F477779

General Info

Members Datasets Scaffolds Average Seq Length
728 284 716 121

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10006442|Ga0070676_100064425
Length 138
Sequence MFDTNYTKHTNYHELRTSMKKLAKREEQIMQVYWDLGKAFIKEVIPHLPDPKPHYNSVATIVKILEEKGFLDHEAIGNVYSYFPKISREEYQKHDMKDIVKKYFDNSYPRMLAFFAKEQNLSEKELKEILEMIKSDKS

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
3 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
4 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
5 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
6 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
7 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
8 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
9 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
10 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
11 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
12 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
13 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
206 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
207 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
212 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
213 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
264 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
272 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
273 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
274 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
275 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
283 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
284 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 1.92
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 4.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02GKPM1 2088090002 Bacteria 507
2 JGI25406J46586_10160090 3300003203 Unclassified 657
3 rootH2_10340456 3300003320 Unclassified 1630
4 rootH1_10388672 3300003323 Unclassified 1586
5 Ga0065714_10002780 3300005288 Bacteria 12386
6 Ga0065714_10008400 3300005288 Bacteria 2987
7 Ga0065704_10018505 3300005289 Bacteria 2054
8 Ga0065704_10495783 3300005289 Bacteria 670
9 Ga0065712_10153950 3300005290 Bacteria 1348
10 Ga0065712_10512818 3300005290 Bacteria 641
11 Ga0065712_10834097 3300005290 Unclassified 502
12 Ga0065715_10027975 3300005293 Bacteria 1634
13 Ga0065715_10277504 3300005293 Bacteria 1095
14 Ga0065715_10551731 3300005293 Bacteria 740
15 Ga0065707_10103348 3300005295 Bacteria 2753
16 Ga0065707_10420512 3300005295 Bacteria 831
17 Ga0065707_10597090 3300005295 Unclassified 692
18 Ga0070658_10383727 3300005327 Bacteria 1206
19 Ga0070676_10006442 3300005328 Bacteria 6275
20 Ga0070676_10683586 3300005328 Bacteria 748
21 Ga0070683_100047424 3300005329 Bacteria 3970
22 Ga0070683_100161092 3300005329 Bacteria 2129
23 Ga0070683_100334253 3300005329 Bacteria 1442
24 Ga0070683_101961349 3300005329 Bacteria 563
25 Ga0070690_100172724 3300005330 Bacteria 1488
26 Ga0070690_100578841 3300005330 Bacteria 850
27 Ga0070670_100065566 3300005331 Bacteria 3116
28 Ga0070670_100108062 3300005331 Bacteria 2397
29 Ga0070670_100129781 3300005331 Bacteria 2176
30 Ga0070670_100185011 3300005331 Bacteria 1809
31 Ga0070670_100448539 3300005331 Bacteria 1143
32 Ga0070670_100664206 3300005331 Bacteria 936
33 Ga0070670_101796862 3300005331 Unclassified 564
34 Ga0070677_10133241 3300005333 Bacteria 1137
35 Ga0070677_10400039 3300005333 Bacteria 724
36 Ga0068869_100037066 3300005334 Bacteria 3465
37 Ga0068869_100248166 3300005334 Bacteria 1421
38 Ga0068869_100439429 3300005334 Bacteria 1079
39 Ga0068869_100873849 3300005334 Bacteria 777
40 Ga0070666_10056032 3300005335 Bacteria 2661
41 Ga0070666_11222892 3300005335 Bacteria 560
42 Ga0070682_100341267 3300005337 Bacteria 1113
43 Ga0068868_100091600 3300005338 Bacteria 2450
44 Ga0068868_100267123 3300005338 Bacteria 1444
45 Ga0068868_100620658 3300005338 Bacteria 960
46 Ga0068868_100926826 3300005338 Bacteria 793
47 Ga0070660_100903612 3300005339 Bacteria 745
48 Ga0070689_100007532 3300005340 Bacteria 7620
49 Ga0070689_100099742 3300005340 Bacteria 2297
50 Ga0070689_100231672 3300005340 Bacteria 1518
51 Ga0070689_100471164 3300005340 Bacteria 1071
52 Ga0070687_100699987 3300005343 Bacteria 708
53 Ga0070661_100057494 3300005344 Bacteria 2850
54 Ga0070668_102092002 3300005347 Unclassified 523
55 Ga0070669_100156596 3300005353 Unclassified 1767
56 Ga0070669_100363299 3300005353 Bacteria 1178
57 Ga0070669_100593254 3300005353 Bacteria 927
58 Ga0070669_101764539 3300005353 Unclassified 540
59 Ga0070669_101984101 3300005353 Unclassified 509
60 Ga0070675_100055526 3300005354 Bacteria 3260
61 Ga0070675_100119203 3300005354 Bacteria 2241
62 Ga0070675_100153456 3300005354 Bacteria 1976
63 Ga0070675_100331730 3300005354 Unclassified 1346
64 Ga0070671_100056167 3300005355 Unclassified 3275
65 Ga0070671_100261210 3300005355 Bacteria 1472
66 Ga0070671_100538350 3300005355 Bacteria 1006
67 Ga0070671_101412243 3300005355 Bacteria 615
68 Ga0070674_100031187 3300005356 Bacteria 3530
69 Ga0070674_100382789 3300005356 Unclassified 1145
70 Ga0070674_100649687 3300005356 Bacteria 896
71 Ga0070673_100074023 3300005364 Bacteria 2743
72 Ga0070673_100220363 3300005364 Bacteria 1642
73 Ga0070673_100592469 3300005364 Unclassified 1010
74 Ga0070673_100654566 3300005364 Bacteria 962
75 Ga0070673_101144362 3300005364 Bacteria 728
76 Ga0070673_101559123 3300005364 Bacteria 623
77 Ga0070673_101631829 3300005364 Bacteria 609
78 Ga0070688_100093127 3300005365 Bacteria 1972
79 Ga0070688_100301395 3300005365 Unclassified 1159
80 Ga0070688_101508146 3300005365 Unclassified 547
81 Ga0070659_100069554 3300005366 Bacteria 2795
82 Ga0070667_100059036 3300005367 Unclassified 3244
83 Ga0070667_100083177 3300005367 Unclassified 2742
84 Ga0070667_100120350 3300005367 Unclassified 2283
85 Ga0070667_100229768 3300005367 Unclassified 1654
86 Ga0070667_100808260 3300005367 Bacteria 871
87 Ga0070667_100819935 3300005367 Bacteria 864
88 Ga0070667_101815569 3300005367 Unclassified 574
89 Ga0070709_11368966 3300005434 Unclassified 572
90 Ga0070713_101030656 3300005436 Bacteria 794
91 Ga0070701_10946258 3300005438 Bacteria 598
92 Ga0070700_100106015 3300005441 Bacteria 1860
93 Ga0070700_101734848 3300005441 Bacteria 536
94 Ga0070663_100439828 3300005455 Unclassified 1073
95 Ga0070663_101334453 3300005455 Unclassified 634
96 Ga0070678_101300074 3300005456 Bacteria 677
97 Ga0070678_101500547 3300005456 Bacteria 631
98 Ga0070662_100380875 3300005457 Unclassified 1161
99 Ga0070662_101072637 3300005457 Bacteria 691
100 Ga0070662_101714678 3300005457 Unclassified 542
101 Ga0068867_100141751 3300005459 Bacteria 1879
102 Ga0068867_100583220 3300005459 Bacteria 973
103 Ga0068867_101468170 3300005459 Bacteria 634
104 Ga0070685_10024602 3300005466 Unclassified 3309
105 Ga0070685_10086939 3300005466 Bacteria 1885
106 Ga0070685_10109046 3300005466 Bacteria 1702
107 Ga0070685_10545990 3300005466 Unclassified 826
108 Ga0070698_100005484 3300005471 Bacteria 13851
109 Ga0070698_100022480 3300005471 Bacteria 6597
110 Ga0070698_100031347 3300005471 Bacteria 5512
111 Ga0070679_100554036 3300005530 Bacteria 1093
112 Ga0070684_100002669 3300005535 Bacteria 13168
113 Ga0070684_100118730 3300005535 Unclassified 2378
114 Ga0068853_100917433 3300005539 Bacteria 842
115 Ga0068853_101122854 3300005539 Bacteria 758
116 Ga0070672_100141813 3300005543 Unclassified 1982
117 Ga0070672_100354266 3300005543 Bacteria 1252
118 Ga0070672_100621451 3300005543 Unclassified 942
119 Ga0070672_100799900 3300005543 Bacteria 830
120 Ga0070686_100842835 3300005544 Bacteria 742
