga0163162_10743235 | 3300013306 | Unclassified | 1101 |
| 327 | Ga0163162_10794787 | 3300013306 | Bacteria | 1064 |
| 328 | Ga0163162_10914492 | 3300013306 | Bacteria | 990 |
| 329 | Ga0163162_11037318 | 3300013306 | Bacteria | 928 |
| 330 | Ga0163162_11266750 | 3300013306 | Unclassified | 837 |
| 331 | Ga0163162_12286148 | 3300013306 | Unclassified | 621 |
| 332 | Ga0163162_12352130 | 3300013306 | Bacteria | 612 |
| 333 | Ga0157372_10149650 | 3300013307 | Bacteria | 2694 |
| 334 | Ga0157372_10251303 | 3300013307 | Bacteria | 2052 |
| 335 | Ga0157372_10353004 | 3300013307 | Bacteria | 1713 |
| 336 | Ga0157372_11560919 | 3300013307 | Bacteria | 760 |
| 337 | Ga0157372_11699701 | 3300013307 | Bacteria | 726 |
| 338 | Ga0157372_12590426 | 3300013307 | Unclassified | 582 |
| 339 | Ga0157372_12690523 | 3300013307 | Bacteria | 571 |
| 340 | Ga0157372_12991807 | 3300013307 | Bacteria | 540 |
| 341 | Ga0157375_10006773 | 3300013308 | Bacteria | 9982 |
| 342 | Ga0157375_10057411 | 3300013308 | Bacteria | 3848 |
| 343 | Ga0157375_10079911 | 3300013308 | Bacteria | 3307 |
| 344 | Ga0157375_10082143 | 3300013308 | Bacteria | 3263 |
| 345 | Ga0157375_10092904 | 3300013308 | Unclassified | 3082 |
| 346 | Ga0157375_10126295 | 3300013308 | Bacteria | 2673 |
| 347 | Ga0157375_10140620 | 3300013308 | Bacteria | 2541 |
| 348 | Ga0157375_10200943 | 3300013308 | Bacteria | 2149 |
| 349 | Ga0157375_10322326 | 3300013308 | Bacteria | 1710 |
| 350 | Ga0157375_10697142 | 3300013308 | Bacteria | 1169 |
| 351 | Ga0157375_10814958 | 3300013308 | Bacteria | 1082 |
| 352 | Ga0157375_11220379 | 3300013308 | Bacteria | 883 |
| 353 | Ga0157375_12344968 | 3300013308 | Unclassified | 636 |
| 354 | Ga0163163_10001981 | 3300014325 | Bacteria | 17328 |
| 355 | Ga0163163_10514137 | 3300014325 | Bacteria | 1259 |
| 356 | Ga0163163_10673108 | 3300014325 | Bacteria | 1098 |
| 357 | Ga0163163_11514557 | 3300014325 | Unclassified | 732 |
| 358 | Ga0163163_12147433 | 3300014325 | Unclassified | 618 |
| 359 | Ga0163163_12178397 | 3300014325 | Unclassified | 614 |
| 360 | Ga0163163_12992740 | 3300014325 | Unclassified | 527 |
| 361 | Ga0157380_10014307 | 3300014326 | Bacteria | 5804 |
| 362 | Ga0157380_10018408 | 3300014326 | Bacteria | 5183 |
| 363 | Ga0157380_10098483 | 3300014326 | Bacteria | 2430 |
| 364 | Ga0157380_10861281 | 3300014326 | Unclassified | 929 |
| 365 | Ga0157380_10953870 | 3300014326 | Bacteria | 888 |
| 366 | Ga0157380_11059303 | 3300014326 | Bacteria | 848 |
| 367 | Ga0157380_11294363 | 3300014326 | Bacteria | 776 |
| 368 | Ga0157380_11843938 | 3300014326 | Bacteria | 664 |
| 369 | Ga0157380_11901490 | 3300014326 | Bacteria | 656 |
| 370 | Ga0157377_10013851 | 3300014745 | Unclassified | 4089 |
| 371 | Ga0157377_10071880 | 3300014745 | Bacteria | 2001 |
| 372 | Ga0157377_10101437 | 3300014745 | Unclassified | 1715 |
| 373 | Ga0157377_11135217 | 3300014745 | Bacteria | 601 |
| 374 | Ga0157377_11337023 | 3300014745 | Unclassified | 562 |
| 375 | Ga0157379_10016773 | 3300014968 | Bacteria | 6446 |
| 376 | Ga0157379_10168872 | 3300014968 | Bacteria | 1975 |
| 377 | Ga0157379_10186779 | 3300014968 | Bacteria | 1873 |
| 378 | Ga0157379_10635773 | 3300014968 | Bacteria | 998 |
| 379 | Ga0157379_10809923 | 3300014968 | Bacteria | 884 |
| 380 | Ga0157379_10984598 | 3300014968 | Bacteria | 803 |
| 381 | Ga0157376_10091666 | 3300014969 | Bacteria | 2633 |
| 382 | Ga0157376_10264607 | 3300014969 | Bacteria | 1613 |
| 383 | Ga0157376_10565587 | 3300014969 | Unclassified | 1127 |
| 384 | Ga0157376_11098384 | 3300014969 | Bacteria | 821 |
| 385 | Ga0157376_11736848 | 3300014969 | Unclassified | 660 |
| 386 | Ga0157376_12998747 | 3300014969 | Bacteria | 511 |
| 387 | Ga0182006_1002176 | 3300015261 | Bacteria | 10863 |
| 388 | Ga0182007_10180118 | 3300015262 | Bacteria | 730 |
| 389 | Ga0163161_10000026 | 3300017792 | Bacteria | 199745 |
| 390 | Ga0163161_10139905 | 3300017792 | Bacteria | 1832 |
| 391 | Ga0163161_10153991 | 3300017792 | Bacteria | 1749 |
| 392 | Ga0163161_10211944 | 3300017792 | Unclassified | 1497 |
| 393 | Ga0163161_10429485 | 3300017792 | Bacteria | 1064 |
| 394 | Ga0163161_10931595 | 3300017792 | Bacteria | 738 |
| 395 | Ga0207697_10107638 | 3300025315 | Bacteria | 1192 |
| 396 | Ga0207655_1000008 | 3300025728 | Bacteria | 734289 |
| 397 | Ga0207713_1163087 | 3300025735 | Bacteria | 709 |
| 398 | Ga0207713_1247042 | 3300025735 | Bacteria | 527 |
| 399 | Ga0207682_10029013 | 3300025893 | Bacteria | 2211 |
| 400 | Ga0207642_10212513 | 3300025899 | Unclassified | 1076 |
| 401 | Ga0207642_10667951 | 3300025899 | Bacteria | 652 |
| 402 | Ga0207710_10015279 | 3300025900 | Bacteria | 3242 |
| 403 | Ga0207688_10110660 | 3300025901 | Bacteria | 1594 |
| 404 | Ga0207680_10072531 | 3300025903 | Bacteria | 2138 |
| 405 | Ga0207680_10088068 | 3300025903 | Bacteria | 1967 |
| 406 | Ga0207680_11016188 | 3300025903 | Unclassified | 594 |
| 407 | Ga0207647_10042205 | 3300025904 | Bacteria | 2863 |
| 408 | Ga0207647_10222973 | 3300025904 | Bacteria | 1086 |
| 409 | Ga0207645_10011823 | 3300025907 | Bacteria | 5942 |
| 410 | Ga0207645_10692343 | 3300025907 | Bacteria | 693 |
| 411 | Ga0207643_10400214 | 3300025908 | Bacteria | 868 |
| 412 | Ga0207643_10923180 | 3300025908 | Bacteria | 565 |
| 413 | Ga0207705_10689300 | 3300025909 | Bacteria | 794 |
| 414 | Ga0207684_11352300 | 3300025910 | Unclassified | 585 |
| 415 | Ga0207654_10833869 | 3300025911 | Unclassified | 667 |
| 416 | Ga0207662_10020618 | 3300025918 | Bacteria | 3761 |
| 417 | Ga0207662_10459852 | 3300025918 | Unclassified | 871 |
| 418 | Ga0207657_10168828 | 3300025919 | Bacteria | 1774 |
| 419 | Ga0207649_10133661 | 3300025920 | Bacteria | 1688 |
| 420 | Ga0207649_10428961 | 3300025920 | Bacteria | 994 |
| 421 | Ga0207652_10816856 | 3300025921 | Bacteria | 827 |
| 422 | Ga0207646_10194660 | 3300025922 | Unclassified | 1831 |
| 423 | Ga0207681_10140828 | 3300025923 | Bacteria | 1796 |
| 424 | Ga0207681_11018178 | 3300025923 | Bacteria | 695 |
| 425 | Ga0207681_11816878 | 3300025923 | Bacteria | 508 |
| 426 | Ga0207650_10035597 | 3300025925 | Bacteria | 3618 |
| 427 | Ga0207650_10118760 | 3300025925 | Bacteria | 2056 |
| 428 | Ga0207650_10265935 | 3300025925 | Unclassified | 1392 |
| 429 | Ga0207650_10316727 | 3300025925 | Unclassified | 1277 |
| 430 | Ga0207650_11107185 | 3300025925 | Unclassified | 674 |
| 431 | Ga0207650_11260871 | 3300025925 | Bacteria | 629 |
| 432 | Ga0207650_11332689 | 3300025925 | Bacteria | 611 |
| 433 | Ga0207659_10055394 | 3300025926 | Bacteria | 2836 |
| 434 | Ga0207659_10221808 | 3300025926 | Bacteria | 1521 |
| 435 | Ga0207659_10416583 | 3300025926 | Unclassified | 1126 |
| 436 | Ga0207659_11279398 | 3300025926 | Bacteria | 630 |
| 437 | Ga0207659_11419690 | 3300025926 | Bacteria | 595 |
| 438 | Ga0207659_11692003 | 3300025926 | Unclassified | 539 |
| 439 | Ga0207700_11050547 | 3300025928 | Bacteria | 729 |
| 440 | Ga0207644_10212241 | 3300025931 | Unclassified | 1531 |
| 441 | Ga0207644_10433401 | 3300025931 | Bacteria | 1078 |
| 442 | Ga0207706_10045661 | 3300025933 | Bacteria | 3881 |
| 443 | Ga0207706_10074986 | 3300025933 | Bacteria | 2974 |
| 444 | Ga0207706_10267209 | 3300025933 | Bacteria | 1493 |
| 445 | Ga0207706_10449222 | 3300025933 | Unclassified | 1115 |
| 446 | Ga0207706_10696234 | 3300025933 | Bacteria | 868 |
| 447 | Ga0207686_10000200 | 3300025934 | Bacteria | 46234 |
| 448 | Ga0207686_11263386 | 3300025934 | Bacteria | 605 |
| 449 | Ga0207709_11240362 | 3300025935 | Bacteria | 615 |
| 450 | Ga0207670_10103846 | 3300025936 | Bacteria | 2034 |
| 451 | Ga0207670_10163574 | 3300025936 | Bacteria | 1663 |
| 452 | Ga0207670_10284640 | 3300025936 | Unclassified | 1289 |
| 453 | Ga0207670_11505317 | 3300025936 | Bacteria | 572 |
| 454 | Ga0207669_10653424 | 3300025937 | Bacteria | 860 |
| 455 | Ga0207669_10976950 | 3300025937 | Bacteria | 711 |
| 456 | Ga0207669_11112106 | 3300025937 | Unclassified | 667 |
| 457 | Ga0207669_11137177 | 3300025937 | Bacteria | 660 |
| 458 | Ga0207704_10658840 | 3300025938 | Unclassified | 863 |
| 459 | Ga0207704_10780080 | 3300025938 | Bacteria | 797 |
| 460 | Ga0207665_10600284 | 3300025939 | Bacteria | 859 |
| 461 | Ga0207691_10090554 | 3300025940 | Unclassified | 2742 |
| 462 | Ga0207691_10401557 | 3300025940 | Bacteria | 1169 |
| 463 | Ga0207691_11145204 | 3300025940 | Unclassified | 646 |
| 464 | Ga0207691_11667356 | 3300025940 | Unclassified | 517 |
| 465 | Ga0207711_11242231 | 3300025941 | Bacteria | 687 |
| 466 | Ga0207689_10039743 | 3300025942 | Bacteria | 3894 |
| 467 | Ga0207689_10169171 | 3300025942 | Bacteria | 1801 |
| 468 | Ga0207689_10209134 | 3300025942 | Bacteria | 1612 |
| 469 | Ga0207689_10260045 | 3300025942 | Unclassified | 1436 |
| 470 | Ga0207689_10374793 | 3300025942 | Bacteria | 1185 |
| 471 | Ga0207689_10770283 | 3300025942 | Unclassified | 812 |
| 472 | Ga0207661_10030202 | 3300025944 | Bacteria | 4172 |
| 473 | Ga0207661_10226925 | 3300025944 | Bacteria | 1652 |
| 474 | Ga0207679_10178810 | 3300025945 | Bacteria | 1753 |
| 475 | Ga0207679_10469833 | 3300025945 | Unclassified | 1118 |
| 476 | Ga0207667_10749876 | 3300025949 | Bacteria | 976 |
| 477 | Ga0207651_10384443 | 3300025960 | Bacteria | 1190 |
| 478 | Ga0207712_10002897 | 3300025961 | Bacteria | 10969 |
| 479 | Ga0207712_10004281 | 3300025961 | Bacteria | 9006 |
| 480 | Ga0207712_10077710 | 3300025961 | Bacteria | 2407 |
| 481 | Ga0207712_10134125 | 3300025961 | Unclassified | 1891 |
| 482 | Ga0207712_10826164 | 3300025961 | Bacteria | 816 |
| 483 | Ga0207712_10899806 | 3300025961 | Bacteria | 782 |
| 484 | Ga0207712_11963244 | 3300025961 | Bacteria | 524 |