121 Ga0070686_101392866 3300005544 Bacteria 588
122 Ga0070693_100290458 3300005547 Bacteria 1098
123 Ga0070665_100064660 3300005548 Unclassified 3669
124 Ga0070665_100337642 3300005548 Unclassified 1511
125 Ga0070665_100757338 3300005548 Bacteria 984
126 Ga0070665_102004070 3300005548 Bacteria 584
127 Ga0070704_100528198 3300005549 Unclassified 1028
128 Ga0070664_100087600 3300005564 Bacteria 2692
129 Ga0070664_100165434 3300005564 Bacteria 1960
130 Ga0070664_100184399 3300005564 Bacteria 1856
131 Ga0070664_100197470 3300005564 Bacteria 1794
132 Ga0070664_100491359 3300005564 Unclassified 1130
133 Ga0070664_100549610 3300005564 Bacteria 1068
134 Ga0070664_100719467 3300005564 Unclassified 931
135 Ga0068857_100073434 3300005577 Bacteria 3048
136 Ga0068857_100719268 3300005577 Bacteria 949
137 Ga0068857_100901152 3300005577 Bacteria 848
138 Ga0068857_102171205 3300005577 Bacteria 545
139 Ga0068854_100571855 3300005578 Bacteria 961
140 Ga0068854_100841276 3300005578 Bacteria 803
141 Ga0070702_100289838 3300005615 Bacteria 1128
142 Ga0070702_101155166 3300005615 Bacteria 622
143 Ga0068852_100080524 3300005616 Bacteria 2888
144 Ga0068852_100406241 3300005616 Unclassified 1340
145 Ga0068852_100505890 3300005616 Unclassified 1203
146 Ga0068859_100013562 3300005617 Bacteria 8172
147 Ga0068859_100013830 3300005617 Bacteria 8093
148 Ga0068859_100042847 3300005617 Bacteria 4547
149 Ga0068859_100145417 3300005617 Bacteria 2445
150 Ga0068859_100268908 3300005617 Bacteria 1796
151 Ga0068859_100355209 3300005617 Bacteria 1560
152 Ga0068859_100516580 3300005617 Bacteria 1289
153 Ga0068859_100555425 3300005617 Bacteria 1242
154 Ga0068859_100609294 3300005617 Bacteria 1185
155 Ga0068859_100759746 3300005617 Bacteria 1058
156 Ga0068859_100786647 3300005617 Bacteria 1039
157 Ga0068859_101419754 3300005617 Bacteria 766
158 Ga0068859_101489715 3300005617 Bacteria 747
159 Ga0068859_102338479 3300005617 Unclassified 589
160 Ga0068859_102854114 3300005617 Unclassified 530
161 Ga0068864_100010460 3300005618 Bacteria 7667
162 Ga0068864_100192211 3300005618 Bacteria 1872
163 Ga0068864_100950092 3300005618 Bacteria 850
164 Ga0068864_101938783 3300005618 Unclassified 595
165 Ga0068866_10074811 3300005718 Bacteria 1802
166 Ga0068866_10305692 3300005718 Bacteria 995
167 Ga0068866_10787442 3300005718 Unclassified 660
168 Ga0068861_100051340 3300005719 Bacteria 3130
169 Ga0068861_100054764 3300005719 Bacteria 3040
170 Ga0068861_100087878 3300005719 Bacteria 2446
171 Ga0068861_100649976 3300005719 Unclassified 974
172 Ga0068861_101132408 3300005719 Unclassified 753
173 Ga0068861_102501786 3300005719 Bacteria 520
174 Ga0068851_10424510 3300005834 Bacteria 786
175 Ga0068870_10780175 3300005840 Bacteria 666
176 Ga0068870_11237958 3300005840 Bacteria 542
177 Ga0068863_100001966 3300005841 Bacteria 20422
178 Ga0068863_100145776 3300005841 Bacteria 2264
179 Ga0068863_101051708 3300005841 Unclassified 818
180 Ga0068863_101170353 3300005841 Bacteria 774
181 Ga0068863_102580928 3300005841 Unclassified 517
182 Ga0068858_100221633 3300005842 Unclassified 1791
183 Ga0068858_100355511 3300005842 Bacteria 1404
184 Ga0068858_100703032 3300005842 Bacteria 984
185 Ga0068860_100004009 3300005843 Bacteria 15116
186 Ga0068860_100005881 3300005843 Bacteria 12349
187 Ga0068860_100195525 3300005843 Bacteria 1959
188 Ga0068860_100239146 3300005843 Bacteria 1766
189 Ga0068860_101104792 3300005843 Unclassified 812
190 Ga0068860_102568950 3300005843 Bacteria 529
191 Ga0068862_100415963 3300005844 Bacteria 1260
192 Ga0068862_100849258 3300005844 Unclassified 895
193 Ga0068862_101346236 3300005844 Bacteria 716
194 Ga0068862_101412879 3300005844 Unclassified 699
195 Ga0081539_10001794 3300005985 Bacteria 33997
196 Ga0070717_11221272 3300006028 Unclassified 684
197 Ga0075432_10312819 3300006058 Unclassified 655
198 Ga0075432_10494114 3300006058 Bacteria 544
199 Ga0070715_10540631 3300006163 Unclassified 674
200 Ga0070716_100271747 3300006173 Bacteria 1165
201 Ga0097621_100005069 3300006237 Bacteria 9257
202 Ga0097621_100204497 3300006237 Bacteria 1715
203 Ga0097621_100343939 3300006237 Unclassified 1325
204 Ga0097621_100460416 3300006237 Bacteria 1147
205 Ga0097621_100568195 3300006237 Unclassified 1034
206 Ga0097621_101572586 3300006237 Bacteria 625
207 Ga0075370_10874260 3300006353 Bacteria 549
208 Ga0068871_100008961 3300006358 Bacteria 7221
209 Ga0068871_100017013 3300006358 Bacteria 5491
210 Ga0068871_100327403 3300006358 Unclassified 1351
211 Ga0068871_100827830 3300006358 Bacteria 855
212 Ga0068871_101024414 3300006358 Bacteria 770
213 Ga0075428_100012494 3300006844 Bacteria 9444
214 Ga0075428_102595621 3300006844 Bacteria 518
215 Ga0075430_100817277 3300006846 Bacteria 768
216 Ga0075431_100055186 3300006847 Bacteria 4098
217 Ga0075431_101566198 3300006847 Unclassified 617
218 Ga0075429_100006150 3300006880 Bacteria 10376
219 Ga0075429_100313024 3300006880 Bacteria 1374
220 Ga0075429_100463541 3300006880 Unclassified 1110
221 Ga0068865_100359529 3300006881 Bacteria 1182
222 Ga0097620_100013560 3300006931 Bacteria 8172
223 Ga0097620_100013830 3300006931 Bacteria 8093
224 Ga0097620_100042845 3300006931 Bacteria 4547
225 Ga0097620_100145418 3300006931 Bacteria 2445
226 Ga0097620_100268914 3300006931 Bacteria 1796
227 Ga0097620_100355215 3300006931 Bacteria 1560
228 Ga0097620_100516578 3300006931 Bacteria 1289
229 Ga0097620_100555436 3300006931 Bacteria 1242
230 Ga0097620_100609262 3300006931 Bacteria 1185
231 Ga0097620_100759728 3300006931 Bacteria 1058
232 Ga0097620_100786663 3300006931 Bacteria 1039
233 Ga0097620_101419866 3300006931 Bacteria 766
234 Ga0097620_101489543 3300006931 Bacteria 747
235 Ga0097620_102339664 3300006931 Unclassified 589
236 Ga0097620_102855217 3300006931 Unclassified 530
237 Ga0105251_10053057 3300009011 Bacteria 1928
238 Ga0105251_10065440 3300009011 Bacteria 1701
239 Ga0105244_10000004 3300009036 Bacteria 492478
240 Ga0105240_10669872 3300009093 Bacteria 1135
241 Ga0105240_12165303 3300009093 Bacteria 577
242 Ga0111539_10041924 3300009094 Bacteria 5500
243 Ga0111539_10054398 3300009094 Unclassified 4763
244 Ga0111539_10433793 3300009094 Bacteria 1530
245 Ga0111539_11018641 3300009094 Bacteria 963
246 Ga0111539_11388357 3300009094 Unclassified 815
247 Ga0111539_11414666 3300009094 Unclassified 807
248 Ga0111539_13476687 3300009094 Bacteria 506
249 Ga0105247_10001409 3300009101 Bacteria 17436
250 Ga0105247_10240118 3300009101 Bacteria 1234
251 Ga0114129_10069169 3300009147 Unclassified 4921
252 Ga0114129_10085559 3300009147 Bacteria 4374
253 Ga0114129_11658103 3300009147 Bacteria 781
254 Ga0114129_13124094 3300009147 Unclassified 541
255 Ga0114129_13378419 3300009147 Unclassified 514
256 Ga0105243_11763213 3300009148 Bacteria 649
257 Ga0105241_10200544 3300009174 Unclassified 1666
258 Ga0105241_10358736 3300009174 Bacteria 1268
259 Ga0105241_11591563 3300009174 Unclassified 632
260 Ga0105241_11725373 3300009174 Unclassified 609
261 Ga0105242_10002507 3300009176 Bacteria 14401
262 Ga0105242_10016969 3300009176 Bacteria 5667
263 Ga0105242_10236415 3300009176 Unclassified 1640
264 Ga0105242_10523942 3300009176 Bacteria 1131
265 Ga0105242_11902181 3300009176 Bacteria 635
266 Ga0105242_13009761 3300009176 Unclassified 522
267 Ga0105248_10390555 3300009177 Bacteria 1567
268 Ga0105248_11002871 3300009177 Bacteria 943
269 Ga0105237_10797586 3300009545 Bacteria 951
270 Ga0105237_11305305 3300009545 Bacteria 732
271 Ga0105237_12220334 3300009545 Unclassified 558
272 Ga0105249_10001319 3300009553 Bacteria 21718
273 Ga0105249_10003297 3300009553 Bacteria 13988
274 Ga0105249_10007594 3300009553 Bacteria 9464
275 Ga0105249_10116159 3300009553 Bacteria 2536
276 Ga0105249_10239858 3300009553 Bacteria 1792
277 Ga0105249_10317806 3300009553 Unclassified 1568
278 Ga0105249_10352843 3300009553 Bacteria 1490
279 Ga0105249_11384769 3300009553 Unclassified 775
280 Ga0105249_11389812 3300009553 Bacteria 774
281 Ga0105249_11763330 3300009553 Bacteria 692
282 Ga0105249_11799193 3300009553 Bacteria 685
283 Ga0105249_12793819 3300009553 Unclassified 560
284 Ga0105239_10502842 3300010375 Bacteria 1378
285 Ga0105246_10062756 3300011119 Bacteria 2590
286 Ga0105246_10134559 3300011119 Bacteria 1851
287 Ga0105246_10808700 3300011119 Unclassified 832
288 Ga0157373_10000002 3300013100 Bacteria 750094
289 Ga0157373_10011815 3300013100 Bacteria 6414
290 Ga0157373_10564275 3300013100 Bacteria 826
291 Ga0157373_10605037 3300013100 Bacteria 798
292 Ga0157373_11101378 3300013100 Bacteria 596
293 Ga0157371_10130310 3300013102 Bacteria 1789
294 Ga0157371_10363368 3300013102 Bacteria 1055
295 Ga0157370_10000097 3300013104 Bacteria 99144
296 Ga0157370_10002822 3300013104 Bacteria 20761
297 Ga0157370_10137162 3300013104 Bacteria 2280
298 Ga0157370_10166724 3300013104 Bacteria 2048
299 Ga0157370_10170945 3300013104 Bacteria 2020
300 Ga0157369_10009083 3300013105 Bacteria 11378
301 Ga0157369_10030197 3300013105 Bacteria 5979
302 Ga0157369_10064219 3300013105 Bacteria 3954
303 Ga0157369_11268232 3300013105 Bacteria 751
304 Ga0157374_10008802 3300013296 Bacteria 8639
305 Ga0157374_10027181 3300013296 Bacteria 5157
306 Ga0157374_10137876 3300013296 Bacteria 2366
307 Ga0157374_10182966 3300013296 Bacteria 2048
308 Ga0157374_10420638 3300013296 Bacteria 1335
309 Ga0157374_10537427 3300013296 Bacteria 1176
310 Ga0157374_12280875 3300013296 Bacteria 568
311 Ga0157378_10011051 3300013297 Bacteria 7902
312 Ga0157378_10022058 3300013297 Bacteria 5601
313 Ga0157378_10199073 3300013297 Bacteria 1894
314 Ga0157378_10237076 3300013297 Bacteria 1741
315 Ga0157378_10439418 3300013297 Bacteria 1293
316 Ga0157378_10906581 3300013297 Bacteria 912
317 Ga0157378_11150171 3300013297 Bacteria 814
318 Ga0163162_10019416 3300013306 Bacteria 6666
319 Ga0163162_10026218 3300013306 Bacteria 5761
320 Ga0163162_10034614 3300013306 Bacteria 5027
321 Ga0163162_10093233 3300013306 Bacteria 3096
322 Ga0163162_10124962 3300013306 Bacteria 2678
323 Ga0163162_10204595 3300013306 Bacteria 2103
324 Ga0163162_10301734 3300013306 Bacteria 1733
325 Ga0163162_10676330 3300013306 Bacteria 1155
326 Ga0163162_10743235 3300013306 Unclassified 1101
327 Ga0163162_10794787 3300013306 Bacteria 1064
328 Ga0163162_10914492 3300013306 Bacteria 990
329 Ga0163162_11037318 3300013306 Bacteria 928
330 Ga0163162_11266750 3300013306 Unclassified 837
331 Ga0163162_12286148 3300013306 Unclassified 621
332 Ga0163162_12352130 3300013306 Bacteria 612
333 Ga0157372_10149650 3300013307 Bacteria 2694
334 Ga0157372_10251303 3300013307 Bacteria 2052
335 Ga0157372_10353004 3300013307 Bacteria 1713
336 Ga0157372_11560919 3300013307 Bacteria 760
337 Ga0157372_11699701 3300013307 Bacteria 726
338 Ga0157372_12590426 3300013307 Unclassified 582
339 Ga0157372_12690523 3300013307 Bacteria 571
340 Ga0157372_12991807 3300013307 Bacteria 540
341 Ga0157375_10006773 3300013308 Bacteria 9982
342 Ga0157375_10057411 3300013308 Bacteria 3848
343 Ga0157375_10079911 3300013308 Bacteria 3307
344 Ga0157375_10082143 3300013308 Bacteria 3263
345 Ga0157375_10092904 3300013308 Unclassified 3082
346 Ga0157375_10126295 3300013308 Bacteria 2673
347 Ga0157375_10140620 3300013308 Bacteria 2541
348 Ga0157375_10200943 3300013308 Bacteria 2149
349 Ga0157375_10322326 3300013308 Bacteria 1710
350 Ga0157375_10697142 3300013308 Bacteria 1169
351 Ga0157375_10814958 3300013308 Bacteria 1082
352 Ga0157375_11220379 3300013308 Bacteria 883
353 Ga0157375_12344968 3300013308 Unclassified 636
354 Ga0163163_10001981 3300014325 Bacteria 17328
355 Ga0163163_10514137 3300014325 Bacteria 1259
356 Ga0163163_10673108 3300014325 Bacteria 1098
357 Ga0163163_11514557 3300014325 Unclassified 732
358 Ga0163163_12147433 3300014325 Unclassified 618
359 Ga0163163_12178397 3300014325 Unclassified 614
360 Ga0163163_12992740 3300014325 Unclassified 527
361 Ga0157380_10014307 3300014326 Bacteria 5804
362 Ga0157380_10018408 3300014326 Bacteria 5183
363 Ga0157380_10098483 3300014326 Bacteria 2430
364 Ga0157380_10861281 3300014326 Unclassified 929
365 Ga0157380_10953870 3300014326 Bacteria 888
366 Ga0157380_11059303 3300014326 Bacteria 848
367 Ga0157380_11294363 3300014326 Bacteria 776
368 Ga0157380_11843938 3300014326 Bacteria 664
369 Ga0157380_11901490 3300014326 Bacteria 656
370 Ga0157377_10013851 3300014745 Unclassified 4089
371 Ga0157377_10071880 3300014745 Bacteria 2001
372 Ga0157377_10101437 3300014745 Unclassified 1715
373 Ga0157377_11135217 3300014745 Bacteria 601
374 Ga0157377_11337023 3300014745 Unclassified 562
375 Ga0157379_10016773 3300014968 Bacteria 6446
376 Ga0157379_10168872 3300014968 Bacteria 1975
377 Ga0157379_10186779 3300014968 Bacteria 1873
378 Ga0157379_10635773 3300014968 Bacteria 998
379 Ga0157379_10809923 3300014968 Bacteria 884
380 Ga0157379_10984598 3300014968 Bacteria 803
381 Ga0157376_10091666 3300014969 Bacteria 2633
382 Ga0157376_10264607 3300014969 Bacteria 1613
383 Ga0157376_10565587 3300014969 Unclassified 1127
384 Ga0157376_11098384 3300014969 Bacteria 821
385 Ga0157376_11736848 3300014969 Unclassified 660
386 Ga0157376_12998747 3300014969 Bacteria 511
387 Ga0182006_1002176 3300015261 Bacteria 10863
388 Ga0182007_10180118 3300015262 Bacteria 730
389 Ga0163161_10000026 3300017792 Bacteria 199745
390 Ga0163161_10139905 3300017792 Bacteria 1832
391 Ga0163161_10153991 3300017792 Bacteria 1749
392 Ga0163161_10211944 3300017792 Unclassified 1497
393 Ga0163161_10429485 3300017792 Bacteria 1064
394 Ga0163161_10931595 3300017792 Bacteria 738
395 Ga0207697_10107638 3300025315 Bacteria 1192
396 Ga0207655_1000008 3300025728 Bacteria 734289
397 Ga0207713_1163087 3300025735 Bacteria 709
398 Ga0207713_1247042 3300025735 Bacteria 527
399 Ga0207682_10029013 3300025893 Bacteria 2211
400 Ga0207642_10212513 3300025899 Unclassified 1076
401 Ga0207642_10667951 3300025899 Bacteria 652
402 Ga0207710_10015279 3300025900 Bacteria 3242
403 Ga0207688_10110660 3300025901 Bacteria 1594
404 Ga0207680_10072531 3300025903 Bacteria 2138
405 Ga0207680_10088068 3300025903 Bacteria 1967
406 Ga0207680_11016188 3300025903 Unclassified 594
407 Ga0207647_10042205 3300025904 Bacteria 2863
408 Ga0207647_10222973 3300025904 Bacteria 1086
409 Ga0207645_10011823 3300025907 Bacteria 5942
410 Ga0207645_10692343 3300025907 Bacteria 693
411 Ga0207643_10400214 3300025908 Bacteria 868
412 Ga0207643_10923180 3300025908 Bacteria 565
413 Ga0207705_10689300 3300025909 Bacteria 794
414 Ga0207684_11352300 3300025910 Unclassified 585
415 Ga0207654_10833869 3300025911 Unclassified 667
416 Ga0207662_10020618 3300025918 Bacteria 3761
417 Ga0207662_10459852 3300025918 Unclassified 871
418 Ga0207657_10168828 3300025919 Bacteria 1774
419 Ga0207649_10133661 3300025920 Bacteria 1688
420 Ga0207649_10428961 3300025920 Bacteria 994
421 Ga0207652_10816856 3300025921 Bacteria 827
422 Ga0207646_10194660 3300025922 Unclassified 1831
423 Ga0207681_10140828 3300025923 Bacteria 1796
424 Ga0207681_11018178 3300025923 Bacteria 695
425 Ga0207681_11816878 3300025923 Bacteria 508
426 Ga0207650_10035597 3300025925 Bacteria 3618
427 Ga0207650_10118760 3300025925 Bacteria 2056
428 Ga0207650_10265935 3300025925 Unclassified 1392
429 Ga0207650_10316727 3300025925 Unclassified 1277