| 485 | Ga0207668_10087974 | 3300025972 | Bacteria | 2274 |
| 486 | Ga0207668_10202832 | 3300025972 | Bacteria | 1581 |
| 487 | Ga0207668_11799895 | 3300025972 | Unclassified | 553 |
| 488 | Ga0207640_10447548 | 3300025981 | Bacteria | 1064 |
| 489 | Ga0207640_10482078 | 3300025981 | Bacteria | 1029 |
| 490 | Ga0207640_11266351 | 3300025981 | Bacteria | 657 |
| 491 | Ga0207658_10068775 | 3300025986 | Bacteria | 2673 |
| 492 | Ga0207658_10363666 | 3300025986 | Unclassified | 1263 |
| 493 | Ga0207658_10403600 | 3300025986 | Unclassified | 1202 |
| 494 | Ga0207658_10762058 | 3300025986 | Bacteria | 877 |
| 495 | Ga0207658_11583956 | 3300025986 | Unclassified | 599 |
| 496 | Ga0207677_10033907 | 3300026023 | Bacteria | 3300 |
| 497 | Ga0207677_10313291 | 3300026023 | Bacteria | 1301 |
| 498 | Ga0207677_10458983 | 3300026023 | Unclassified | 1093 |
| 499 | Ga0207677_12140386 | 3300026023 | Unclassified | 520 |
| 500 | Ga0207703_10304457 | 3300026035 | Bacteria | 1455 |
| 501 | Ga0207703_10404519 | 3300026035 | Bacteria | 1267 |
| 502 | Ga0207703_10795798 | 3300026035 | Bacteria | 902 |
| 503 | Ga0207639_10576649 | 3300026041 | Unclassified | 1035 |
| 504 | Ga0207639_10918954 | 3300026041 | Bacteria | 818 |
| 505 | Ga0207639_11990037 | 3300026041 | Bacteria | 542 |
| 506 | Ga0207678_10054197 | 3300026067 | Unclassified | 3454 |
| 507 | Ga0207678_10325103 | 3300026067 | Bacteria | 1323 |
| 508 | Ga0207702_10983318 | 3300026078 | Bacteria | 837 |
| 509 | Ga0207702_10984363 | 3300026078 | Bacteria | 836 |
| 510 | Ga0207641_10020162 | 3300026088 | Bacteria | 5473 |
| 511 | Ga0207641_10041489 | 3300026088 | Bacteria | 3856 |
| 512 | Ga0207641_11046125 | 3300026088 | Bacteria | 814 |
| 513 | Ga0207641_11328397 | 3300026088 | Bacteria | 720 |
| 514 | Ga0207648_10047106 | 3300026089 | Bacteria | 3779 |
| 515 | Ga0207648_10055161 | 3300026089 | Bacteria | 3470 |
| 516 | Ga0207648_10057539 | 3300026089 | Bacteria | 3392 |
| 517 | Ga0207648_10181197 | 3300026089 | Bacteria | 1865 |
| 518 | Ga0207648_10315820 | 3300026089 | Bacteria | 1403 |
| 519 | Ga0207648_10532132 | 3300026089 | Bacteria | 1078 |
| 520 | Ga0207648_11332845 | 3300026089 | Bacteria | 674 |
| 521 | Ga0207648_11436195 | 3300026089 | Bacteria | 648 |
| 522 | Ga0207676_10129917 | 3300026095 | Bacteria | 2140 |
| 523 | Ga0207676_10156593 | 3300026095 | Unclassified | 1969 |
| 524 | Ga0207676_10157440 | 3300026095 | Bacteria | 1964 |
| 525 | Ga0207676_10729483 | 3300026095 | Bacteria | 962 |
| 526 | Ga0207674_10019713 | 3300026116 | Bacteria | 7300 |
| 527 | Ga0207674_10062109 | 3300026116 | Bacteria | 3773 |
| 528 | Ga0207674_10180762 | 3300026116 | Bacteria | 2061 |
| 529 | Ga0207674_10909694 | 3300026116 | Bacteria | 848 |
| 530 | Ga0207674_11261776 | 3300026116 | Bacteria | 708 |
| 531 | Ga0207675_100010610 | 3300026118 | Bacteria | 8629 |
| 532 | Ga0207675_100034120 | 3300026118 | Bacteria | 4743 |
| 533 | Ga0207675_100270961 | 3300026118 | Bacteria | 1647 |
| 534 | Ga0207675_100363355 | 3300026118 | Bacteria | 1420 |
| 535 | Ga0207675_100632873 | 3300026118 | Bacteria | 1075 |
| 536 | Ga0207675_101079257 | 3300026118 | Bacteria | 822 |
| 537 | Ga0207675_101653731 | 3300026118 | Unclassified | 660 |
| 538 | Ga0207675_102247055 | 3300026118 | Unclassified | 560 |
| 539 | Ga0207683_10991110 | 3300026121 | Unclassified | 780 |
| 540 | Ga0207683_11012352 | 3300026121 | Bacteria | 771 |
| 541 | Ga0207698_10372018 | 3300026142 | Bacteria | 1357 |
| 542 | Ga0207698_10674453 | 3300026142 | Bacteria | 1026 |
| 543 | Ga0207698_10971600 | 3300026142 | Unclassified | 859 |
| 544 | Ga0207698_11074522 | 3300026142 | Bacteria | 817 |
| 545 | Ga0207698_12342274 | 3300026142 | Bacteria | 546 |
| 546 | Ga0209995_1027606 | 3300027471 | Bacteria | 948 |
| 547 | Ga0207428_10672672 | 3300027907 | Unclassified | 742 |
| 548 | Ga0207428_11301296 | 3300027907 | Bacteria | 504 |
| 549 | Ga0268266_10277028 | 3300028379 | Unclassified | 1559 |
| 550 | Ga0268266_10323399 | 3300028379 | Bacteria | 1444 |
| 551 | Ga0268266_10468923 | 3300028379 | Bacteria | 1199 |
| 552 | Ga0268265_10234832 | 3300028380 | Bacteria | 1614 |
| 553 | Ga0268265_10291949 | 3300028380 | Bacteria | 1464 |
| 554 | Ga0268265_11009699 | 3300028380 | Bacteria | 822 |
| 555 | Ga0268265_11232908 | 3300028380 | Bacteria | 746 |
| 556 | Ga0268265_11847226 | 3300028380 | Bacteria | 611 |
| 557 | Ga0268264_10005626 | 3300028381 | Bacteria | 10615 |
| 558 | Ga0268264_10042733 | 3300028381 | Bacteria | 3752 |
| 559 | Ga0268264_10077236 | 3300028381 | Unclassified | 2836 |
| 560 | Ga0268264_10156577 | 3300028381 | Bacteria | 2048 |
| 561 | Ga0268264_11074970 | 3300028381 | Unclassified | 812 |
| 562 | Ga0268264_11170489 | 3300028381 | Bacteria | 778 |
| 563 | Ga0268264_11616869 | 3300028381 | Bacteria | 658 |
| 564 | Ga0307515_10000380 | 3300028794 | Bacteria | 108537 |
| 565 | Ga0307515_10006611 | 3300028794 | Bacteria | 23131 |
| 566 | Ga0307509_10487751 | 3300031507 | Bacteria | 919 |
| 567 | Ga0307408_100020641 | 3300031548 | Bacteria | 4450 |
| 568 | Ga0316576_10263168 | 3300031727 | Bacteria | 1294 |
| 569 | Ga0307413_10598496 | 3300031824 | Bacteria | 902 |
| 570 | Ga0307413_10819778 | 3300031824 | Bacteria | 784 |
| 571 | Ga0307410_10000071 | 3300031852 | Bacteria | 35788 |
| 572 | Ga0307406_10000037 | 3300031901 | Bacteria | 80899 |
| 573 | Ga0307407_10006810 | 3300031903 | Bacteria | 5121 |
| 574 | Ga0307409_102310819 | 3300031995 | Bacteria | 567 |
| 575 | Ga0307416_102686002 | 3300032002 | Bacteria | 595 |
| 576 | Ga0307414_10000012 | 3300032004 | Bacteria | 322675 |
| 577 | Ga0307414_10874760 | 3300032004 | Bacteria | 823 |
| 578 | Ga0307411_10399037 | 3300032005 | Bacteria | 1136 |
| 579 | Ga0307411_10800353 | 3300032005 | Bacteria | 830 |
| 580 | Ga0307411_11281402 | 3300032005 | Bacteria | 667 |
| 581 | Ga0373929_0044557 | 3300035085 | Bacteria | 997 |
| 582 | Ga0373934_0220285 | 3300035086 | Bacteria | 783 |
| 583 | Ga0373952_0029310 | 3300035092 | Bacteria | 1212 |
| 584 | Ga0373955_0325662 | 3300035172 | Bacteria | 929 |
| 585 | Ga0316574_0243033 | 3300035398 | Unclassified | 1151 |
| 586 | Ga0373924_0221624 | 3300035410 | Bacteria | 836 |
| 587 | Ga0373937_0067380 | 3300036401 | Bacteria | 3298 |
| 588 | Ga0316584_0517844 | 3300036712 | Bacteria | 836 |
| 589 | Ga0395900_1769213 | 3300037418 | Bacteria | 529 |
| 590 | Ga0395905_0179469 | 3300037471 | Bacteria | 1988 |
| 591 | Ga0436365_0729052 | 3300039437 | Bacteria | 5196 |
| 592 | Ga0436365_0843457 | 3300039437 | Bacteria | 1552 |
| 593 | Ga0436365_0853306 | 3300039437 | Bacteria | 2533 |
| 594 | Ga0436365_1151340 | 3300039437 | Bacteria | 808 |
| 595 | Ga0436365_1758907 | 3300039437 | Bacteria | 764 |
| 596 | Ga0439447_147320 | 3300041407 | Bacteria | 541 |
| 597 | Ga0439461_0093789 | 3300041410 | Unclassified | 723 |
| 598 | Ga0439466_0022583 | 3300041411 | Bacteria | 2219 |
| 599 | Ga0439466_0152692 | 3300041411 | Bacteria | 707 |
| 600 | Ga0451800_0578341 | 3300041459 | Unclassified | 565 |
| 601 | Ga0451802_0144258 | 3300041460 | Unclassified | 519 |
| 602 | Ga0451802_0831830 | 3300041460 | Bacteria | 713 |
| 603 | Ga0451807_1994737 | 3300041486 | Bacteria | 962 |
| 604 | Ga0451833_1296905 | 3300041491 | Unclassified | 590 |
| 605 | Ga0451839_0785002 | 3300041496 | Bacteria | 780 |
| 606 | Ga0451843_0767574 | 3300041509 | Bacteria | 833 |
| 607 | Ga0451853_3843889 | 3300041512 | Unclassified | 880 |
| 608 | Ga0439431_0233793 | 3300041997 | Unclassified | 542 |
| 609 | Ga0439445_0117259 | 3300042004 | Bacteria | 763 |
| 610 | Ga0439444_0039841 | 3300042437 | Bacteria | 918 |
| 611 | Ga0439444_0200902 | 3300042437 | Unclassified | 503 |
| 612 | Ga0439460_0169504 | 3300042461 | Bacteria | 735 |
| 613 | Ga0451577_0001044 | 3300042876 | Bacteria | 40023 |
| 614 | Ga0451577_0266645 | 3300042876 | Bacteria | 1551 |
| 615 | Ga0451577_0526212 | 3300042876 | Bacteria | 1074 |
| 616 | Ga0453683_0000005 | 3300044673 | Bacteria | 741657 |
| 617 | Ga0453683_0000792 | 3300044673 | Bacteria | 31218 |
| 618 | Ga0453683_0007079 | 3300044673 | Bacteria | 7639 |
| 619 | Ga0453683_0009838 | 3300044673 | Bacteria | 6371 |
| 620 | Ga0453683_0135617 | 3300044673 | Bacteria | 1552 |
| 621 | Ga0453683_0523355 | 3300044673 | Bacteria | 770 |
| 622 | Ga0453683_1053705 | 3300044673 | Unclassified | 541 |
| 623 | Ga0453683_1127602 | 3300044673 | Unclassified | 523 |
| 624 | Ga0453684_0000610 | 3300044712 | Bacteria | 131386 |
| 625 | Ga0453684_0037330 | 3300044712 | Bacteria | 6669 |
| 626 | Ga0453684_0041845 | 3300044712 | Bacteria | 6186 |
| 627 | Ga0453684_0073834 | 3300044712 | Bacteria | 4298 |
| 628 | Ga0453684_0187867 | 3300044712 | Bacteria | 2419 |
| 629 | Ga0453684_0261375 | 3300044712 | Bacteria | 1982 |
| 630 | Ga0453684_0310964 | 3300044712 | Bacteria | 1788 |
| 631 | Ga0453684_0358626 | 3300044712 | Unclassified | 1642 |
| 632 | Ga0453684_0730654 | 3300044712 | Bacteria | 1073 |
| 633 | Ga0451576_0000193 | 3300045051 | Bacteria | 154108 |
| 634 | Ga0451576_0006040 | 3300045051 | Bacteria | 14948 |
| 635 | Ga0451576_0006802 | 3300045051 | Bacteria | 13898 |
| 636 | Ga0451576_0011516 | 3300045051 | Bacteria | 10042 |
| 637 | Ga0451576_0238042 | 3300045051 | Bacteria | 1901 |
| 638 | Ga0451576_0858618 | 3300045051 | Bacteria | 953 |
| 639 | Ga0451576_1095975 | 3300045051 | Unclassified | 833 |
| 640 | Ga0495592_0445143 | 3300046454 | Bacteria | 813 |
| 641 | Ga0495638_0027584 | 3300046460 | Bacteria | 3675 |
| 642 | Ga0495638_0309182 | 3300046460 | Bacteria | 849 |
| 643 | Ga0495606_0000021 | 3300046507 | Bacteria | 271238 |
| 644 | Ga0495610_0000279 | 3300046512 | Bacteria | 53150 |
| 645 | Ga0495610_0001345 | 3300046512 | Bacteria | 21797 |
| 646 | Ga0495628_0299785 | 3300046516 | Bacteria | 1190 |
| 647 | Ga0495632_0296989 | 3300046519 | Bacteria | 717 |
| 648 | Ga0495637_0088822 | 3300046520 | Bacteria | 1222 |
| 649 | Ga0495643_0255454 | 3300046522 | Bacteria | 816 |
| 650 | Ga0495587_0129525 | 3300046536 | Bacteria | 1442 |
| 651 | Ga0495598_0148551 | 3300046537 | Bacteria | 816 |
| 652 | Ga0495621_0304944 | 3300046539 | Bacteria | 661 |
| 653 | Ga0495645_0143842 | 3300046543 | Bacteria | 1662 |
| 654 | Ga0495633_0005737 | 3300046558 | Bacteria | 7506 |
| 655 | Ga0495667_0106133 | 3300046559 | Bacteria | 1816 |
| 656 | Ga0495668_0000097 | 3300046616 | Bacteria | 139246 |
| 657 | Ga0495668_0013869 | 3300046616 | Bacteria | 4740 |
| 658 | Ga0495661_0022788 | 3300046665 | Bacteria | 4071 |
| 659 | Ga0495613_0533742 | 3300046689 | Bacteria | 787 |
| 660 | Ga0495671_0314262 | 3300046692 | Bacteria | 753 |
| 661 | Ga0495581_0643331 | 3300047315 | Bacteria | 613 |
| 662 | Ga0495604_0288924 | 3300047317 | Bacteria | 1105 |
| 663 | Ga0495674_0838556 | 3300047319 | Unclassified | 713 |
| 664 | Ga0495672_0395622 | 3300047320 | Bacteria | 633 |
| 665 | Ga0495680_0259306 | 3300047322 | Bacteria | 1230 |
| 666 | Ga0495686_0000625 | 3300047472 | Bacteria | 48634 |
| 667 | Ga0496100_0514093 | 3300048903 | Bacteria | 924 |
| 668 | Ga0496104_0943806 | 3300048907 | Unclassified | 767 |
| 669 | Ga0496110_0220839 | 3300048913 | Bacteria | 1723 |
| 670 | Ga0496110_1696769 | 3300048913 | Unclassified | 542 |
| 671 | Ga0496111_0086257 | 3300048914 | Bacteria | 2297 |
| 672 | Ga0496111_0180514 | 3300048914 | Unclassified | 1569 |
| 673 | Ga0496112_1227484 | 3300048915 | Unclassified | 666 |
| 674 | Ga0496112_1500157 | 3300048915 | Bacteria | 588 |
| 675 | Ga0496113_0896284 | 3300048916 | Unclassified | 702 |
| 676 | Ga0496114_0062136 | 3300048917 | Unclassified | 3126 |
| 677 | Ga0496116_0000032 | 3300048919 | Bacteria | 419997 |
| 678 | Ga0496121_0233147 | 3300048924 | Bacteria | 1288 |
| 679 | Ga0496124_0299158 | 3300048927 | Bacteria | 1163 |
| 680 | Ga0496125_0000111 | 3300048928 | Bacteria | 191489 |
| 681 | Ga0496126_0004578 | 3300048929 | Bacteria | 16402 |
| 682 | Ga0496126_0167088 | 3300048929 | Bacteria | 1877 |
| 683 | Ga0501290_062370 | 3300049513 | Bacteria | 603 |
| 684 | Ga0501038_0086325 | 3300049574 | Bacteria | 2637 |
| 685 | Ga0501238_000090 | 3300049671 | Bacteria | 14589 |
| 686 | Ga0501249_043346 | 3300049679 | Bacteria | 1024 |
| 687 | Ga0501266_016963 | 3300049763 | Bacteria | 971 |
| 688 | Ga0501280_001826 | 3300049776 | Bacteria | 3734 |
| 689 | nmdc:mga07m45_686929_c1 | 3300050496 | Bacteria | 589 |
| 690 | nmdc:mga05p37_231810_c1 | 3300050507 | Bacteria | 2224 |
| 691 | nmdc:mga05p37_439472_c1 | 3300050507 | Bacteria | 1513 |
| 692 | nmdc:mga05p37_46311_c1 | 3300050507 | Bacteria | 5348 |
| 693 | nmdc:mga09592_208367_c1 | 3300050508 | Unclassified | 1693 |
| 694 | nmdc:mga09592_375511_c1 | 3300050508 | Bacteria | 1230 |
| 695 | nmdc:mga0qj67_1193098_c1 | 3300050509 | Unclassified | 592 |
| 696 | nmdc:mga06r32_1072593_c1 | 3300050510 | Bacteria | 755 |
| 697 | nmdc:mga06r32_360646_c1 | 3300050510 | Bacteria | 1437 |
| 698 | nmdc:mga08y16_1495192_c1 | 3300050511 | Bacteria | 636 |
| 699 | nmdc:mga08y16_1640127_c1 | 3300050511 | Bacteria | 600 |
| 700 | nmdc:mga08y16_285380_c1 | 3300050511 | Bacteria | 1702 |
| 701 | nmdc:mga08y16_771138_c1 | 3300050511 | Unclassified | 956 |
| 702 | nmdc:mga08y16_897432_c1 | 3300050511 | Unclassified | 873 |
| 703 | nmdc:mga0n895_179543_c1 | 3300050512 | Bacteria | 2148 |
| 704 | Ga0500635_0082404 | 3300053080 | Unclassified | 1158 |
| 705 | Ga0500644_0166812 | 3300053088 | Bacteria | 893 |
| 706 | Ga0500646_0136625 | 3300053090 | Bacteria | 801 |
| 707 | Ga0500647_0085727 | 3300053091 | Bacteria | 1510 |
| 708 | Ga0500583_0154170 | 3300053092 | Bacteria | 1144 |
| 709 | Ga0500641_0000020 | 3300053096 | Bacteria | 119591 |
| 710 | Ga0500642_0007034 | 3300053130 | Bacteria | 3753 |
| 711 | Ga0500573_0352650 | 3300053140 | Bacteria | 714 |
| 712 | Ga0500604_0011813 | 3300053151 | Bacteria | 2352 |
| 713 | Ga0500616_0033668 | 3300053153 | Bacteria | 2794 |
| 714 | Ga0500627_0002345 | 3300053158 | Bacteria | 5593 |
| 715 | Ga0500584_040179 | 3300053726 | Bacteria | 2148 |
| 716 | Ga0500611_000020 | 3300053727 | Bacteria | 105250 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_1053705 | Ga0453683_1053705_221_529 | 97 |
| 2 | iso_pu_bacteria | 2643221667 | 2644369708 | 115 |
| 3 | iso_pu_bacteria | 2643221716 | 2644642420 | 115 |
| 4 | iso_pu_bacteria | 2643221725 | 2644685066 | 115 |
| 5 | iso_pu_bacteria | 2738541279 | 2738732096 | 115 |
| 6 | iso_pu_bacteria | 2738541285 | 2738764661 | 115 |
| 7 | iso_pu_bacteria | 2738543007 | 2739213676 | 115 |
| 8 | iso_pu_bacteria | 2802428842 | 2802653989 | 115 |
| 9 | iso_pu_bacteria | 2857613821 | 2857615976 | 115 |
| 10 | iso_pu_bacteria | 2904419702 | 2904422169 | 115 |
| 11 | iso_pu_bacteria | 2904555929 | 2904560054 | 115 |
| 12 | iso_pu_bacteria | 2929150217 | 2929153209 | 115 |
| 13 | iso_pu_bacteria | 2977268062 | 2977269901 | 115 |
| 14 | 3300026116 | Ga0207674_11261776 | Ga0207674_112617762 | 117 |
| 15 | 3300005547 | Ga0070693_100290458 | Ga0070693_1002904582 | 118 |
| 16 | 3300005548 | Ga0070665_102004070 | Ga0070665_1020040701 | 118 |
| 17 | 3300028379 | Ga0268266_10323399 | Ga0268266_103233992 | 118 |
| 18 | 3300031824 | Ga0307413_10819778 | Ga0307413_108197782 | 118 |
| 19 | 3300032005 | Ga0307411_10399037 | Ga0307411_103990372 | 118 |
| 20 | 3300036712 | Ga0316584_0517844 | Ga0316584_0517844_456_815 | 118 |
| 21 | 3300047315 | Ga0495581_0643331 | Ga0495581_0643331_65_424 | 118 |
| 22 | 2088090002 | CNA_F6ESG4R02GKPM1 | CNA_01333650 | 119 |
| 23 | 3300003203 | JGI25406J46586_10160090 | JGI25406J46586_101600901 | 119 |
| 24 | 3300003320 | rootH2_10340456 | rootH2_103404562 | 119 |
| 25 | 3300003323 | rootH1_10388672 | rootH1_103886722 | 119 |
| 26 | 3300005288 | Ga0065714_10002780 | Ga0065714_100027803 | 119 |
| 27 | 3300005288 | Ga0065714_10008400 | Ga0065714_100084002 | 119 |
| 28 | 3300005289 | Ga0065704_10018505 | Ga0065704_100185052 | 119 |
| 29 | 3300005289 | Ga0065704_10495783 | Ga0065704_104957831 | 119 |
| 30 | 3300005290 | Ga0065712_10153950 | Ga0065712_101539501 | 119 |
| 31 | 3300005290 | Ga0065712_10512818 | Ga0065712_105128181 | 119 |
| 32 | 3300005290 | Ga0065712_10834097 | Ga0065712_108340971 | 119 |
| 33 | 3300005293 | Ga0065715_10027975 | Ga0065715_100279753 | 119 |
| 34 | 3300005293 | Ga0065715_10277504 | Ga0065715_102775042 | 119 |
| 35 | 3300005293 | Ga0065715_10551731 | Ga0065715_105517312 | 119 |
| 36 | 3300005295 | Ga0065707_10103348 | Ga0065707_101033483 | 119 |
| 37 | 3300005295 | Ga0065707_10420512 | Ga0065707_104205122 | 119 |
| 38 | 3300005295 | Ga0065707_10597090 | Ga0065707_105970901 | 119 |
| 39 | 3300005327 | Ga0070658_10383727 | Ga0070658_103837272 | 119 |
| 40 | 3300005328 | Ga0070676_10006442 | Ga0070676_100064425 | 119 |
| 41 | 3300005328 | Ga0070676_10683586 | Ga0070676_106835861 | 119 |
| 42 | 3300005329 | Ga0070683_100047424 | Ga0070683_1000474242 | 119 |
| 43 | 3300005329 | Ga0070683_100161092 | Ga0070683_1001610925 | 119 |
| 44 | 3300005329 | Ga0070683_100334253 | Ga0070683_1003342531 | 119 |
| 45 | 3300005329 | Ga0070683_101961349 | Ga0070683_1019613491 | 119 |
| 46 | 3300005330 | Ga0070690_100172724 | Ga0070690_1001727242 | 119 |
| 47 | 3300005330 | Ga0070690_100578841 | Ga0070690_1005788411 | 119 |
| 48 | 3300005331 | Ga0070670_100065566 | Ga0070670_1000655662 | 119 |
| 49 | 3300005331 | Ga0070670_100108062 | Ga0070670_1001080623 | 119 |
| 50 | 3300005331 | Ga0070670_100129781 | Ga0070670_1001297812 | 119 |
| 51 | 3300005331 | Ga0070670_100185011 | Ga0070670_1001850113 | 119 |
| 52 | 3300005331 | Ga0070670_100448539 | Ga0070670_1004485392 | 119 |
| 53 | 3300005331 | Ga0070670_100664206 | Ga0070670_1006642061 | 119 |
| 54 | 3300005331 | Ga0070670_101796862 | Ga0070670_1017968621 | 119 |
| 55 | 3300005333 | Ga0070677_10133241 | Ga0070677_101332411 | 119 |
| 56 | 3300005333 | Ga0070677_10400039 | Ga0070677_104000391 | 119 |
| 57 | 3300005334 | Ga0068869_100037066 | Ga0068869_1000370661 | 119 |
| 58 | 3300005334 | Ga0068869_100248166 | Ga0068869_1002481662 | 119 |
| 59 | 3300005334 | Ga0068869_100439429 | Ga0068869_1004394292 | 119 |
| 60 | 3300005334 | Ga0068869_100873849 | Ga0068869_1008738492 | 119 |
| 61 | 3300005335 | Ga0070666_10056032 | Ga0070666_100560323 | 119 |
| 62 | 3300005335 | Ga0070666_11222892 | Ga0070666_112228921 | 119 |
| 63 | 3300005337 | Ga0070682_100341267 | Ga0070682_1003412671 | 119 |
| 64 | 3300005338 | Ga0068868_100091600 | Ga0068868_1000916003 | 119 |
| 65 | 3300005338 | Ga0068868_100267123 | Ga0068868_1002671232 | 119 |
| 66 | 3300005338 | Ga0068868_100620658 | Ga0068868_1006206582 | 119 |
| 67 | 3300005338 | Ga0068868_100926826 | Ga0068868_1009268262 | 119 |
| 68 | 3300005339 | Ga0070660_100903612 | Ga0070660_1009036121 | 119 |
| 69 | 3300005340 | Ga0070689_100007532 | Ga0070689_1000075323 | 119 |
| 70 | 3300005340 | Ga0070689_100099742 | Ga0070689_1000997423 | 119 |
| 71 | 3300005340 | Ga0070689_100231672 | Ga0070689_1002316722 | 119 |
| 72 | 3300005340 | Ga0070689_100471164 | Ga0070689_1004711642 | 119 |
| 73 | 3300005343 | Ga0070687_100699987 | Ga0070687_1006999872 | 119 |
| 74 | 3300005344 | Ga0070661_100057494 | Ga0070661_1000574941 | 119 |
| 75 | 3300005347 | Ga0070668_102092002 | Ga0070668_1020920021 | 119 |
| 76 | 3300005353 | Ga0070669_100156596 | Ga0070669_1001565962 | 119 |
| 77 | 3300005353 | Ga0070669_100363299 | Ga0070669_1003632992 | 119 |
| 78 | 3300005353 | Ga0070669_100593254 | Ga0070669_1005932543 | 119 |