430 Ga0207650_11107185 3300025925 Unclassified 674
431 Ga0207650_11260871 3300025925 Bacteria 629
432 Ga0207650_11332689 3300025925 Bacteria 611
433 Ga0207659_10055394 3300025926 Bacteria 2836
434 Ga0207659_10221808 3300025926 Bacteria 1521
435 Ga0207659_10416583 3300025926 Unclassified 1126
436 Ga0207659_11279398 3300025926 Bacteria 630
437 Ga0207659_11419690 3300025926 Bacteria 595
438 Ga0207659_11692003 3300025926 Unclassified 539
439 Ga0207700_11050547 3300025928 Bacteria 729
440 Ga0207644_10212241 3300025931 Unclassified 1531
441 Ga0207644_10433401 3300025931 Bacteria 1078
442 Ga0207706_10045661 3300025933 Bacteria 3881
443 Ga0207706_10074986 3300025933 Bacteria 2974
444 Ga0207706_10267209 3300025933 Bacteria 1493
445 Ga0207706_10449222 3300025933 Unclassified 1115
446 Ga0207706_10696234 3300025933 Bacteria 868
447 Ga0207686_10000200 3300025934 Bacteria 46234
448 Ga0207686_11263386 3300025934 Bacteria 605
449 Ga0207709_11240362 3300025935 Bacteria 615
450 Ga0207670_10103846 3300025936 Bacteria 2034
451 Ga0207670_10163574 3300025936 Bacteria 1663
452 Ga0207670_10284640 3300025936 Unclassified 1289
453 Ga0207670_11505317 3300025936 Bacteria 572
454 Ga0207669_10653424 3300025937 Bacteria 860
455 Ga0207669_10976950 3300025937 Bacteria 711
456 Ga0207669_11112106 3300025937 Unclassified 667
457 Ga0207669_11137177 3300025937 Bacteria 660
458 Ga0207704_10658840 3300025938 Unclassified 863
459 Ga0207704_10780080 3300025938 Bacteria 797
460 Ga0207665_10600284 3300025939 Bacteria 859
461 Ga0207691_10090554 3300025940 Unclassified 2742
462 Ga0207691_10401557 3300025940 Bacteria 1169
463 Ga0207691_11145204 3300025940 Unclassified 646
464 Ga0207691_11667356 3300025940 Unclassified 517
465 Ga0207711_11242231 3300025941 Bacteria 687
466 Ga0207689_10039743 3300025942 Bacteria 3894
467 Ga0207689_10169171 3300025942 Bacteria 1801
468 Ga0207689_10209134 3300025942 Bacteria 1612
469 Ga0207689_10260045 3300025942 Unclassified 1436
470 Ga0207689_10374793 3300025942 Bacteria 1185
471 Ga0207689_10770283 3300025942 Unclassified 812
472 Ga0207661_10030202 3300025944 Bacteria 4172
473 Ga0207661_10226925 3300025944 Bacteria 1652
474 Ga0207679_10178810 3300025945 Bacteria 1753
475 Ga0207679_10469833 3300025945 Unclassified 1118
476 Ga0207667_10749876 3300025949 Bacteria 976
477 Ga0207651_10384443 3300025960 Bacteria 1190
478 Ga0207712_10002897 3300025961 Bacteria 10969
479 Ga0207712_10004281 3300025961 Bacteria 9006
480 Ga0207712_10077710 3300025961 Bacteria 2407
481 Ga0207712_10134125 3300025961 Unclassified 1891
482 Ga0207712_10826164 3300025961 Bacteria 816
483 Ga0207712_10899806 3300025961 Bacteria 782
484 Ga0207712_11963244 3300025961 Bacteria 524
485 Ga0207668_10087974 3300025972 Bacteria 2274
486 Ga0207668_10202832 3300025972 Bacteria 1581
487 Ga0207668_11799895 3300025972 Unclassified 553
488 Ga0207640_10447548 3300025981 Bacteria 1064
489 Ga0207640_10482078 3300025981 Bacteria 1029
490 Ga0207640_11266351 3300025981 Bacteria 657
491 Ga0207658_10068775 3300025986 Bacteria 2673
492 Ga0207658_10363666 3300025986 Unclassified 1263
493 Ga0207658_10403600 3300025986 Unclassified 1202
494 Ga0207658_10762058 3300025986 Bacteria 877
495 Ga0207658_11583956 3300025986 Unclassified 599
496 Ga0207677_10033907 3300026023 Bacteria 3300
497 Ga0207677_10313291 3300026023 Bacteria 1301
498 Ga0207677_10458983 3300026023 Unclassified 1093
499 Ga0207677_12140386 3300026023 Unclassified 520
500 Ga0207703_10304457 3300026035 Bacteria 1455
501 Ga0207703_10404519 3300026035 Bacteria 1267
502 Ga0207703_10795798 3300026035 Bacteria 902
503 Ga0207639_10576649 3300026041 Unclassified 1035
504 Ga0207639_10918954 3300026041 Bacteria 818
505 Ga0207639_11990037 3300026041 Bacteria 542
506 Ga0207678_10054197 3300026067 Unclassified 3454
507 Ga0207678_10325103 3300026067 Bacteria 1323
508 Ga0207702_10983318 3300026078 Bacteria 837
509 Ga0207702_10984363 3300026078 Bacteria 836
510 Ga0207641_10020162 3300026088 Bacteria 5473
511 Ga0207641_10041489 3300026088 Bacteria 3856
512 Ga0207641_11046125 3300026088 Bacteria 814
513 Ga0207641_11328397 3300026088 Bacteria 720
514 Ga0207648_10047106 3300026089 Bacteria 3779
515 Ga0207648_10055161 3300026089 Bacteria 3470
516 Ga0207648_10057539 3300026089 Bacteria 3392
517 Ga0207648_10181197 3300026089 Bacteria 1865
518 Ga0207648_10315820 3300026089 Bacteria 1403
519 Ga0207648_10532132 3300026089 Bacteria 1078
520 Ga0207648_11332845 3300026089 Bacteria 674
521 Ga0207648_11436195 3300026089 Bacteria 648
522 Ga0207676_10129917 3300026095 Bacteria 2140
523 Ga0207676_10156593 3300026095 Unclassified 1969
524 Ga0207676_10157440 3300026095 Bacteria 1964
525 Ga0207676_10729483 3300026095 Bacteria 962
526 Ga0207674_10019713 3300026116 Bacteria 7300
527 Ga0207674_10062109 3300026116 Bacteria 3773
528 Ga0207674_10180762 3300026116 Bacteria 2061
529 Ga0207674_10909694 3300026116 Bacteria 848
530 Ga0207674_11261776 3300026116 Bacteria 708
531 Ga0207675_100010610 3300026118 Bacteria 8629
532 Ga0207675_100034120 3300026118 Bacteria 4743
533 Ga0207675_100270961 3300026118 Bacteria 1647
534 Ga0207675_100363355 3300026118 Bacteria 1420
535 Ga0207675_100632873 3300026118 Bacteria 1075
536 Ga0207675_101079257 3300026118 Bacteria 822
537 Ga0207675_101653731 3300026118 Unclassified 660
538 Ga0207675_102247055 3300026118 Unclassified 560
539 Ga0207683_10991110 3300026121 Unclassified 780
540 Ga0207683_11012352 3300026121 Bacteria 771
541 Ga0207698_10372018 3300026142 Bacteria 1357
542 Ga0207698_10674453 3300026142 Bacteria 1026
543 Ga0207698_10971600 3300026142 Unclassified 859
544 Ga0207698_11074522 3300026142 Bacteria 817
545 Ga0207698_12342274 3300026142 Bacteria 546
546 Ga0209995_1027606 3300027471 Bacteria 948
547 Ga0207428_10672672 3300027907 Unclassified 742
548 Ga0207428_11301296 3300027907 Bacteria 504
549 Ga0268266_10277028 3300028379 Unclassified 1559
550 Ga0268266_10323399 3300028379 Bacteria 1444
551 Ga0268266_10468923 3300028379 Bacteria 1199
552 Ga0268265_10234832 3300028380 Bacteria 1614
553 Ga0268265_10291949 3300028380 Bacteria 1464
554 Ga0268265_11009699 3300028380 Bacteria 822
555 Ga0268265_11232908 3300028380 Bacteria 746
556 Ga0268265_11847226 3300028380 Bacteria 611
557 Ga0268264_10005626 3300028381 Bacteria 10615
558 Ga0268264_10042733 3300028381 Bacteria 3752
559 Ga0268264_10077236 3300028381 Unclassified 2836
560 Ga0268264_10156577 3300028381 Bacteria 2048
561 Ga0268264_11074970 3300028381 Unclassified 812
562 Ga0268264_11170489 3300028381 Bacteria 778
563 Ga0268264_11616869 3300028381 Bacteria 658
564 Ga0307515_10000380 3300028794 Bacteria 108537
565 Ga0307515_10006611 3300028794 Bacteria 23131
566 Ga0307509_10487751 3300031507 Bacteria 919
567 Ga0307408_100020641 3300031548 Bacteria 4450
568 Ga0316576_10263168 3300031727 Bacteria 1294
569 Ga0307413_10598496 3300031824 Bacteria 902
570 Ga0307413_10819778 3300031824 Bacteria 784
571 Ga0307410_10000071 3300031852 Bacteria 35788
572 Ga0307406_10000037 3300031901 Bacteria 80899
573 Ga0307407_10006810 3300031903 Bacteria 5121
574 Ga0307409_102310819 3300031995 Bacteria 567
575 Ga0307416_102686002 3300032002 Bacteria 595
576 Ga0307414_10000012 3300032004 Bacteria 322675
577 Ga0307414_10874760 3300032004 Bacteria 823
578 Ga0307411_10399037 3300032005 Bacteria 1136
579 Ga0307411_10800353 3300032005 Bacteria 830
580 Ga0307411_11281402 3300032005 Bacteria 667
581 Ga0373929_0044557 3300035085 Bacteria 997
582 Ga0373934_0220285 3300035086 Bacteria 783
583 Ga0373952_0029310 3300035092 Bacteria 1212
584 Ga0373955_0325662 3300035172 Bacteria 929
585 Ga0316574_0243033 3300035398 Unclassified 1151