| 79 | 3300005353 | Ga0070669_101764539 | Ga0070669_1017645391 | 119 |
| 80 | 3300005353 | Ga0070669_101984101 | Ga0070669_1019841011 | 119 |
| 81 | 3300005354 | Ga0070675_100055526 | Ga0070675_1000555262 | 119 |
| 82 | 3300005354 | Ga0070675_100119203 | Ga0070675_1001192033 | 119 |
| 83 | 3300005354 | Ga0070675_100153456 | Ga0070675_1001534561 | 119 |
| 84 | 3300005354 | Ga0070675_100331730 | Ga0070675_1003317302 | 119 |
| 85 | 3300005355 | Ga0070671_100056167 | Ga0070671_1000561671 | 119 |
| 86 | 3300005355 | Ga0070671_100261210 | Ga0070671_1002612102 | 119 |
| 87 | 3300005355 | Ga0070671_100538350 | Ga0070671_1005383501 | 119 |
| 88 | 3300005355 | Ga0070671_101412243 | Ga0070671_1014122431 | 119 |
| 89 | 3300005356 | Ga0070674_100031187 | Ga0070674_1000311871 | 119 |
| 90 | 3300005356 | Ga0070674_100382789 | Ga0070674_1003827892 | 119 |
| 91 | 3300005356 | Ga0070674_100649687 | Ga0070674_1006496872 | 119 |
| 92 | 3300005364 | Ga0070673_100074023 | Ga0070673_1000740231 | 119 |
| 93 | 3300005364 | Ga0070673_100220363 | Ga0070673_1002203631 | 119 |
| 94 | 3300005364 | Ga0070673_100592469 | Ga0070673_1005924692 | 119 |
| 95 | 3300005364 | Ga0070673_100654566 | Ga0070673_1006545662 | 119 |
| 96 | 3300005364 | Ga0070673_101144362 | Ga0070673_1011443621 | 119 |
| 97 | 3300005364 | Ga0070673_101559123 | Ga0070673_1015591231 | 119 |
| 98 | 3300005364 | Ga0070673_101631829 | Ga0070673_1016318292 | 119 |
| 99 | 3300005365 | Ga0070688_100093127 | Ga0070688_1000931272 | 119 |
| 100 | 3300005365 | Ga0070688_100301395 | Ga0070688_1003013951 | 119 |
| 101 | 3300005365 | Ga0070688_101508146 | Ga0070688_1015081461 | 119 |
| 102 | 3300005366 | Ga0070659_100069554 | Ga0070659_1000695544 | 119 |
| 103 | 3300005367 | Ga0070667_100059036 | Ga0070667_1000590361 | 119 |
| 104 | 3300005367 | Ga0070667_100083177 | Ga0070667_1000831773 | 119 |
| 105 | 3300005367 | Ga0070667_100120350 | Ga0070667_1001203502 | 119 |
| 106 | 3300005367 | Ga0070667_100229768 | Ga0070667_1002297682 | 119 |
| 107 | 3300005367 | Ga0070667_100808260 | Ga0070667_1008082602 | 119 |
| 108 | 3300005367 | Ga0070667_100819935 | Ga0070667_1008199351 | 119 |
| 109 | 3300005367 | Ga0070667_101815569 | Ga0070667_1018155691 | 119 |
| 110 | 3300005434 | Ga0070709_11368966 | Ga0070709_113689661 | 119 |
| 111 | 3300005436 | Ga0070713_101030656 | Ga0070713_1010306562 | 119 |
| 112 | 3300005438 | Ga0070701_10946258 | Ga0070701_109462581 | 119 |
| 113 | 3300005441 | Ga0070700_100106015 | Ga0070700_1001060152 | 119 |
| 114 | 3300005441 | Ga0070700_101734848 | Ga0070700_1017348481 | 119 |
| 115 | 3300005455 | Ga0070663_100439828 | Ga0070663_1004398281 | 119 |
| 116 | 3300005455 | Ga0070663_101334453 | Ga0070663_1013344531 | 119 |
| 117 | 3300005456 | Ga0070678_101300074 | Ga0070678_1013000741 | 119 |
| 118 | 3300005456 | Ga0070678_101500547 | Ga0070678_1015005471 | 119 |
| 119 | 3300005457 | Ga0070662_100380875 | Ga0070662_1003808752 | 119 |
| 120 | 3300005457 | Ga0070662_101072637 | Ga0070662_1010726371 | 119 |
| 121 | 3300005457 | Ga0070662_101714678 | Ga0070662_1017146781 | 119 |
| 122 | 3300005459 | Ga0068867_100141751 | Ga0068867_1001417511 | 119 |
| 123 | 3300005459 | Ga0068867_100583220 | Ga0068867_1005832202 | 119 |
| 124 | 3300005459 | Ga0068867_101468170 | Ga0068867_1014681701 | 119 |
| 125 | 3300005466 | Ga0070685_10024602 | Ga0070685_100246022 | 119 |
| 126 | 3300005466 | Ga0070685_10086939 | Ga0070685_100869392 | 119 |
| 127 | 3300005466 | Ga0070685_10109046 | Ga0070685_101090462 | 119 |
| 128 | 3300005466 | Ga0070685_10545990 | Ga0070685_105459901 | 119 |
| 129 | 3300005471 | Ga0070698_100005484 | Ga0070698_10000548415 | 119 |
| 130 | 3300005471 | Ga0070698_100022480 | Ga0070698_1000224807 | 119 |
| 131 | 3300005471 | Ga0070698_100031347 | Ga0070698_1000313474 | 119 |
| 132 | 3300005530 | Ga0070679_100554036 | Ga0070679_1005540362 | 119 |
| 133 | 3300005535 | Ga0070684_100002669 | Ga0070684_1000026697 | 119 |
| 134 | 3300005535 | Ga0070684_100118730 | Ga0070684_1001187302 | 119 |
| 135 | 3300005539 | Ga0068853_100917433 | Ga0068853_1009174333 | 119 |
| 136 | 3300005539 | Ga0068853_101122854 | Ga0068853_1011228541 | 119 |
| 137 | 3300005543 | Ga0070672_100141813 | Ga0070672_1001418133 | 119 |
| 138 | 3300005543 | Ga0070672_100354266 | Ga0070672_1003542662 | 119 |
| 139 | 3300005543 | Ga0070672_100621451 | Ga0070672_1006214512 | 119 |
| 140 | 3300005543 | Ga0070672_100799900 | Ga0070672_1007999003 | 119 |
| 141 | 3300005544 | Ga0070686_100842835 | Ga0070686_1008428352 | 119 |
| 142 | 3300005544 | Ga0070686_101392866 | Ga0070686_1013928662 | 119 |
| 143 | 3300005548 | Ga0070665_100064660 | Ga0070665_1000646603 | 119 |
| 144 | 3300005548 | Ga0070665_100337642 | Ga0070665_1003376422 | 119 |
| 145 | 3300005548 | Ga0070665_100757338 | Ga0070665_1007573381 | 119 |
| 146 | 3300005549 | Ga0070704_100528198 | Ga0070704_1005281981 | 119 |
| 147 | 3300005564 | Ga0070664_100087600 | Ga0070664_1000876002 | 119 |
| 148 | 3300005564 | Ga0070664_100165434 | Ga0070664_1001654342 | 119 |
| 149 | 3300005564 | Ga0070664_100184399 | Ga0070664_1001843991 | 119 |
| 150 | 3300005564 | Ga0070664_100197470 | Ga0070664_1001974702 | 119 |
| 151 | 3300005564 | Ga0070664_100491359 | Ga0070664_1004913592 | 119 |
| 152 | 3300005564 | Ga0070664_100549610 | Ga0070664_1005496101 | 119 |
| 153 | 3300005564 | Ga0070664_100719467 | Ga0070664_1007194671 | 119 |
| 154 | 3300005577 | Ga0068857_100073434 | Ga0068857_1000734342 | 119 |
| 155 | 3300005577 | Ga0068857_100719268 | Ga0068857_1007192682 | 119 |
| 156 | 3300005577 | Ga0068857_100901152 | Ga0068857_1009011522 | 119 |
| 157 | 3300005577 | Ga0068857_102171205 | Ga0068857_1021712051 | 119 |
| 158 | 3300005578 | Ga0068854_100571855 | Ga0068854_1005718552 | 119 |
| 159 | 3300005578 | Ga0068854_100841276 | Ga0068854_1008412761 | 119 |
| 160 | 3300005615 | Ga0070702_100289838 | Ga0070702_1002898381 | 119 |
| 161 | 3300005615 | Ga0070702_101155166 | Ga0070702_1011551661 | 119 |
| 162 | 3300005616 | Ga0068852_100080524 | Ga0068852_1000805243 | 119 |
| 163 | 3300005616 | Ga0068852_100406241 | Ga0068852_1004062412 | 119 |
| 164 | 3300005616 | Ga0068852_100505890 | Ga0068852_1005058902 | 119 |
| 165 | 3300005617 | Ga0068859_100013562 | Ga0068859_1000135627 | 119 |
| 166 | 3300005617 | Ga0068859_100013830 | Ga0068859_10001383010 | 119 |
| 167 | 3300005617 | Ga0068859_100042847 | Ga0068859_1000428471 | 119 |
| 168 | 3300005617 | Ga0068859_100145417 | Ga0068859_1001454173 | 119 |
| 169 | 3300005617 | Ga0068859_100268908 | Ga0068859_1002689082 | 119 |
| 170 | 3300005617 | Ga0068859_100355209 | Ga0068859_1003552092 | 119 |
| 171 | 3300005617 | Ga0068859_100516580 | Ga0068859_1005165802 | 119 |
| 172 | 3300005617 | Ga0068859_100555425 | Ga0068859_1005554253 | 119 |
| 173 | 3300005617 | Ga0068859_100609294 | Ga0068859_1006092942 | 119 |
| 174 | 3300005617 | Ga0068859_100759746 | Ga0068859_1007597462 | 119 |
| 175 | 3300005617 | Ga0068859_100786647 | Ga0068859_1007866472 | 119 |
| 176 | 3300005617 | Ga0068859_101419754 | Ga0068859_1014197541 | 119 |
| 177 | 3300005617 | Ga0068859_101489715 | Ga0068859_1014897152 | 119 |
| 178 | 3300005617 | Ga0068859_102338479 | Ga0068859_1023384792 | 119 |
| 179 | 3300005617 | Ga0068859_102854114 | Ga0068859_1028541141 | 119 |
| 180 | 3300005618 | Ga0068864_100010460 | Ga0068864_1000104601 | 119 |
| 181 | 3300005618 | Ga0068864_100192211 | Ga0068864_1001922112 | 119 |
| 182 | 3300005618 | Ga0068864_100950092 | Ga0068864_1009500921 | 119 |
| 183 | 3300005618 | Ga0068864_101938783 | Ga0068864_1019387831 | 119 |
| 184 | 3300005718 | Ga0068866_10074811 | Ga0068866_100748112 | 119 |
| 185 | 3300005718 | Ga0068866_10305692 | Ga0068866_103056921 | 119 |
| 186 | 3300005718 | Ga0068866_10787442 | Ga0068866_107874422 | 119 |
| 187 | 3300005719 | Ga0068861_100051340 | Ga0068861_1000513402 | 119 |
| 188 | 3300005719 | Ga0068861_100054764 | Ga0068861_1000547642 | 119 |
| 189 | 3300005719 | Ga0068861_100087878 | Ga0068861_1000878786 | 119 |
| 190 | 3300005719 | Ga0068861_100649976 | Ga0068861_1006499763 | 119 |
| 191 | 3300005719 | Ga0068861_101132408 | Ga0068861_1011324082 | 119 |
| 192 | 3300005719 | Ga0068861_102501786 | Ga0068861_1025017861 | 119 |
| 193 | 3300005834 | Ga0068851_10424510 | Ga0068851_104245101 | 119 |
| 194 | 3300005840 | Ga0068870_10780175 | Ga0068870_107801752 | 119 |
| 195 | 3300005840 | Ga0068870_11237958 | Ga0068870_112379581 | 119 |
| 196 | 3300005841 | Ga0068863_100001966 | Ga0068863_10000196623 | 119 |
| 197 | 3300005841 | Ga0068863_100145776 | Ga0068863_1001457762 | 119 |
| 198 | 3300005841 | Ga0068863_101051708 | Ga0068863_1010517081 | 119 |
| 199 | 3300005841 | Ga0068863_101170353 | Ga0068863_1011703532 | 119 |
| 200 | 3300005841 | Ga0068863_102580928 | Ga0068863_1025809282 | 119 |
| 201 | 3300005842 | Ga0068858_100221633 | Ga0068858_1002216332 | 119 |
| 202 | 3300005842 | Ga0068858_100355511 | Ga0068858_1003555112 | 119 |
| 203 | 3300005842 | Ga0068858_100703032 | Ga0068858_1007030321 | 119 |
| 204 | 3300005843 | Ga0068860_100004009 | Ga0068860_1000040095 | 119 |
| 205 | 3300005843 | Ga0068860_100005881 | Ga0068860_1000058816 | 119 |
| 206 | 3300005843 | Ga0068860_100195525 | Ga0068860_1001955253 | 119 |
| 207 | 3300005843 | Ga0068860_100239146 | Ga0068860_1002391462 | 119 |
| 208 | 3300005843 | Ga0068860_101104792 | Ga0068860_1011047922 | 119 |
| 209 | 3300005843 | Ga0068860_102568950 | Ga0068860_1025689501 | 119 |
| 210 | 3300005844 | Ga0068862_100415963 | Ga0068862_1004159632 | 119 |
| 211 | 3300005844 | Ga0068862_100849258 | Ga0068862_1008492582 | 119 |
| 212 | 3300005844 | Ga0068862_101346236 | Ga0068862_1013462362 | 119 |
| 213 | 3300005844 | Ga0068862_101412879 | Ga0068862_1014128792 | 119 |