586 Ga0373924_0221624 3300035410 Bacteria 836
587 Ga0373937_0067380 3300036401 Bacteria 3298
588 Ga0316584_0517844 3300036712 Bacteria 836
589 Ga0395900_1769213 3300037418 Bacteria 529
590 Ga0395905_0179469 3300037471 Bacteria 1988
591 Ga0436365_0729052 3300039437 Bacteria 5196
592 Ga0436365_0843457 3300039437 Bacteria 1552
593 Ga0436365_0853306 3300039437 Bacteria 2533
594 Ga0436365_1151340 3300039437 Bacteria 808
595 Ga0436365_1758907 3300039437 Bacteria 764
596 Ga0439447_147320 3300041407 Bacteria 541
597 Ga0439461_0093789 3300041410 Unclassified 723
598 Ga0439466_0022583 3300041411 Bacteria 2219
599 Ga0439466_0152692 3300041411 Bacteria 707
600 Ga0451800_0578341 3300041459 Unclassified 565
601 Ga0451802_0144258 3300041460 Unclassified 519
602 Ga0451802_0831830 3300041460 Bacteria 713
603 Ga0451807_1994737 3300041486 Bacteria 962
604 Ga0451833_1296905 3300041491 Unclassified 590
605 Ga0451839_0785002 3300041496 Bacteria 780
606 Ga0451843_0767574 3300041509 Bacteria 833
607 Ga0451853_3843889 3300041512 Unclassified 880
608 Ga0439431_0233793 3300041997 Unclassified 542
609 Ga0439445_0117259 3300042004 Bacteria 763
610 Ga0439444_0039841 3300042437 Bacteria 918
611 Ga0439444_0200902 3300042437 Unclassified 503
612 Ga0439460_0169504 3300042461 Bacteria 735
613 Ga0451577_0001044 3300042876 Bacteria 40023
614 Ga0451577_0266645 3300042876 Bacteria 1551
615 Ga0451577_0526212 3300042876 Bacteria 1074
616 Ga0453683_0000005 3300044673 Bacteria 741657
617 Ga0453683_0000792 3300044673 Bacteria 31218
618 Ga0453683_0007079 3300044673 Bacteria 7639
619 Ga0453683_0009838 3300044673 Bacteria 6371
620 Ga0453683_0135617 3300044673 Bacteria 1552
621 Ga0453683_0523355 3300044673 Bacteria 770
622 Ga0453683_1053705 3300044673 Unclassified 541
623 Ga0453683_1127602 3300044673 Unclassified 523
624 Ga0453684_0000610 3300044712 Bacteria 131386
625 Ga0453684_0037330 3300044712 Bacteria 6669
626 Ga0453684_0041845 3300044712 Bacteria 6186
627 Ga0453684_0073834 3300044712 Bacteria 4298
628 Ga0453684_0187867 3300044712 Bacteria 2419
629 Ga0453684_0261375 3300044712 Bacteria 1982
630 Ga0453684_0310964 3300044712 Bacteria 1788
631 Ga0453684_0358626 3300044712 Unclassified 1642
632 Ga0453684_0730654 3300044712 Bacteria 1073
633 Ga0451576_0000193 3300045051 Bacteria 154108
634 Ga0451576_0006040 3300045051 Bacteria 14948
635 Ga0451576_0006802 3300045051 Bacteria 13898
636 Ga0451576_0011516 3300045051 Bacteria 10042
637 Ga0451576_0238042 3300045051 Bacteria 1901
638 Ga0451576_0858618 3300045051 Bacteria 953
639 Ga0451576_1095975 3300045051 Unclassified 833
640 Ga0495592_0445143 3300046454 Bacteria 813
641 Ga0495638_0027584 3300046460 Bacteria 3675
642 Ga0495638_0309182 3300046460 Bacteria 849
643 Ga0495606_0000021 3300046507 Bacteria 271238
644 Ga0495610_0000279 3300046512 Bacteria 53150
645 Ga0495610_0001345 3300046512 Bacteria 21797
646 Ga0495628_0299785 3300046516 Bacteria 1190
647 Ga0495632_0296989 3300046519 Bacteria 717
648 Ga0495637_0088822 3300046520 Bacteria 1222
649 Ga0495643_0255454 3300046522 Bacteria 816
650 Ga0495587_0129525 3300046536 Bacteria 1442
651 Ga0495598_0148551 3300046537 Bacteria 816
652 Ga0495621_0304944 3300046539 Bacteria 661
653 Ga0495645_0143842 3300046543 Bacteria 1662
654 Ga0495633_0005737 3300046558 Bacteria 7506
655 Ga0495667_0106133 3300046559 Bacteria 1816
656 Ga0495668_0000097 3300046616 Bacteria 139246
657 Ga0495668_0013869 3300046616 Bacteria 4740
658 Ga0495661_0022788 3300046665 Bacteria 4071
659 Ga0495613_0533742 3300046689 Bacteria 787
660 Ga0495671_0314262 3300046692 Bacteria 753
661 Ga0495581_0643331 3300047315 Bacteria 613
662 Ga0495604_0288924 3300047317 Bacteria 1105
663 Ga0495674_0838556 3300047319 Unclassified 713
664 Ga0495672_0395622 3300047320 Bacteria 633
665 Ga0495680_0259306 3300047322 Bacteria 1230
666 Ga0495686_0000625 3300047472 Bacteria 48634
667 Ga0496100_0514093 3300048903 Bacteria 924
668 Ga0496104_0943806 3300048907 Unclassified 767
669 Ga0496110_0220839 3300048913 Bacteria 1723
670 Ga0496110_1696769 3300048913 Unclassified 542
671 Ga0496111_0086257 3300048914 Bacteria 2297
672 Ga0496111_0180514 3300048914 Unclassified 1569
673 Ga0496112_1227484 3300048915 Unclassified 666
674 Ga0496112_1500157 3300048915 Bacteria 588
675 Ga0496113_0896284 3300048916 Unclassified 702
676 Ga0496114_0062136 3300048917 Unclassified 3126
677 Ga0496116_0000032 3300048919 Bacteria 419997
678 Ga0496121_0233147 3300048924 Bacteria 1288
679 Ga0496124_0299158 3300048927 Bacteria 1163
680 Ga0496125_0000111 3300048928 Bacteria 191489
681 Ga0496126_0004578 3300048929 Bacteria 16402
682 Ga0496126_0167088 3300048929 Bacteria 1877
683 Ga0501290_062370 3300049513 Bacteria 603
684 Ga0501038_0086325 3300049574 Bacteria 2637
685 Ga0501238_000090 3300049671 Bacteria 14589
686 Ga0501249_043346 3300049679 Bacteria 1024
687 Ga0501266_016963 3300049763 Bacteria 971
688 Ga0501280_001826 3300049776 Bacteria 3734
689 nmdc:mga07m45_686929_c1 3300050496 Bacteria 589
690 nmdc:mga05p37_231810_c1 3300050507 Bacteria 2224
691 nmdc:mga05p37_439472_c1 3300050507 Bacteria 1513
692 nmdc:mga05p37_46311_c1 3300050507 Bacteria 5348
693 nmdc:mga09592_208367_c1 3300050508 Unclassified 1693
694 nmdc:mga09592_375511_c1 3300050508 Bacteria 1230
695 nmdc:mga0qj67_1193098_c1 3300050509 Unclassified 592
696 nmdc:mga06r32_1072593_c1 3300050510 Bacteria 755
697 nmdc:mga06r32_360646_c1 3300050510 Bacteria 1437
698 nmdc:mga08y16_1495192_c1 3300050511 Bacteria 636
699 nmdc:mga08y16_1640127_c1 3300050511 Bacteria 600
700 nmdc:mga08y16_285380_c1 3300050511 Bacteria 1702
701 nmdc:mga08y16_771138_c1 3300050511 Unclassified 956
702 nmdc:mga08y16_897432_c1 3300050511 Unclassified 873
703 nmdc:mga0n895_179543_c1 3300050512 Bacteria 2148
704 Ga0500635_0082404 3300053080 Unclassified 1158
705 Ga0500644_0166812 3300053088 Bacteria 893
706 Ga0500646_0136625 3300053090 Bacteria 801
707 Ga0500647_0085727 3300053091 Bacteria 1510
708 Ga0500583_0154170 3300053092 Bacteria 1144
709 Ga0500641_0000020 3300053096 Bacteria 119591
710 Ga0500642_0007034 3300053130 Bacteria 3753
711 Ga0500573_0352650 3300053140 Bacteria 714
712 Ga0500604_0011813 3300053151 Bacteria 2352
713 Ga0500616_0033668 3300053153 Bacteria 2794
714 Ga0500627_0002345 3300053158 Bacteria 5593
715 Ga0500584_040179 3300053726 Bacteria 2148
716 Ga0500611_000020 3300053727 Bacteria 105250

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_1053705 Ga0453683_1053705_221_529 97
2 iso_pu_bacteria 2643221667 2644369708 115
3 iso_pu_bacteria 2643221716 2644642420 115
4 iso_pu_bacteria 2643221725 2644685066 115
5 iso_pu_bacteria 2738541279 2738732096 115
6 iso_pu_bacteria 2738541285 2738764661 115
7 iso_pu_bacteria 2738543007 2739213676 115
8 iso_pu_bacteria 2802428842 2802653989 115
9 iso_pu_bacteria 2857613821 2857615976 115
10 iso_pu_bacteria 2904419702 2904422169 115
11 iso_pu_bacteria 2904555929 2904560054 115
12 iso_pu_bacteria 2929150217 2929153209 115
13 iso_pu_bacteria 2977268062 2977269901 115
14 3300026116 Ga0207674_11261776 Ga0207674_112617762 117
15 3300005547 Ga0070693_100290458 Ga0070693_1002904582 118
16 3300005548 Ga0070665_102004070 Ga0070665_1020040701 118
17 3300028379 Ga0268266_10323399 Ga0268266_103233992 118
18 3300031824 Ga0307413_10819778 Ga0307413_108197782 118
19 3300032005 Ga0307411_10399037 Ga0307411_103990372 118
20 3300036712 Ga0316584_0517844 Ga0316584_0517844_456_815 118
21 3300047315 Ga0495581_0643331 Ga0495581_0643331_65_424 118
22 2088090002 CNA_F6ESG4R02GKPM1 CNA_01333650 119
23 3300003203 JGI25406J46586_10160090 JGI25406J46586_101600901 119
24 3300003320 rootH2_10340456 rootH2_103404562 119
25 3300003323 rootH1_10388672 rootH1_103886722 119
26 3300005288 Ga0065714_10002780 Ga0065714_100027803 119
27 3300005288 Ga0065714_10008400 Ga0065714_100084002 119
28 3300005289 Ga0065704_10018505 Ga0065704_100185052 119
29 3300005289 Ga0065704_10495783 Ga0065704_104957831 119
30 3300005290 Ga0065712_10153950 Ga0065712_101539501 119
31 3300005290 Ga0065712_10512818 Ga0065712_105128181 119
32 3300005290 Ga0065712_10834097 Ga0065712_108340971 119
33 3300005293 Ga0065715_10027975 Ga0065715_100279753 119
34 3300005293 Ga0065715_10277504 Ga0065715_102775042 119
35 3300005293 Ga0065715_10551731 Ga0065715_105517312 119
36 3300005295 Ga0065707_10103348 Ga0065707_101033483 119
37 3300005295 Ga0065707_10420512 Ga0065707_104205122 119
38 3300005295 Ga0065707_10597090 Ga0065707_105970901 119
39 3300005327 Ga0070658_10383727 Ga0070658_103837272 119
40 3300005328 Ga0070676_10006442 Ga0070676_100064425 119
41 3300005328 Ga0070676_10683586 Ga0070676_106835861 119
42 3300005329 Ga0070683_100047424 Ga0070683_1000474242 119
43 3300005329 Ga0070683_100161092 Ga0070683_1001610925 119
44 3300005329 Ga0070683_100334253 Ga0070683_1003342531 119
45 3300005329 Ga0070683_101961349 Ga0070683_1019613491 119
46 3300005330 Ga0070690_100172724 Ga0070690_1001727242 119
47 3300005330 Ga0070690_100578841 Ga0070690_1005788411 119
48 3300005331 Ga0070670_100065566 Ga0070670_1000655662 119
49 3300005331 Ga0070670_100108062 Ga0070670_1001080623 119
50 3300005331 Ga0070670_100129781 Ga0070670_1001297812 119
51 3300005331 Ga0070670_100185011 Ga0070670_1001850113 119
52 3300005331 Ga0070670_100448539 Ga0070670_1004485392 119
53 3300005331 Ga0070670_100664206 Ga0070670_1006642061 119
54 3300005331 Ga0070670_101796862 Ga0070670_1017968621 119
55 3300005333 Ga0070677_10133241 Ga0070677_101332411 119
56 3300005333 Ga0070677_10400039 Ga0070677_104000391 119
57 3300005334 Ga0068869_100037066 Ga0068869_1000370661 119
58 3300005334 Ga0068869_100248166 Ga0068869_1002481662 119
59 3300005334 Ga0068869_100439429 Ga0068869_1004394292 119
60 3300005334 Ga0068869_100873849 Ga0068869_1008738492 119
61 3300005335 Ga0070666_10056032 Ga0070666_100560323 119
62 3300005335 Ga0070666_11222892 Ga0070666_112228921 119
63 3300005337 Ga0070682_100341267 Ga0070682_1003412671 119
64 3300005338 Ga0068868_100091600 Ga0068868_1000916003 119
65 3300005338 Ga0068868_100267123 Ga0068868_1002671232 119
66 3300005338 Ga0068868_100620658 Ga0068868_1006206582 119
67 3300005338 Ga0068868_100926826 Ga0068868_1009268262 119
68 3300005339 Ga0070660_100903612 Ga0070660_1009036121 119
69 3300005340 Ga0070689_100007532 Ga0070689_1000075323 119
70 3300005340 Ga0070689_100099742 Ga0070689_1000997423 119
71 3300005340 Ga0070689_100231672 Ga0070689_1002316722 119
72 3300005340 Ga0070689_100471164 Ga0070689_1004711642 119
73 3300005343 Ga0070687_100699987 Ga0070687_1006999872 119
74 3300005344 Ga0070661_100057494 Ga0070661_1000574941 119
75 3300005347 Ga0070668_102092002 Ga0070668_1020920021 119
76 3300005353 Ga0070669_100156596 Ga0070669_1001565962 119
77 3300005353 Ga0070669_100363299 Ga0070669_1003632992 119
78 3300005353 Ga0070669_100593254 Ga0070669_1005932543 119
79 3300005353 Ga0070669_101764539 Ga0070669_1017645391 119
80 3300005353 Ga0070669_101984101 Ga0070669_1019841011 119
81 3300005354 Ga0070675_100055526 Ga0070675_1000555262 119
82 3300005354 Ga0070675_100119203 Ga0070675_1001192033 119
83 3300005354 Ga0070675_100153456 Ga0070675_1001534561 119
84 3300005354 Ga0070675_100331730 Ga0070675_1003317302 119
85 3300005355 Ga0070671_100056167 Ga0070671_1000561671 119
86 3300005355 Ga0070671_100261210 Ga0070671_1002612102 119
87 3300005355 Ga0070671_100538350 Ga0070671_1005383501 119
88 3300005355 Ga0070671_101412243 Ga0070671_1014122431 119
89 3300005356 Ga0070674_100031187 Ga0070674_1000311871 119
90 3300005356 Ga0070674_100382789 Ga0070674_1003827892 119
91 3300005356 Ga0070674_100649687 Ga0070674_1006496872 119
92 3300005364 Ga0070673_100074023 Ga0070673_1000740231 119
93 3300005364 Ga0070673_100220363 Ga0070673_1002203631 119
94 3300005364 Ga0070673_100592469 Ga0070673_1005924692 119
95 3300005364 Ga0070673_100654566 Ga0070673_1006545662 119
96 3300005364 Ga0070673_101144362 Ga0070673_1011443621 119
97 3300005364 Ga0070673_101559123 Ga0070673_1015591231 119
98 3300005364 Ga0070673_101631829 Ga0070673_1016318292 119
99 3300005365 Ga0070688_100093127 Ga0070688_1000931272 119
100 3300005365 Ga0070688_100301395 Ga0070688_1003013951 119
101 3300005365 Ga0070688_101508146 Ga0070688_1015081461 119
102 3300005366 Ga0070659_100069554 Ga0070659_1000695544 119
103 3300005367 Ga0070667_100059036 Ga0070667_1000590361 119
104 3300005367 Ga0070667_100083177 Ga0070667_1000831773 119
105 3300005367 Ga0070667_100120350 Ga0070667_1001203502 119
106 3300005367 Ga0070667_100229768 Ga0070667_1002297682 119
107 3300005367 Ga0070667_100808260 Ga0070667_1008082602 119
108 3300005367 Ga0070667_100819935 Ga0070667_1008199351 119
109 3300005367 Ga0070667_101815569 Ga0070667_1018155691 119
110 3300005434 Ga0070709_11368966 Ga0070709_113689661 119
111 3300005436 Ga0070713_101030656 Ga0070713_1010306562 119
112 3300005438 Ga0070701_10946258 Ga0070701_109462581 119
113 3300005441 Ga0070700_100106015 Ga0070700_1001060152 119
114 3300005441 Ga0070700_101734848 Ga0070700_1017348481 119
115 3300005455 Ga0070663_100439828 Ga0070663_1004398281 119
116 3300005455 Ga0070663_101334453 Ga0070663_1013344531 119
117 3300005456 Ga0070678_101300074 Ga0070678_1013000741 119
118 3300005456 Ga0070678_101500547 Ga0070678_1015005471 119
119 3300005457 Ga0070662_100380875 Ga0070662_1003808752 119
120 3300005457 Ga0070662_101072637 Ga0070662_1010726371 119
121 3300005457 Ga0070662_101714678 Ga0070662_1017146781 119
122 3300005459 Ga0068867_100141751 Ga0068867_1001417511 119
123 3300005459 Ga0068867_100583220 Ga0068867_1005832202 119
124 3300005459 Ga0068867_101468170 Ga0068867_1014681701 119
125 3300005466 Ga0070685_10024602 Ga0070685_100246022 119
126 3300005466 Ga0070685_10086939 Ga0070685_100869392 119
127 3300005466 Ga0070685_10109046 Ga0070685_101090462 119
128 3300005466 Ga0070685_10545990 Ga0070685_105459901 119
129 3300005471 Ga0070698_100005484 Ga0070698_10000548415 119
130 3300005471 Ga0070698_100022480 Ga0070698_1000224807 119
131 3300005471 Ga0070698_100031347 Ga0070698_1000313474 119
132 3300005530 Ga0070679_100554036 Ga0070679_1005540362 119
133 3300005535 Ga0070684_100002669 Ga0070684_1000026697 119
134 3300005535 Ga0070684_100118730 Ga0070684_1001187302 119
135 3300005539 Ga0068853_100917433 Ga0068853_1009174333 119
136 3300005539 Ga0068853_101122854 Ga0068853_1011228541 119
137 3300005543 Ga0070672_100141813 Ga0070672_1001418133 119
138 3300005543 Ga0070672_100354266 Ga0070672_1003542662 119
139 3300005543 Ga0070672_100621451 Ga0070672_1006214512 119
140 3300005543 Ga0070672_100799900 Ga0070672_1007999003 119
141 3300005544 Ga0070686_100842835 Ga0070686_1008428352 119
142 3300005544 Ga0070686_101392866 Ga0070686_1013928662 119
143 3300005548 Ga0070665_100064660 Ga0070665_1000646603 119
144 3300005548 Ga0070665_100337642 Ga0070665_1003376422 119
145 3300005548 Ga0070665_100757338 Ga0070665_1007573381 119
146 3300005549 Ga0070704_100528198 Ga0070704_1005281981 119
147 3300005564 Ga0070664_100087600 Ga0070664_1000876002 119
148 3300005564 Ga0070664_100165434 Ga0070664_1001654342 119
149 3300005564 Ga0070664_100184399 Ga0070664_1001843991 119
150 3300005564 Ga0070664_100197470 Ga0070664_1001974702 119
151 3300005564 Ga0070664_100491359 Ga0070664_1004913592 119
152 3300005564 Ga0070664_100549610 Ga0070664_1005496101 119
153 3300005564 Ga0070664_100719467 Ga0070664_1007194671 119
154 3300005577 Ga0068857_100073434 Ga0068857_1000734342 119
155 3300005577 Ga0068857_100719268 Ga0068857_1007192682 119
156 3300005577 Ga0068857_100901152 Ga0068857_1009011522 119
157 3300005577 Ga0068857_102171205 Ga0068857_1021712051 119
158 3300005578 Ga0068854_100571855 Ga0068854_1005718552 119
159 3300005578 Ga0068854_100841276 Ga0068854_1008412761 119
160 3300005615 Ga0070702_100289838 Ga0070702_1002898381 119
161 3300005615 Ga0070702_101155166 Ga0070702_1011551661 119
162 3300005616 Ga0068852_100080524 Ga0068852_1000805243 119
163 3300005616 Ga0068852_100406241 Ga0068852_1004062412 119
164 3300005616 Ga0068852_100505890 Ga0068852_1005058902 119
165 3300005617 Ga0068859_100013562 Ga0068859_1000135627 119
166 3300005617 Ga0068859_100013830 Ga0068859_10001383010 119
167 3300005617 Ga0068859_100042847 Ga0068859_1000428471 119
168 3300005617 Ga0068859_100145417 Ga0068859_1001454173 119
169 3300005617 Ga0068859_100268908 Ga0068859_1002689082 119
170 3300005617 Ga0068859_100355209 Ga0068859_1003552092 119
171 3300005617 Ga0068859_100516580 Ga0068859_1005165802 119
172 3300005617 Ga0068859_100555425 Ga0068859_1005554253 119
173 3300005617 Ga0068859_100609294 Ga0068859_1006092942 119
174 3300005617 Ga0068859_100759746 Ga0068859_1007597462 119
175 3300005617 Ga0068859_100786647 Ga0068859_1007866472 119
176 3300005617 Ga0068859_101419754 Ga0068859_1014197541 119
177 3300005617 Ga0068859_101489715 Ga0068859_1014897152 119
178 3300005617 Ga0068859_102338479 Ga0068859_1023384792 119
179 3300005617 Ga0068859_102854114 Ga0068859_1028541141 119
180 3300005618 Ga0068864_100010460 Ga0068864_1000104601 119
181 3300005618 Ga0068864_100192211 Ga0068864_1001922112 119
182 3300005618 Ga0068864_100950092 Ga0068864_1009500921 119
183 3300005618 Ga0068864_101938783 Ga0068864_1019387831 119
184 3300005718 Ga0068866_10074811 Ga0068866_100748112 119
185 3300005718 Ga0068866_10305692 Ga0068866_103056921 119
186 3300005718 Ga0068866_10787442 Ga0068866_107874422 119
187 3300005719 Ga0068861_100051340 Ga0068861_1000513402 119
188 3300005719 Ga0068861_100054764 Ga0068861_1000547642 119
189 3300005719 Ga0068861_100087878 Ga0068861_1000878786 119
190 3300005719 Ga0068861_100649976 Ga0068861_1006499763 119
191 3300005719 Ga0068861_101132408 Ga0068861_1011324082 119
192 3300005719 Ga0068861_102501786 Ga0068861_1025017861 119
193 3300005834 Ga0068851_10424510 Ga0068851_104245101 119
194 3300005840 Ga0068870_10780175 Ga0068870_107801752 119
195 3300005840 Ga0068870_11237958 Ga0068870_112379581 119
196 3300005841 Ga0068863_100001966 Ga0068863_10000196623 119
197 3300005841 Ga0068863_100145776 Ga0068863_1001457762 119
198 3300005841 Ga0068863_101051708 Ga0068863_1010517081 119
199 3300005841 Ga0068863_101170353 Ga0068863_1011703532 119
200 3300005841 Ga0068863_102580928 Ga0068863_1025809282 119
201 3300005842 Ga0068858_100221633 Ga0068858_1002216332 119
202 3300005842 Ga0068858_100355511 Ga0068858_1003555112 119
203 3300005842 Ga0068858_100703032 Ga0068858_1007030321 119
204 3300005843 Ga0068860_100004009 Ga0068860_1000040095 119
205 3300005843 Ga0068860_100005881 Ga0068860_1000058816 119
206 3300005843 Ga0068860_100195525 Ga0068860_1001955253 119
207 3300005843 Ga0068860_100239146 Ga0068860_1002391462 119
208 3300005843 Ga0068860_101104792 Ga0068860_1011047922 119
209 3300005843 Ga0068860_102568950 Ga0068860_1025689501 119
210 3300005844 Ga0068862_100415963 Ga0068862_1004159632 119
211 3300005844 Ga0068862_100849258 Ga0068862_1008492582 119
212 3300005844 Ga0068862_101346236 Ga0068862_1013462362 119
213 3300005844 Ga0068862_101412879 Ga0068862_1014128792 119
214 3300005985 Ga0081539_10001794 Ga0081539_1000179418 119
215 3300006028 Ga0070717_11221272 Ga0070717_112212721 119
216 3300006058 Ga0075432_10312819 Ga0075432_103128191 119
217 3300006058 Ga0075432_10494114 Ga0075432_104941141 119
218 3300006163 Ga0070715_10540631 Ga0070715_105406311 119
219 3300006173 Ga0070716_100271747 Ga0070716_1002717472 119
220 3300006237 Ga0097621_100005069 Ga0097621_1000050699 119
221 3300006237 Ga0097621_100204497 Ga0097621_1002044972 119
222 3300006237 Ga0097621_100343939 Ga0097621_1003439391 119
223 3300006237 Ga0097621_100460416 Ga0097621_1004604161 119
224 3300006237 Ga0097621_100568195 Ga0097621_1005681952 119
225 3300006237 Ga0097621_101572586 Ga0097621_1015725861 119
226 3300006353 Ga0075370_10874260 Ga0075370_108742601 119
227 3300006358 Ga0068871_100008961 Ga0068871_1000089613 119
228 3300006358 Ga0068871_100017013 Ga0068871_1000170134 119
229 3300006358 Ga0068871_100327403 Ga0068871_1003274032 119
230 3300006358 Ga0068871_100827830 Ga0068871_1008278301 119
231 3300006358 Ga0068871_101024414 Ga0068871_1010244141 119
232 3300006844 Ga0075428_100012494 Ga0075428_1000124942 119
233 3300006844 Ga0075428_102595621 Ga0075428_1025956212 119
234 3300006846 Ga0075430_100817277 Ga0075430_1008172771 119
235 3300006847 Ga0075431_100055186 Ga0075431_1000551862 119
236 3300006847 Ga0075431_101566198 Ga0075431_1015661981 119
237 3300006880 Ga0075429_100006150 Ga0075429_1000061508 119
238 3300006880 Ga0075429_100313024 Ga0075429_1003130242 119
239 3300006880 Ga0075429_100463541 Ga0075429_1004635412 119
240 3300006881 Ga0068865_100359529 Ga0068865_1003595292 119
241 3300006931 Ga0097620_100013560 Ga0097620_1000135607 119
242 3300006931 Ga0097620_100013830 Ga0097620_10001383010 119
243 3300006931 Ga0097620_100042845 Ga0097620_1000428451 119
244 3300006931 Ga0097620_100145418 Ga0097620_1001454181 119
245 3300006931 Ga0097620_100268914 Ga0097620_1002689142 119
246 3300006931 Ga0097620_100355215 Ga0097620_1003552152 119
247 3300006931 Ga0097620_100516578 Ga0097620_1005165781 119
248 3300006931 Ga0097620_100555436 Ga0097620_1005554362 119
249 3300006931 Ga0097620_100609262 Ga0097620_1006092622 119
250 3300006931 Ga0097620_100759728 Ga0097620_1007597282 119
251 3300006931 Ga0097620_100786663 Ga0097620_1007866632 119
252 3300006931 Ga0097620_101419866 Ga0097620_1014198661 119
253 3300006931 Ga0097620_101489543 Ga0097620_1014895431 119
254 3300006931 Ga0097620_102339664 Ga0097620_1023396642 119
255 3300006931 Ga0097620_102855217 Ga0097620_1028552171 119
256 3300009011 Ga0105251_10053057 Ga0105251_100530571 119
257 3300009011 Ga0105251_10065440 Ga0105251_100654402 119
258 3300009036 Ga0105244_10000004 Ga0105244_10000004218 119
259 3300009093 Ga0105240_10669872 Ga0105240_106698722 119
260 3300009093 Ga0105240_12165303 Ga0105240_121653031 119
261 3300009094 Ga0111539_10041924 Ga0111539_100419242 119
262 3300009094 Ga0111539_10054398 Ga0111539_100543982 119
263 3300009094 Ga0111539_10433793 Ga0111539_104337933 119
264 3300009094 Ga0111539_11018641 Ga0111539_110186412 119
265 3300009094 Ga0111539_11388357 Ga0111539_113883571 119
266 3300009094 Ga0111539_11414666 Ga0111539_114146662 119
267 3300009094 Ga0111539_13476687 Ga0111539_134766871 119
268 3300009101 Ga0105247_10001409 Ga0105247_1000140918 119
269 3300009101 Ga0105247_10240118 Ga0105247_102401182 119
270 3300009147 Ga0114129_10069169 Ga0114129_100691692 119
271 3300009147 Ga0114129_10085559 Ga0114129_100855592 119
272 3300009147 Ga0114129_11658103 Ga0114129_116581031 119
273 3300009147 Ga0114129_13124094 Ga0114129_131240941 119
274 3300009147 Ga0114129_13378419 Ga0114129_133784192 119
275 3300009148 Ga0105243_11763213 Ga0105243_117632132 119
276 3300009174 Ga0105241_10200544 Ga0105241_102005442 119
277 3300009174 Ga0105241_10358736 Ga0105241_103587361 119
278 3300009174 Ga0105241_11591563 Ga0105241_115915631 119