| 214 | 3300005985 | Ga0081539_10001794 | Ga0081539_1000179418 | 119 |
| 215 | 3300006028 | Ga0070717_11221272 | Ga0070717_112212721 | 119 |
| 216 | 3300006058 | Ga0075432_10312819 | Ga0075432_103128191 | 119 |
| 217 | 3300006058 | Ga0075432_10494114 | Ga0075432_104941141 | 119 |
| 218 | 3300006163 | Ga0070715_10540631 | Ga0070715_105406311 | 119 |
| 219 | 3300006173 | Ga0070716_100271747 | Ga0070716_1002717472 | 119 |
| 220 | 3300006237 | Ga0097621_100005069 | Ga0097621_1000050699 | 119 |
| 221 | 3300006237 | Ga0097621_100204497 | Ga0097621_1002044972 | 119 |
| 222 | 3300006237 | Ga0097621_100343939 | Ga0097621_1003439391 | 119 |
| 223 | 3300006237 | Ga0097621_100460416 | Ga0097621_1004604161 | 119 |
| 224 | 3300006237 | Ga0097621_100568195 | Ga0097621_1005681952 | 119 |
| 225 | 3300006237 | Ga0097621_101572586 | Ga0097621_1015725861 | 119 |
| 226 | 3300006353 | Ga0075370_10874260 | Ga0075370_108742601 | 119 |
| 227 | 3300006358 | Ga0068871_100008961 | Ga0068871_1000089613 | 119 |
| 228 | 3300006358 | Ga0068871_100017013 | Ga0068871_1000170134 | 119 |
| 229 | 3300006358 | Ga0068871_100327403 | Ga0068871_1003274032 | 119 |
| 230 | 3300006358 | Ga0068871_100827830 | Ga0068871_1008278301 | 119 |
| 231 | 3300006358 | Ga0068871_101024414 | Ga0068871_1010244141 | 119 |
| 232 | 3300006844 | Ga0075428_100012494 | Ga0075428_1000124942 | 119 |
| 233 | 3300006844 | Ga0075428_102595621 | Ga0075428_1025956212 | 119 |
| 234 | 3300006846 | Ga0075430_100817277 | Ga0075430_1008172771 | 119 |
| 235 | 3300006847 | Ga0075431_100055186 | Ga0075431_1000551862 | 119 |
| 236 | 3300006847 | Ga0075431_101566198 | Ga0075431_1015661981 | 119 |
| 237 | 3300006880 | Ga0075429_100006150 | Ga0075429_1000061508 | 119 |
| 238 | 3300006880 | Ga0075429_100313024 | Ga0075429_1003130242 | 119 |
| 239 | 3300006880 | Ga0075429_100463541 | Ga0075429_1004635412 | 119 |
| 240 | 3300006881 | Ga0068865_100359529 | Ga0068865_1003595292 | 119 |
| 241 | 3300006931 | Ga0097620_100013560 | Ga0097620_1000135607 | 119 |
| 242 | 3300006931 | Ga0097620_100013830 | Ga0097620_10001383010 | 119 |
| 243 | 3300006931 | Ga0097620_100042845 | Ga0097620_1000428451 | 119 |
| 244 | 3300006931 | Ga0097620_100145418 | Ga0097620_1001454181 | 119 |
| 245 | 3300006931 | Ga0097620_100268914 | Ga0097620_1002689142 | 119 |
| 246 | 3300006931 | Ga0097620_100355215 | Ga0097620_1003552152 | 119 |
| 247 | 3300006931 | Ga0097620_100516578 | Ga0097620_1005165781 | 119 |
| 248 | 3300006931 | Ga0097620_100555436 | Ga0097620_1005554362 | 119 |
| 249 | 3300006931 | Ga0097620_100609262 | Ga0097620_1006092622 | 119 |
| 250 | 3300006931 | Ga0097620_100759728 | Ga0097620_1007597282 | 119 |
| 251 | 3300006931 | Ga0097620_100786663 | Ga0097620_1007866632 | 119 |
| 252 | 3300006931 | Ga0097620_101419866 | Ga0097620_1014198661 | 119 |
| 253 | 3300006931 | Ga0097620_101489543 | Ga0097620_1014895431 | 119 |
| 254 | 3300006931 | Ga0097620_102339664 | Ga0097620_1023396642 | 119 |
| 255 | 3300006931 | Ga0097620_102855217 | Ga0097620_1028552171 | 119 |
| 256 | 3300009011 | Ga0105251_10053057 | Ga0105251_100530571 | 119 |
| 257 | 3300009011 | Ga0105251_10065440 | Ga0105251_100654402 | 119 |
| 258 | 3300009036 | Ga0105244_10000004 | Ga0105244_10000004218 | 119 |
| 259 | 3300009093 | Ga0105240_10669872 | Ga0105240_106698722 | 119 |
| 260 | 3300009093 | Ga0105240_12165303 | Ga0105240_121653031 | 119 |
| 261 | 3300009094 | Ga0111539_10041924 | Ga0111539_100419242 | 119 |
| 262 | 3300009094 | Ga0111539_10054398 | Ga0111539_100543982 | 119 |
| 263 | 3300009094 | Ga0111539_10433793 | Ga0111539_104337933 | 119 |
| 264 | 3300009094 | Ga0111539_11018641 | Ga0111539_110186412 | 119 |
| 265 | 3300009094 | Ga0111539_11388357 | Ga0111539_113883571 | 119 |
| 266 | 3300009094 | Ga0111539_11414666 | Ga0111539_114146662 | 119 |
| 267 | 3300009094 | Ga0111539_13476687 | Ga0111539_134766871 | 119 |
| 268 | 3300009101 | Ga0105247_10001409 | Ga0105247_1000140918 | 119 |
| 269 | 3300009101 | Ga0105247_10240118 | Ga0105247_102401182 | 119 |
| 270 | 3300009147 | Ga0114129_10069169 | Ga0114129_100691692 | 119 |
| 271 | 3300009147 | Ga0114129_10085559 | Ga0114129_100855592 | 119 |
| 272 | 3300009147 | Ga0114129_11658103 | Ga0114129_116581031 | 119 |
| 273 | 3300009147 | Ga0114129_13124094 | Ga0114129_131240941 | 119 |
| 274 | 3300009147 | Ga0114129_13378419 | Ga0114129_133784192 | 119 |
| 275 | 3300009148 | Ga0105243_11763213 | Ga0105243_117632132 | 119 |
| 276 | 3300009174 | Ga0105241_10200544 | Ga0105241_102005442 | 119 |
| 277 | 3300009174 | Ga0105241_10358736 | Ga0105241_103587361 | 119 |
| 278 | 3300009174 | Ga0105241_11591563 | Ga0105241_115915631 | 119 |
| 279 | 3300009174 | Ga0105241_11725373 | Ga0105241_117253732 | 119 |
| 280 | 3300009176 | Ga0105242_10002507 | Ga0105242_100025072 | 119 |
| 281 | 3300009176 | Ga0105242_10016969 | Ga0105242_100169694 | 119 |
| 282 | 3300009176 | Ga0105242_10236415 | Ga0105242_102364152 | 119 |
| 283 | 3300009176 | Ga0105242_10523942 | Ga0105242_105239421 | 119 |
| 284 | 3300009176 | Ga0105242_11902181 | Ga0105242_119021811 | 119 |
| 285 | 3300009176 | Ga0105242_13009761 | Ga0105242_130097611 | 119 |
| 286 | 3300009177 | Ga0105248_10390555 | Ga0105248_103905551 | 119 |
| 287 | 3300009177 | Ga0105248_11002871 | Ga0105248_110028712 | 119 |
| 288 | 3300009545 | Ga0105237_10797586 | Ga0105237_107975861 | 119 |
| 289 | 3300009545 | Ga0105237_11305305 | Ga0105237_113053052 | 119 |
| 290 | 3300009545 | Ga0105237_12220334 | Ga0105237_122203341 | 119 |
| 291 | 3300009553 | Ga0105249_10001319 | Ga0105249_1000131912 | 119 |
| 292 | 3300009553 | Ga0105249_10003297 | Ga0105249_100032976 | 119 |
| 293 | 3300009553 | Ga0105249_10007594 | Ga0105249_1000759412 | 119 |
| 294 | 3300009553 | Ga0105249_10116159 | Ga0105249_101161592 | 119 |
| 295 | 3300009553 | Ga0105249_10239858 | Ga0105249_102398582 | 119 |
| 296 | 3300009553 | Ga0105249_10317806 | Ga0105249_103178062 | 119 |
| 297 | 3300009553 | Ga0105249_10352843 | Ga0105249_103528432 | 119 |
| 298 | 3300009553 | Ga0105249_11384769 | Ga0105249_113847691 | 119 |
| 299 | 3300009553 | Ga0105249_11389812 | Ga0105249_113898121 | 119 |
| 300 | 3300009553 | Ga0105249_11763330 | Ga0105249_117633301 | 119 |
| 301 | 3300009553 | Ga0105249_11799193 | Ga0105249_117991931 | 119 |
| 302 | 3300009553 | Ga0105249_12793819 | Ga0105249_127938192 | 119 |
| 303 | 3300010375 | Ga0105239_10502842 | Ga0105239_105028422 | 119 |
| 304 | 3300011119 | Ga0105246_10062756 | Ga0105246_100627562 | 119 |
| 305 | 3300011119 | Ga0105246_10134559 | Ga0105246_101345592 | 119 |
| 306 | 3300011119 | Ga0105246_10808700 | Ga0105246_108087002 | 119 |
| 307 | 3300013100 | Ga0157373_10000002 | Ga0157373_10000002230 | 119 |
| 308 | 3300013100 | Ga0157373_10011815 | Ga0157373_100118151 | 119 |
| 309 | 3300013100 | Ga0157373_10564275 | Ga0157373_105642751 | 119 |
| 310 | 3300013100 | Ga0157373_10605037 | Ga0157373_106050371 | 119 |
| 311 | 3300013100 | Ga0157373_11101378 | Ga0157373_111013781 | 119 |
| 312 | 3300013102 | Ga0157371_10130310 | Ga0157371_101303102 | 119 |
| 313 | 3300013102 | Ga0157371_10363368 | Ga0157371_103633682 | 119 |
| 314 | 3300013104 | Ga0157370_10000097 | Ga0157370_1000009733 | 119 |
| 315 | 3300013104 | Ga0157370_10002822 | Ga0157370_1000282210 | 119 |
| 316 | 3300013104 | Ga0157370_10137162 | Ga0157370_101371622 | 119 |
| 317 | 3300013104 | Ga0157370_10166724 | Ga0157370_101667243 | 119 |
| 318 | 3300013104 | Ga0157370_10170945 | Ga0157370_101709451 | 119 |
| 319 | 3300013105 | Ga0157369_10009083 | Ga0157369_100090837 | 119 |
| 320 | 3300013105 | Ga0157369_10030197 | Ga0157369_100301973 | 119 |
| 321 | 3300013105 | Ga0157369_10064219 | Ga0157369_100642194 | 119 |
| 322 | 3300013105 | Ga0157369_11268232 | Ga0157369_112682321 | 119 |
| 323 | 3300013296 | Ga0157374_10008802 | Ga0157374_100088022 | 119 |
| 324 | 3300013296 | Ga0157374_10027181 | Ga0157374_100271813 | 119 |
| 325 | 3300013296 | Ga0157374_10137876 | Ga0157374_101378763 | 119 |
| 326 | 3300013296 | Ga0157374_10182966 | Ga0157374_101829663 | 119 |
| 327 | 3300013296 | Ga0157374_10420638 | Ga0157374_104206382 | 119 |
| 328 | 3300013296 | Ga0157374_10537427 | Ga0157374_105374271 | 119 |
| 329 | 3300013296 | Ga0157374_12280875 | Ga0157374_122808752 | 119 |
| 330 | 3300013297 | Ga0157378_10011051 | Ga0157378_100110518 | 119 |
| 331 | 3300013297 | Ga0157378_10022058 | Ga0157378_100220585 | 119 |
| 332 | 3300013297 | Ga0157378_10199073 | Ga0157378_101990732 | 119 |
| 333 | 3300013297 | Ga0157378_10237076 | Ga0157378_102370761 | 119 |
| 334 | 3300013297 | Ga0157378_10439418 | Ga0157378_104394182 | 119 |
| 335 | 3300013297 | Ga0157378_10906581 | Ga0157378_109065811 | 119 |
| 336 | 3300013297 | Ga0157378_11150171 | Ga0157378_111501712 | 119 |
| 337 | 3300013306 | Ga0163162_10019416 | Ga0163162_100194162 | 119 |
| 338 | 3300013306 | Ga0163162_10026218 | Ga0163162_100262185 | 119 |
| 339 | 3300013306 | Ga0163162_10034614 | Ga0163162_100346143 | 119 |
| 340 | 3300013306 | Ga0163162_10093233 | Ga0163162_100932332 | 119 |
| 341 | 3300013306 | Ga0163162_10124962 | Ga0163162_101249622 | 119 |
| 342 | 3300013306 | Ga0163162_10204595 | Ga0163162_102045952 | 119 |
| 343 | 3300013306 | Ga0163162_10301734 | Ga0163162_103017342 | 119 |
| 344 | 3300013306 | Ga0163162_10676330 | Ga0163162_106763302 | 119 |
| 345 | 3300013306 | Ga0163162_10743235 | Ga0163162_107432352 | 119 |
| 346 | 3300013306 | Ga0163162_10794787 | Ga0163162_107947871 | 119 |
| 347 | 3300013306 | Ga0163162_10914492 | Ga0163162_109144922 | 119 |
| 348 | 3300013306 | Ga0163162_11037318 | Ga0163162_110373182 | 119 |
| 349 | 3300013306 | Ga0163162_11266750 | Ga0163162_112667502 | 119 |
| 350 | 3300013306 | Ga0163162_12286148 | Ga0163162_122861481 | 119 |
| 351 | 3300013306 | Ga0163162_12352130 | Ga0163162_123521301 | 119 |
| 352 | 3300013307 | Ga0157372_10149650 | Ga0157372_101496505 | 119 |
| 353 | 3300013307 | Ga0157372_10251303 | Ga0157372_102513032 | 119 |
| 354 | 3300013307 | Ga0157372_10353004 | Ga0157372_103530041 | 119 |
| 355 | 3300013307 | Ga0157372_11560919 | Ga0157372_115609191 | 119 |
| 356 | 3300013307 | Ga0157372_11699701 | Ga0157372_116997012 | 119 |
| 357 | 3300013307 | Ga0157372_12590426 | Ga0157372_125904261 | 119 |
| 358 | 3300013307 | Ga0157372_12690523 | Ga0157372_126905231 | 119 |
| 359 | 3300013307 | Ga0157372_12991807 | Ga0157372_129918071 | 119 |
| 360 | 3300013308 | Ga0157375_10006773 | Ga0157375_100067738 | 119 |
| 361 | 3300013308 | Ga0157375_10057411 | Ga0157375_100574112 | 119 |
| 362 | 3300013308 | Ga0157375_10079911 | Ga0157375_100799112 | 119 |
| 363 | 3300013308 | Ga0157375_10082143 | Ga0157375_100821433 | 119 |
| 364 | 3300013308 | Ga0157375_10092904 | Ga0157375_100929042 | 119 |
| 365 | 3300013308 | Ga0157375_10126295 | Ga0157375_101262955 | 119 |
| 366 | 3300013308 | Ga0157375_10140620 | Ga0157375_101406202 | 119 |
| 367 | 3300013308 | Ga0157375_10200943 | Ga0157375_102009432 | 119 |
| 368 | 3300013308 | Ga0157375_10322326 | Ga0157375_103223262 | 119 |
| 369 | 3300013308 | Ga0157375_10697142 | Ga0157375_106971421 | 119 |
| 370 | 3300013308 | Ga0157375_10814958 | Ga0157375_108149581 | 119 |
| 371 | 3300013308 | Ga0157375_11220379 | Ga0157375_112203792 | 119 |
| 372 | 3300013308 | Ga0157375_12344968 | Ga0157375_123449682 | 119 |
| 373 | 3300014325 | Ga0163163_10001981 | Ga0163163_1000198116 | 119 |
| 374 | 3300014325 | Ga0163163_10514137 | Ga0163163_105141372 | 119 |
| 375 | 3300014325 | Ga0163163_10673108 | Ga0163163_106731082 | 119 |
| 376 | 3300014325 | Ga0163163_11514557 | Ga0163163_115145572 | 119 |
| 377 | 3300014325 | Ga0163163_12147433 | Ga0163163_121474332 | 119 |
| 378 | 3300014325 | Ga0163163_12178397 | Ga0163163_121783971 | 119 |
| 379 | 3300014325 | Ga0163163_12992740 | Ga0163163_129927401 | 119 |
| 380 | 3300014326 | Ga0157380_10014307 | Ga0157380_100143078 | 119 |
| 381 | 3300014326 | Ga0157380_10018408 | Ga0157380_100184082 | 119 |
| 382 | 3300014326 | Ga0157380_10098483 | Ga0157380_100984832 | 119 |
| 383 | 3300014326 | Ga0157380_10861281 | Ga0157380_108612811 | 119 |
| 384 | 3300014326 | Ga0157380_10953870 | Ga0157380_109538702 | 119 |
| 385 | 3300014326 | Ga0157380_11059303 | Ga0157380_110593031 | 119 |
| 386 | 3300014326 | Ga0157380_11294363 | Ga0157380_112943631 | 119 |
| 387 | 3300014326 | Ga0157380_11843938 | Ga0157380_118439381 | 119 |
| 388 | 3300014326 | Ga0157380_11901490 | Ga0157380_119014901 | 119 |
| 389 | 3300014745 | Ga0157377_10013851 | Ga0157377_100138514 | 119 |
| 390 | 3300014745 | Ga0157377_10071880 | Ga0157377_100718804 | 119 |
| 391 | 3300014745 | Ga0157377_10101437 | Ga0157377_101014372 | 119 |
| 392 | 3300014745 | Ga0157377_11135217 | Ga0157377_111352171 | 119 |
| 393 | 3300014745 | Ga0157377_11337023 | Ga0157377_113370232 | 119 |
| 394 | 3300014968 | Ga0157379_10016773 | Ga0157379_100167732 | 119 |
| 395 | 3300014968 | Ga0157379_10168872 | Ga0157379_101688721 | 119 |
| 396 | 3300014968 | Ga0157379_10186779 | Ga0157379_101867791 | 119 |
| 397 | 3300014968 | Ga0157379_10635773 | Ga0157379_106357731 | 119 |
| 398 | 3300014968 | Ga0157379_10809923 | Ga0157379_108099231 | 119 |
| 399 | 3300014968 | Ga0157379_10984598 | Ga0157379_109845982 | 119 |
| 400 | 3300014969 | Ga0157376_10091666 | Ga0157376_100916662 | 119 |
| 401 | 3300014969 | Ga0157376_10264607 | Ga0157376_102646072 | 119 |
| 402 | 3300014969 | Ga0157376_10565587 | Ga0157376_105655871 | 119 |
| 403 | 3300014969 | Ga0157376_11098384 | Ga0157376_110983841 | 119 |
| 404 | 3300014969 | Ga0157376_11736848 | Ga0157376_117368481 | 119 |
| 405 | 3300014969 | Ga0157376_12998747 | Ga0157376_129987471 | 119 |
| 406 | 3300015261 | Ga0182006_1002176 | Ga0182006_10021769 | 119 |
| 407 | 3300015262 | Ga0182007_10180118 | Ga0182007_101801182 | 119 |
| 408 | 3300017792 | Ga0163161_10000026 | Ga0163161_1000002646 | 119 |
| 409 | 3300017792 | Ga0163161_10139905 | Ga0163161_101399052 | 119 |
| 410 | 3300017792 | Ga0163161_10153991 | Ga0163161_101539912 | 119 |
| 411 | 3300017792 | Ga0163161_10211944 | Ga0163161_102119442 | 119 |
| 412 | 3300017792 | Ga0163161_10429485 | Ga0163161_104294851 | 119 |
| 413 | 3300017792 | Ga0163161_10931595 | Ga0163161_109315951 | 119 |
| 414 | 3300025315 | Ga0207697_10107638 | Ga0207697_101076382 | 119 |
| 415 | 3300025728 | Ga0207655_1000008 | Ga0207655_1000008370 | 119 |
| 416 | 3300025735 | Ga0207713_1163087 | Ga0207713_11630872 | 119 |
| 417 | 3300025735 | Ga0207713_1247042 | Ga0207713_12470421 | 119 |
| 418 | 3300025893 | Ga0207682_10029013 | Ga0207682_100290132 | 119 |
| 419 | 3300025899 | Ga0207642_10212513 | Ga0207642_102125132 | 119 |
| 420 | 3300025899 | Ga0207642_10667951 | Ga0207642_106679511 | 119 |
| 421 | 3300025900 | Ga0207710_10015279 | Ga0207710_100152792 | 119 |
| 422 | 3300025901 | Ga0207688_10110660 | Ga0207688_101106602 | 119 |
| 423 | 3300025903 | Ga0207680_10072531 | Ga0207680_100725312 | 119 |
| 424 | 3300025903 | Ga0207680_10088068 | Ga0207680_100880682 | 119 |
| 425 | 3300025903 | Ga0207680_11016188 | Ga0207680_110161882 | 119 |
| 426 | 3300025904 | Ga0207647_10042205 | Ga0207647_100422052 | 119 |
| 427 | 3300025904 | Ga0207647_10222973 | Ga0207647_102229732 | 119 |
| 428 | 3300025907 | Ga0207645_10011823 | Ga0207645_100118232 | 119 |
| 429 | 3300025907 | Ga0207645_10692343 | Ga0207645_106923431 | 119 |
| 430 | 3300025908 | Ga0207643_10400214 | Ga0207643_104002142 | 119 |
| 431 | 3300025908 | Ga0207643_10923180 | Ga0207643_109231802 | 119 |
| 432 | 3300025909 | Ga0207705_10689300 | Ga0207705_106893001 | 119 |
| 433 | 3300025910 | Ga0207684_11352300 | Ga0207684_113523002 | 119 |
| 434 | 3300025911 | Ga0207654_10833869 | Ga0207654_108338691 | 119 |
| 435 | 3300025918 | Ga0207662_10020618 | Ga0207662_100206183 | 119 |
| 436 | 3300025918 | Ga0207662_10459852 | Ga0207662_104598522 | 119 |
| 437 | 3300025919 | Ga0207657_10168828 | Ga0207657_101688281 | 119 |
| 438 | 3300025920 | Ga0207649_10133661 | Ga0207649_101336612 | 119 |
| 439 | 3300025920 | Ga0207649_10428961 | Ga0207649_104289612 | 119 |
| 440 | 3300025921 | Ga0207652_10816856 | Ga0207652_108168562 | 119 |
| 441 | 3300025922 | Ga0207646_10194660 | Ga0207646_101946602 | 119 |
| 442 | 3300025923 | Ga0207681_10140828 | Ga0207681_101408282 | 119 |
| 443 | 3300025923 | Ga0207681_11018178 | Ga0207681_110181781 | 119 |
| 444 | 3300025923 | Ga0207681_11816878 | Ga0207681_118168781 | 119 |
| 445 | 3300025925 | Ga0207650_10035597 | Ga0207650_100355975 | 119 |
| 446 | 3300025925 | Ga0207650_10118760 | Ga0207650_101187603 | 119 |
| 447 | 3300025925 | Ga0207650_10265935 | Ga0207650_102659352 | 119 |
| 448 | 3300025925 | Ga0207650_10316727 | Ga0207650_103167272 | 119 |
| 449 | 3300025925 | Ga0207650_11107185 | Ga0207650_111071852 | 119 |
| 450 | 3300025925 | Ga0207650_11260871 | Ga0207650_112608711 | 119 |
| 451 | 3300025925 | Ga0207650_11332689 | Ga0207650_113326892 | 119 |
| 452 | 3300025926 | Ga0207659_10055394 | Ga0207659_100553942 | 119 |
| 453 | 3300025926 | Ga0207659_10221808 | Ga0207659_102218082 | 119 |
| 454 | 3300025926 | Ga0207659_10416583 | Ga0207659_104165832 | 119 |
| 455 | 3300025926 | Ga0207659_11279398 | Ga0207659_112793981 | 119 |
| 456 | 3300025926 | Ga0207659_11419690 | Ga0207659_114196902 | 119 |
| 457 | 3300025926 | Ga0207659_11692003 | Ga0207659_116920031 | 119 |
| 458 | 3300025928 | Ga0207700_11050547 | Ga0207700_110505471 | 119 |
| 459 | 3300025931 | Ga0207644_10212241 | Ga0207644_102122412 | 119 |
| 460 | 3300025931 | Ga0207644_10433401 | Ga0207644_104334012 | 119 |
| 461 | 3300025933 | Ga0207706_10045661 | Ga0207706_100456612 | 119 |
| 462 | 3300025933 | Ga0207706_10074986 | Ga0207706_100749862 | 119 |
| 463 | 3300025933 | Ga0207706_10267209 | Ga0207706_102672092 | 119 |
| 464 | 3300025933 | Ga0207706_10449222 | Ga0207706_104492223 | 119 |
| 465 | 3300025933 | Ga0207706_10696234 | Ga0207706_106962342 | 119 |
| 466 | 3300025934 | Ga0207686_10000200 | Ga0207686_100002006 | 119 |
| 467 | 3300025934 | Ga0207686_11263386 | Ga0207686_112633861 | 119 |
| 468 | 3300025935 | Ga0207709_11240362 | Ga0207709_112403621 | 119 |
| 469 | 3300025936 | Ga0207670_10103846 | Ga0207670_101038462 | 119 |
| 470 | 3300025936 | Ga0207670_10163574 | Ga0207670_101635742 | 119 |
| 471 | 3300025936 | Ga0207670_10284640 | Ga0207670_102846401 | 119 |
| 472 | 3300025936 | Ga0207670_11505317 | Ga0207670_115053171 | 119 |
| 473 | 3300025937 | Ga0207669_10653424 | Ga0207669_106534242 | 119 |
| 474 | 3300025937 | Ga0207669_10976950 | Ga0207669_109769502 | 119 |
| 475 | 3300025937 | Ga0207669_11112106 | Ga0207669_111121061 | 119 |
| 476 | 3300025937 | Ga0207669_11137177 | Ga0207669_111371771 | 119 |
| 477 | 3300025938 | Ga0207704_10658840 | Ga0207704_106588401 | 119 |
| 478 | 3300025938 | Ga0207704_10780080 | Ga0207704_107800801 | 119 |
| 479 | 3300025939 | Ga0207665_10600284 | Ga0207665_106002841 | 119 |
| 480 | 3300025940 | Ga0207691_10090554 | Ga0207691_100905545 | 119 |
| 481 | 3300025940 | Ga0207691_10401557 | Ga0207691_104015571 | 119 |
| 482 | 3300025940 | Ga0207691_11145204 | Ga0207691_111452042 | 119 |
| 483 | 3300025940 | Ga0207691_11667356 | Ga0207691_116673561 | 119 |
| 484 | 3300025941 | Ga0207711_11242231 | Ga0207711_112422311 | 119 |
| 485 | 3300025942 | Ga0207689_10039743 | Ga0207689_100397432 | 119 |
| 486 | 3300025942 | Ga0207689_10169171 | Ga0207689_101691712 | 119 |
| 487 | 3300025942 | Ga0207689_10209134 | Ga0207689_102091342 | 119 |