279 3300009174 Ga0105241_11725373 Ga0105241_117253732 119
280 3300009176 Ga0105242_10002507 Ga0105242_100025072 119
281 3300009176 Ga0105242_10016969 Ga0105242_100169694 119
282 3300009176 Ga0105242_10236415 Ga0105242_102364152 119
283 3300009176 Ga0105242_10523942 Ga0105242_105239421 119
284 3300009176 Ga0105242_11902181 Ga0105242_119021811 119
285 3300009176 Ga0105242_13009761 Ga0105242_130097611 119
286 3300009177 Ga0105248_10390555 Ga0105248_103905551 119
287 3300009177 Ga0105248_11002871 Ga0105248_110028712 119
288 3300009545 Ga0105237_10797586 Ga0105237_107975861 119
289 3300009545 Ga0105237_11305305 Ga0105237_113053052 119
290 3300009545 Ga0105237_12220334 Ga0105237_122203341 119
291 3300009553 Ga0105249_10001319 Ga0105249_1000131912 119
292 3300009553 Ga0105249_10003297 Ga0105249_100032976 119
293 3300009553 Ga0105249_10007594 Ga0105249_1000759412 119
294 3300009553 Ga0105249_10116159 Ga0105249_101161592 119
295 3300009553 Ga0105249_10239858 Ga0105249_102398582 119
296 3300009553 Ga0105249_10317806 Ga0105249_103178062 119
297 3300009553 Ga0105249_10352843 Ga0105249_103528432 119
298 3300009553 Ga0105249_11384769 Ga0105249_113847691 119
299 3300009553 Ga0105249_11389812 Ga0105249_113898121 119
300 3300009553 Ga0105249_11763330 Ga0105249_117633301 119
301 3300009553 Ga0105249_11799193 Ga0105249_117991931 119
302 3300009553 Ga0105249_12793819 Ga0105249_127938192 119
303 3300010375 Ga0105239_10502842 Ga0105239_105028422 119
304 3300011119 Ga0105246_10062756 Ga0105246_100627562 119
305 3300011119 Ga0105246_10134559 Ga0105246_101345592 119
306 3300011119 Ga0105246_10808700 Ga0105246_108087002 119
307 3300013100 Ga0157373_10000002 Ga0157373_10000002230 119
308 3300013100 Ga0157373_10011815 Ga0157373_100118151 119
309 3300013100 Ga0157373_10564275 Ga0157373_105642751 119
310 3300013100 Ga0157373_10605037 Ga0157373_106050371 119
311 3300013100 Ga0157373_11101378 Ga0157373_111013781 119
312 3300013102 Ga0157371_10130310 Ga0157371_101303102 119
313 3300013102 Ga0157371_10363368 Ga0157371_103633682 119
314 3300013104 Ga0157370_10000097 Ga0157370_1000009733 119
315 3300013104 Ga0157370_10002822 Ga0157370_1000282210 119
316 3300013104 Ga0157370_10137162 Ga0157370_101371622 119
317 3300013104 Ga0157370_10166724 Ga0157370_101667243 119
318 3300013104 Ga0157370_10170945 Ga0157370_101709451 119
319 3300013105 Ga0157369_10009083 Ga0157369_100090837 119
320 3300013105 Ga0157369_10030197 Ga0157369_100301973 119
321 3300013105 Ga0157369_10064219 Ga0157369_100642194 119
322 3300013105 Ga0157369_11268232 Ga0157369_112682321 119
323 3300013296 Ga0157374_10008802 Ga0157374_100088022 119
324 3300013296 Ga0157374_10027181 Ga0157374_100271813 119
325 3300013296 Ga0157374_10137876 Ga0157374_101378763 119
326 3300013296 Ga0157374_10182966 Ga0157374_101829663 119
327 3300013296 Ga0157374_10420638 Ga0157374_104206382 119
328 3300013296 Ga0157374_10537427 Ga0157374_105374271 119
329 3300013296 Ga0157374_12280875 Ga0157374_122808752 119
330 3300013297 Ga0157378_10011051 Ga0157378_100110518 119
331 3300013297 Ga0157378_10022058 Ga0157378_100220585 119
332 3300013297 Ga0157378_10199073 Ga0157378_101990732 119
333 3300013297 Ga0157378_10237076 Ga0157378_102370761 119
334 3300013297 Ga0157378_10439418 Ga0157378_104394182 119
335 3300013297 Ga0157378_10906581 Ga0157378_109065811 119
336 3300013297 Ga0157378_11150171 Ga0157378_111501712 119
337 3300013306 Ga0163162_10019416 Ga0163162_100194162 119
338 3300013306 Ga0163162_10026218 Ga0163162_100262185 119
339 3300013306 Ga0163162_10034614 Ga0163162_100346143 119
340 3300013306 Ga0163162_10093233 Ga0163162_100932332 119
341 3300013306 Ga0163162_10124962 Ga0163162_101249622 119
342 3300013306 Ga0163162_10204595 Ga0163162_102045952 119
343 3300013306 Ga0163162_10301734 Ga0163162_103017342 119
344 3300013306 Ga0163162_10676330 Ga0163162_106763302 119
345 3300013306 Ga0163162_10743235 Ga0163162_107432352 119
346 3300013306 Ga0163162_10794787 Ga0163162_107947871 119
347 3300013306 Ga0163162_10914492 Ga0163162_109144922 119
348 3300013306 Ga0163162_11037318 Ga0163162_110373182 119
349 3300013306 Ga0163162_11266750 Ga0163162_112667502 119
350 3300013306 Ga0163162_12286148 Ga0163162_122861481 119
351 3300013306 Ga0163162_12352130 Ga0163162_123521301 119
352 3300013307 Ga0157372_10149650 Ga0157372_101496505 119
353 3300013307 Ga0157372_10251303 Ga0157372_102513032 119
354 3300013307 Ga0157372_10353004 Ga0157372_103530041 119
355 3300013307 Ga0157372_11560919 Ga0157372_115609191 119
356 3300013307 Ga0157372_11699701 Ga0157372_116997012 119
357 3300013307 Ga0157372_12590426 Ga0157372_125904261 119
358 3300013307 Ga0157372_12690523 Ga0157372_126905231 119
359 3300013307 Ga0157372_12991807 Ga0157372_129918071 119
360 3300013308 Ga0157375_10006773 Ga0157375_100067738 119
361 3300013308 Ga0157375_10057411 Ga0157375_100574112 119
362 3300013308 Ga0157375_10079911 Ga0157375_100799112 119
363 3300013308 Ga0157375_10082143 Ga0157375_100821433 119
364 3300013308 Ga0157375_10092904 Ga0157375_100929042 119
365 3300013308 Ga0157375_10126295 Ga0157375_101262955 119
366 3300013308 Ga0157375_10140620 Ga0157375_101406202 119
367 3300013308 Ga0157375_10200943 Ga0157375_102009432 119
368 3300013308 Ga0157375_10322326 Ga0157375_103223262 119
369 3300013308 Ga0157375_10697142 Ga0157375_106971421 119
370 3300013308 Ga0157375_10814958 Ga0157375_108149581 119
371 3300013308 Ga0157375_11220379 Ga0157375_112203792 119
372 3300013308 Ga0157375_12344968 Ga0157375_123449682 119
373 3300014325 Ga0163163_10001981 Ga0163163_1000198116 119
374 3300014325 Ga0163163_10514137 Ga0163163_105141372 119
375 3300014325 Ga0163163_10673108 Ga0163163_106731082 119
376 3300014325 Ga0163163_11514557 Ga0163163_115145572 119
377 3300014325 Ga0163163_12147433 Ga0163163_121474332 119
378 3300014325 Ga0163163_12178397 Ga0163163_121783971 119
379 3300014325 Ga0163163_12992740 Ga0163163_129927401 119
380 3300014326 Ga0157380_10014307 Ga0157380_100143078 119
381 3300014326 Ga0157380_10018408 Ga0157380_100184082 119
382 3300014326 Ga0157380_10098483 Ga0157380_100984832 119
383 3300014326 Ga0157380_10861281 Ga0157380_108612811 119
384 3300014326 Ga0157380_10953870 Ga0157380_109538702 119
385 3300014326 Ga0157380_11059303 Ga0157380_110593031 119
386 3300014326 Ga0157380_11294363 Ga0157380_112943631 119
387 3300014326 Ga0157380_11843938 Ga0157380_118439381 119
388 3300014326 Ga0157380_11901490 Ga0157380_119014901 119
389 3300014745 Ga0157377_10013851 Ga0157377_100138514 119
390 3300014745 Ga0157377_10071880 Ga0157377_100718804 119
391 3300014745 Ga0157377_10101437 Ga0157377_101014372 119
392 3300014745 Ga0157377_11135217 Ga0157377_111352171 119
393 3300014745 Ga0157377_11337023 Ga0157377_113370232 119
394 3300014968 Ga0157379_10016773 Ga0157379_100167732 119
395 3300014968 Ga0157379_10168872 Ga0157379_101688721 119
396 3300014968 Ga0157379_10186779 Ga0157379_101867791 119
397 3300014968 Ga0157379_10635773 Ga0157379_106357731 119
398 3300014968 Ga0157379_10809923 Ga0157379_108099231 119
399 3300014968 Ga0157379_10984598 Ga0157379_109845982 119
400 3300014969 Ga0157376_10091666 Ga0157376_100916662 119
401 3300014969 Ga0157376_10264607 Ga0157376_102646072 119
402 3300014969 Ga0157376_10565587 Ga0157376_105655871 119
403 3300014969 Ga0157376_11098384 Ga0157376_110983841 119
404 3300014969 Ga0157376_11736848 Ga0157376_117368481 119
405 3300014969 Ga0157376_12998747 Ga0157376_129987471 119
406 3300015261 Ga0182006_1002176 Ga0182006_10021769 119
407 3300015262 Ga0182007_10180118 Ga0182007_101801182 119
408 3300017792 Ga0163161_10000026 Ga0163161_1000002646 119
409 3300017792 Ga0163161_10139905 