| 488 | 3300025942 | Ga0207689_10260045 | Ga0207689_102600451 | 119 |
| 489 | 3300025942 | Ga0207689_10374793 | Ga0207689_103747931 | 119 |
| 490 | 3300025942 | Ga0207689_10770283 | Ga0207689_107702831 | 119 |
| 491 | 3300025944 | Ga0207661_10030202 | Ga0207661_100302022 | 119 |
| 492 | 3300025944 | Ga0207661_10226925 | Ga0207661_102269252 | 119 |
| 493 | 3300025945 | Ga0207679_10178810 | Ga0207679_101788102 | 119 |
| 494 | 3300025945 | Ga0207679_10469833 | Ga0207679_104698332 | 119 |
| 495 | 3300025949 | Ga0207667_10749876 | Ga0207667_107498761 | 119 |
| 496 | 3300025960 | Ga0207651_10384443 | Ga0207651_103844432 | 119 |
| 497 | 3300025961 | Ga0207712_10002897 | Ga0207712_100028975 | 119 |
| 498 | 3300025961 | Ga0207712_10004281 | Ga0207712_1000428111 | 119 |
| 499 | 3300025961 | Ga0207712_10077710 | Ga0207712_100777104 | 119 |
| 500 | 3300025961 | Ga0207712_10134125 | Ga0207712_101341252 | 119 |
| 501 | 3300025961 | Ga0207712_10826164 | Ga0207712_108261641 | 119 |
| 502 | 3300025961 | Ga0207712_10899806 | Ga0207712_108998062 | 119 |
| 503 | 3300025961 | Ga0207712_11963244 | Ga0207712_119632441 | 119 |
| 504 | 3300025972 | Ga0207668_10087974 | Ga0207668_100879742 | 119 |
| 505 | 3300025972 | Ga0207668_10202832 | Ga0207668_102028321 | 119 |
| 506 | 3300025972 | Ga0207668_11799895 | Ga0207668_117998951 | 119 |
| 507 | 3300025981 | Ga0207640_10447548 | Ga0207640_104475482 | 119 |
| 508 | 3300025981 | Ga0207640_10482078 | Ga0207640_104820781 | 119 |
| 509 | 3300025981 | Ga0207640_11266351 | Ga0207640_112663512 | 119 |
| 510 | 3300025986 | Ga0207658_10068775 | Ga0207658_100687751 | 119 |
| 511 | 3300025986 | Ga0207658_10363666 | Ga0207658_103636662 | 119 |
| 512 | 3300025986 | Ga0207658_10403600 | Ga0207658_104036002 | 119 |
| 513 | 3300025986 | Ga0207658_10762058 | Ga0207658_107620582 | 119 |
| 514 | 3300025986 | Ga0207658_11583956 | Ga0207658_115839562 | 119 |
| 515 | 3300026023 | Ga0207677_10033907 | Ga0207677_100339071 | 119 |
| 516 | 3300026023 | Ga0207677_10313291 | Ga0207677_103132912 | 119 |
| 517 | 3300026023 | Ga0207677_10458983 | Ga0207677_104589832 | 119 |
| 518 | 3300026023 | Ga0207677_12140386 | Ga0207677_121403861 | 119 |
| 519 | 3300026035 | Ga0207703_10304457 | Ga0207703_103044572 | 119 |
| 520 | 3300026035 | Ga0207703_10404519 | Ga0207703_104045192 | 119 |
| 521 | 3300026035 | Ga0207703_10795798 | Ga0207703_107957982 | 119 |
| 522 | 3300026041 | Ga0207639_10576649 | Ga0207639_105766492 | 119 |
| 523 | 3300026041 | Ga0207639_10918954 | Ga0207639_109189541 | 119 |
| 524 | 3300026041 | Ga0207639_11990037 | Ga0207639_119900371 | 119 |
| 525 | 3300026067 | Ga0207678_10054197 | Ga0207678_100541972 | 119 |
| 526 | 3300026067 | Ga0207678_10325103 | Ga0207678_103251032 | 119 |
| 527 | 3300026078 | Ga0207702_10983318 | Ga0207702_109833182 | 119 |
| 528 | 3300026078 | Ga0207702_10984363 | Ga0207702_109843631 | 119 |
| 529 | 3300026088 | Ga0207641_10020162 | Ga0207641_100201626 | 119 |
| 530 | 3300026088 | Ga0207641_10041489 | Ga0207641_100414892 | 119 |
| 531 | 3300026088 | Ga0207641_11046125 | Ga0207641_110461253 | 119 |
| 532 | 3300026088 | Ga0207641_11328397 | Ga0207641_113283972 | 119 |
| 533 | 3300026089 | Ga0207648_10047106 | Ga0207648_100471062 | 119 |
| 534 | 3300026089 | Ga0207648_10055161 | Ga0207648_100551615 | 119 |
| 535 | 3300026089 | Ga0207648_10057539 | Ga0207648_100575392 | 119 |
| 536 | 3300026089 | Ga0207648_10181197 | Ga0207648_101811972 | 119 |
| 537 | 3300026089 | Ga0207648_10315820 | Ga0207648_103158202 | 119 |
| 538 | 3300026089 | Ga0207648_10532132 | Ga0207648_105321321 | 119 |
| 539 | 3300026089 | Ga0207648_11332845 | Ga0207648_113328452 | 119 |
| 540 | 3300026089 | Ga0207648_11436195 | Ga0207648_114361951 | 119 |
| 541 | 3300026095 | Ga0207676_10129917 | Ga0207676_101299172 | 119 |
| 542 | 3300026095 | Ga0207676_10156593 | Ga0207676_101565932 | 119 |
| 543 | 3300026095 | Ga0207676_10157440 | Ga0207676_101574401 | 119 |
| 544 | 3300026095 | Ga0207676_10729483 | Ga0207676_107294831 | 119 |
| 545 | 3300026116 | Ga0207674_10019713 | Ga0207674_100197137 | 119 |
| 546 | 3300026116 | Ga0207674_10062109 | Ga0207674_100621095 | 119 |
| 547 | 3300026116 | Ga0207674_10180762 | Ga0207674_101807621 | 119 |
| 548 | 3300026116 | Ga0207674_10909694 | Ga0207674_109096942 | 119 |
| 549 | 3300026118 | Ga0207675_100010610 | Ga0207675_1000106106 | 119 |
| 550 | 3300026118 | Ga0207675_100034120 | Ga0207675_1000341202 | 119 |
| 551 | 3300026118 | Ga0207675_100270961 | Ga0207675_1002709612 | 119 |
| 552 | 3300026118 | Ga0207675_100363355 | Ga0207675_1003633552 | 119 |
| 553 | 3300026118 | Ga0207675_100632873 | Ga0207675_1006328732 | 119 |
| 554 | 3300026118 | Ga0207675_101079257 | Ga0207675_1010792571 | 119 |
| 555 | 3300026118 | Ga0207675_101653731 | Ga0207675_1016537311 | 119 |
| 556 | 3300026118 | Ga0207675_102247055 | Ga0207675_1022470552 | 119 |
| 557 | 3300026121 | Ga0207683_10991110 | Ga0207683_109911102 | 119 |
| 558 | 3300026121 | Ga0207683_11012352 | Ga0207683_110123522 | 119 |
| 559 | 3300026142 | Ga0207698_10372018 | Ga0207698_103720182 | 119 |
| 560 | 3300026142 | Ga0207698_10674453 | Ga0207698_106744532 | 119 |
| 561 | 3300026142 | Ga0207698_10971600 | Ga0207698_109716001 | 119 |
| 562 | 3300026142 | Ga0207698_11074522 | Ga0207698_110745222 | 119 |
| 563 | 3300026142 | Ga0207698_12342274 | Ga0207698_123422741 | 119 |
| 564 | 3300027471 | Ga0209995_1027606 | Ga0209995_10276062 | 119 |
| 565 | 3300027907 | Ga0207428_10672672 | Ga0207428_106726721 | 119 |
| 566 | 3300027907 | Ga0207428_11301296 | Ga0207428_113012962 | 119 |
| 567 | 3300028379 | Ga0268266_10277028 | Ga0268266_102770282 | 119 |
| 568 | 3300028379 | Ga0268266_10468923 | Ga0268266_104689232 | 119 |
| 569 | 3300028380 | Ga0268265_10234832 | Ga0268265_102348323 | 119 |
| 570 | 3300028380 | Ga0268265_10291949 | Ga0268265_102919492 | 119 |
| 571 | 3300028380 | Ga0268265_11009699 | Ga0268265_110096992 | 119 |
| 572 | 3300028380 | Ga0268265_11232908 | Ga0268265_112329082 | 119 |
| 573 | 3300028380 | Ga0268265_11847226 | Ga0268265_118472261 | 119 |
| 574 | 3300028381 | Ga0268264_10005626 | Ga0268264_100056268 | 119 |
| 575 | 3300028381 | Ga0268264_10042733 | Ga0268264_100427332 | 119 |
| 576 | 3300028381 | Ga0268264_10077236 | Ga0268264_100772362 | 119 |
| 577 | 3300028381 | Ga0268264_10156577 | Ga0268264_101565773 | 119 |
| 578 | 3300028381 | Ga0268264_11074970 | Ga0268264_110749701 | 119 |
| 579 | 3300028381 | Ga0268264_11170489 | Ga0268264_111704891 | 119 |
| 580 | 3300028381 | Ga0268264_11616869 | Ga0268264_116168691 | 119 |
| 581 | 3300028794 | Ga0307515_10000380 | Ga0307515_10000380106 | 119 |
| 582 | 3300028794 | Ga0307515_10006611 | Ga0307515_100066118 | 119 |
| 583 | 3300031507 | Ga0307509_10487751 | Ga0307509_104877512 | 119 |
| 584 | 3300031548 | Ga0307408_100020641 | Ga0307408_1000206413 | 119 |
| 585 | 3300031727 | Ga0316576_10263168 | Ga0316576_102631682 | 119 |
| 586 | 3300031824 | Ga0307413_10598496 | Ga0307413_105984962 | 119 |
| 587 | 3300031852 | Ga0307410_10000071 | Ga0307410_1000007120 | 119 |
| 588 | 3300031901 | Ga0307406_10000037 | Ga0307406_1000003735 | 119 |
| 589 | 3300031903 | Ga0307407_10006810 | Ga0307407_100068103 | 119 |
| 590 | 3300031995 | Ga0307409_102310819 | Ga0307409_1023108191 | 119 |
| 591 | 3300032002 | Ga0307416_102686002 | Ga0307416_1026860022 | 119 |
| 592 | 3300032004 | Ga0307414_10000012 | Ga0307414_1000001210 | 119 |
| 593 | 3300032004 | Ga0307414_10874760 | Ga0307414_108747601 | 119 |
| 594 | 3300032005 | Ga0307411_10800353 | Ga0307411_108003532 | 119 |
| 595 | 3300032005 | Ga0307411_11281402 | Ga0307411_112814022 | 119 |
| 596 | 3300035085 | Ga0373929_0044557 | Ga0373929_0044557_234_596 | 119 |
| 597 | 3300035086 | Ga0373934_0220285 | Ga0373934_0220285_201_563 | 119 |
| 598 | 3300035092 | Ga0373952_0029310 | Ga0373952_0029310_837_1199 | 119 |
| 599 | 3300035172 | Ga0373955_0325662 | Ga0373955_0325662_414_776 | 119 |
| 600 | 3300035398 | Ga0316574_0243033 | Ga0316574_0243033_420_794 | 119 |
| 601 | 3300035410 | Ga0373924_0221624 | Ga0373924_0221624_362_724 | 119 |
| 602 | 3300036401 | Ga0373937_0067380 | Ga0373937_0067380_2556_2918 | 119 |
| 603 | 3300037418 | Ga0395900_1769213 | Ga0395900_1769213_151_513 | 119 |
| 604 | 3300037471 | Ga0395905_0179469 | Ga0395905_0179469_1290_1652 | 119 |
| 605 | 3300039437 | Ga0436365_0729052 | Ga0436365_0729052_1421_1783 | 119 |
| 606 | 3300039437 | Ga0436365_0843457 | Ga0436365_0843457_255_614 | 119 |
| 607 | 3300039437 | Ga0436365_0853306 | Ga0436365_0853306_1070_1432 | 119 |
| 608 | 3300039437 | Ga0436365_1151340 | Ga0436365_1151340_65_427 | 119 |
| 609 | 3300039437 | Ga0436365_1758907 | Ga0436365_1758907_275_637 | 119 |
| 610 | 3300041407 | Ga0439447_147320 | Ga0439447_147320_68_430 | 119 |
| 611 | 3300041410 | Ga0439461_0093789 | Ga0439461_0093789_161_523 | 119 |
| 612 | 3300041411 | Ga0439466_0022583 | Ga0439466_0022583_889_1251 | 119 |
| 613 | 3300041411 | Ga0439466_0152692 | Ga0439466_0152692_237_599 | 119 |
| 614 | 3300041459 | Ga0451800_0578341 | Ga0451800_0578341_23_385 | 119 |
| 615 | 3300041460 | Ga0451802_0144258 | Ga0451802_0144258_62_424 | 119 |
| 616 | 3300041460 | Ga0451802_0831830 | Ga0451802_0831830_61_423 | 119 |
| 617 | 3300041486 | Ga0451807_1994737 | Ga0451807_1994737_209_571 | 119 |
| 618 | 3300041491 | Ga0451833_1296905 | Ga0451833_1296905_64_426 | 119 |
| 619 | 3300041496 | Ga0451839_0785002 | Ga0451839_0785002_403_765 | 119 |
| 620 | 3300041509 | Ga0451843_0767574 | Ga0451843_0767574_321_683 | 119 |
| 621 | 3300041512 | Ga0451853_3843889 | Ga0451853_3843889_370_732 | 119 |
| 622 | 3300041997 | Ga0439431_0233793 | Ga0439431_0233793_37_399 | 119 |
| 623 | 3300042004 | Ga0439445_0117259 | Ga0439445_0117259_276_638 | 119 |
| 624 | 3300042437 | Ga0439444_0039841 | Ga0439444_0039841_200_562 | 119 |
| 625 | 3300042437 | Ga0439444_0200902 | Ga0439444_0200902_26_388 | 119 |
| 626 | 3300042461 | Ga0439460_0169504 | Ga0439460_0169504_101_463 | 119 |
| 627 | 3300042876 | Ga0451577_0001044 | Ga0451577_0001044_19868_20236 | 119 |
| 628 | 3300042876 | Ga0451577_0266645 | Ga0451577_0266645_355_729 | 119 |
| 629 | 3300042876 | Ga0451577_0526212 | Ga0451577_0526212_509_871 | 119 |
| 630 | 3300044673 | Ga0453683_0000005 | Ga0453683_0000005_536614_536988 | 119 |
| 631 | 3300044673 | Ga0453683_0000792 | Ga0453683_0000792_10648_11025 | 119 |
| 632 | 3300044673 | Ga0453683_0007079 | Ga0453683_0007079_3077_3481 | 119 |
| 633 | 3300044673 | Ga0453683_0009838 | Ga0453683_0009838_818_1186 | 119 |
| 634 | 3300044673 | Ga0453683_0135617 | Ga0453683_0135617_97_471 | 119 |
| 635 | 3300044673 | Ga0453683_0523355 | Ga0453683_0523355_363_737 | 119 |
| 636 | 3300044673 | Ga0453683_1127602 | Ga0453683_1127602_106_468 | 119 |
| 637 | 3300044712 | Ga0453684_0000610 | Ga0453684_0000610_105362_105730 | 119 |
| 638 | 3300044712 | Ga0453684_0037330 | Ga0453684_0037330_292_666 | 119 |
| 639 | 3300044712 | Ga0453684_0041845 | Ga0453684_0041845_3606_4010 | 119 |
| 640 | 3300044712 | Ga0453684_0073834 | Ga0453684_0073834_562_927 | 119 |
| 641 | 3300044712 | Ga0453684_0187867 | Ga0453684_0187867_83_457 | 119 |
| 642 | 3300044712 | Ga0453684_0261375 | Ga0453684_0261375_594_998 | 119 |
| 643 | 3300044712 | Ga0453684_0310964 | Ga0453684_0310964_875_1249 | 119 |
| 644 | 3300044712 | Ga0453684_0358626 | Ga0453684_0358626_723_1097 | 119 |
| 645 | 3300044712 | Ga0453684_0730654 | Ga0453684_0730654_162_539 | 119 |
| 646 | 3300045051 | Ga0451576_0000193 | Ga0451576_0000193_48375_48743 | 119 |
| 647 | 3300045051 | Ga0451576_0006040 | Ga0451576_0006040_5667_6044 | 119 |
| 648 | 3300045051 | Ga0451576_0006802 | Ga0451576_0006802_8039_8443 | 119 |
| 649 | 3300045051 | Ga0451576_0011516 | Ga0451576_0011516_1567_1935 | 119 |
| 650 | 3300045051 | Ga0451576_0238042 | Ga0451576_0238042_1517_1882 | 119 |
| 651 | 3300045051 | Ga0451576_0858618 | Ga0451576_0858618_491_865 | 119 |
| 652 | 3300045051 | Ga0451576_1095975 | Ga0451576_1095975_131_496 | 119 |
| 653 | 3300046454 | Ga0495592_0445143 | Ga0495592_0445143_323_685 | 119 |
| 654 | 3300046460 | Ga0495638_0027584 | Ga0495638_0027584_434_796 | 119 |
| 655 | 3300046460 | Ga0495638_0309182 | Ga0495638_0309182_428_790 | 119 |
| 656 | 3300046507 | Ga0495606_0000021 | Ga0495606_0000021_130021_130383 | 119 |
| 657 | 3300046512 | Ga0495610_0000279 | Ga0495610_0000279_19329_19691 | 119 |
| 658 | 3300046512 | Ga0495610_0001345 | Ga0495610_0001345_10271_10633 | 119 |
| 659 | 3300046516 | Ga0495628_0299785 | Ga0495628_0299785_279_641 | 119 |
| 660 | 3300046519 | Ga0495632_0296989 | Ga0495632_0296989_316_678 | 119 |
| 661 | 3300046520 | Ga0495637_0088822 | Ga0495637_0088822_136_498 | 119 |
| 662 | 3300046522 | Ga0495643_0255454 | Ga0495643_0255454_214_576 | 119 |
| 663 | 3300046536 | Ga0495587_0129525 | Ga0495587_0129525_756_1118 | 119 |
| 664 | 3300046537 | Ga0495598_0148551 | Ga0495598_0148551_183_545 | 119 |
| 665 | 3300046539 | Ga0495621_0304944 | Ga0495621_0304944_269_631 | 119 |
| 666 | 3300046543 | Ga0495645_0143842 | Ga0495645_0143842_453_818 | 119 |
| 667 | 3300046558 | Ga0495633_0005737 | Ga0495633_0005737_2022_2384 | 119 |
| 668 | 3300046559 | Ga0495667_0106133 | Ga0495667_0106133_1359_1721 | 119 |
| 669 | 3300046616 | Ga0495668_0000097 | Ga0495668_0000097_35509_35877 | 119 |
| 670 | 3300046616 | Ga0495668_0013869 | Ga0495668_0013869_3198_3560 | 119 |
| 671 | 3300046665 | Ga0495661_0022788 | Ga0495661_0022788_181_543 | 119 |
| 672 | 3300046689 | Ga0495613_0533742 | Ga0495613_0533742_219_581 | 119 |
| 673 | 3300046692 | Ga0495671_0314262 | Ga0495671_0314262_149_511 | 119 |
| 674 | 3300047317 | Ga0495604_0288924 | Ga0495604_0288924_129_491 | 119 |
| 675 | 3300047319 | Ga0495674_0838556 | Ga0495674_0838556_129_491 | 119 |
| 676 | 3300047320 | Ga0495672_0395622 | Ga0495672_0395622_145_507 | 119 |
| 677 | 3300047322 | Ga0495680_0259306 | Ga0495680_0259306_712_1074 | 119 |
| 678 | 3300047472 | Ga0495686_0000625 | Ga0495686_0000625_15339_15707 | 119 |
| 679 | 3300048903 | Ga0496100_0514093 | Ga0496100_0514093_152_514 | 119 |
| 680 | 3300048907 | Ga0496104_0943806 | Ga0496104_0943806_339_701 | 119 |
| 681 | 3300048913 | Ga0496110_0220839 | Ga0496110_0220839_1170_1532 | 119 |
| 682 | 3300048913 | Ga0496110_1696769 | Ga0496110_1696769_17_379 | 119 |
| 683 | 3300048914 | Ga0496111_0086257 | Ga0496111_0086257_1142_1504 | 119 |
| 684 | 3300048914 | Ga0496111_0180514 | Ga0496111_0180514_636_998 | 119 |
| 685 | 3300048915 | Ga0496112_1227484 | Ga0496112_1227484_161_523 | 119 |
| 686 | 3300048915 | Ga0496112_1500157 | Ga0496112_1500157_40_402 | 119 |
| 687 | 3300048916 | Ga0496113_0896284 | Ga0496113_0896284_97_459 | 119 |
| 688 | 3300048917 | Ga0496114_0062136 | Ga0496114_0062136_15_377 | 119 |
| 689 | 3300048919 | Ga0496116_0000032 | Ga0496116_0000032_411176_411538 | 119 |
| 690 | 3300048924 | Ga0496121_0233147 | Ga0496121_0233147_909_1271 | 119 |
| 691 | 3300048927 | Ga0496124_0299158 | Ga0496124_0299158_52_414 | 119 |
| 692 | 3300048928 | Ga0496125_0000111 | Ga0496125_0000111_34810_35172 | 119 |
| 693 | 3300048929 | Ga0496126_0004578 | Ga0496126_0004578_15592_15954 | 119 |
| 694 | 3300048929 | Ga0496126_0167088 | Ga0496126_0167088_128_490 | 119 |
| 695 | 3300049513 | Ga0501290_062370 | Ga0501290_062370_27_389 | 119 |
| 696 | 3300049574 | Ga0501038_0086325 | Ga0501038_0086325_955_1323 | 119 |
| 697 | 3300049671 | Ga0501238_000090 | Ga0501238_000090_10928_11290 | 119 |
| 698 | 3300049679 | Ga0501249_043346 | Ga0501249_043346_343_705 | 119 |
| 699 | 3300049763 | Ga0501266_016963 | Ga0501266_016963_51_413 | 119 |
| 700 | 3300049776 | Ga0501280_001826 | Ga0501280_001826_786_1148 | 119 |
| 701 | 3300050496 | nmdc:mga07m45_686929_c1 | nmdc:mga07m45_686929_c1_120_482 | 119 |
| 702 | 3300050507 | nmdc:mga05p37_231810_c1 | nmdc:mga05p37_231810_c1_720_1082 | 119 |
| 703 | 3300050507 | nmdc:mga05p37_439472_c1 | nmdc:mga05p37_439472_c1_24_386 | 119 |
| 704 | 3300050507 | nmdc:mga05p37_46311_c1 | nmdc:mga05p37_46311_c1_4958_5320 | 119 |
| 705 | 3300050508 | nmdc:mga09592_208367_c1 | nmdc:mga09592_208367_c1_565_927 | 119 |
| 706 | 3300050508 | nmdc:mga09592_375511_c1 | nmdc:mga09592_375511_c1_721_1083 | 119 |
| 707 | 3300050509 | nmdc:mga0qj67_1193098_c1 | nmdc:mga0qj67_1193098_c1_89_451 | 119 |
| 708 | 3300050510 | nmdc:mga06r32_1072593_c1 | nmdc:mga06r32_1072593_c1_298_660 | 119 |
| 709 | 3300050510 | nmdc:mga06r32_360646_c1 | nmdc:mga06r32_360646_c1_530_892 | 119 |
| 710 | 3300050511 | nmdc:mga08y16_1495192_c1 | nmdc:mga08y16_1495192_c1_86_448 | 119 |
| 711 | 3300050511 | nmdc:mga08y16_1640127_c1 | nmdc:mga08y16_1640127_c1_56_418 | 119 |
| 712 | 3300050511 | nmdc:mga08y16_285380_c1 | nmdc:mga08y16_285380_c1_837_1199 | 119 |
| 713 | 3300050511 | nmdc:mga08y16_771138_c1 | nmdc:mga08y16_771138_c1_418_780 | 119 |
| 714 | 3300050511 | nmdc:mga08y16_897432_c1 | nmdc:mga08y16_897432_c1_92_454 | 119 |
| 715 | 3300050512 | nmdc:mga0n895_179543_c1 | nmdc:mga0n895_179543_c1_854_1216 | 119 |
| 716 | 3300053080 | Ga0500635_0082404 | Ga0500635_0082404_642_1004 | 119 |
| 717 | 3300053088 | Ga0500644_0166812 | Ga0500644_0166812_296_658 | 119 |
| 718 | 3300053090 | Ga0500646_0136625 | Ga0500646_0136625_209_571 | 119 |
| 719 | 3300053091 | Ga0500647_0085727 | Ga0500647_0085727_288_650 | 119 |
| 720 | 3300053092 | Ga0500583_0154170 | Ga0500583_0154170_564_926 | 119 |
| 721 | 3300053096 | Ga0500641_0000020 | Ga0500641_0000020_101294_101656 | 119 |
| 722 | 3300053130 | Ga0500642_0007034 | Ga0500642_0007034_1303_1674 | 119 |
| 723 | 3300053140 | Ga0500573_0352650 | Ga0500573_0352650_341_703 | 119 |
| 724 | 3300053151 | Ga0500604_0011813 | Ga0500604_0011813_1099_1461 | 119 |
| 725 | 3300053153 | Ga0500616_0033668 | Ga0500616_0033668_1359_1727 | 119 |
| 726 | 3300053158 | Ga0500627_0002345 | Ga0500627_0002345_3438_3806 | 119 |
| 727 | 3300053726 | Ga0500584_040179 | Ga0500584_040179_523_885 | 119 |
| 728 | 3300053727 | Ga0500611_000020 | Ga0500611_000020_86974_87336 | 119 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8811 | 2 | 66 |
| 3zec-assembly1.cif.gz_A | fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp | 0.872 | 13 | 67 |
| 1sd6-assembly1.cif.gz_B | crystal structure of native meci at 2.65 a | 0.8605 | 1 | 116 |
| 2mh2-assembly1.cif.gz_A | structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 | 0.8602 | 8 | 66 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.857 | 2 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9047 | 4 | 65 | 1.10.10.10 |
| 2xigA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8983 | 6 | 68 | 1.10.10.10 |
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.8857 | 18 | 66 | 3.30.230.130 |
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8804 | 5 | 67 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8775 | 4 | 65 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H1DIA1-F1-model_v4 | Penicillinase repressor | 0.9788 | 1 | 74 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A519RYD7-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.9766 | 2 | 118 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A1M5N177-F1-model_v4 | Predicted transcriptional regulator | 0.9736 | 1 | 118 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A7J7AZU7-F1-model_v4 | deleted | 0.9684 | 1 | 78 |
|
| AF-A0A1F3P524-F1-model_v4 | Transcriptional regulator | 0.9679 | 1 | 78 |
GO:0003677
GO:0005737 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar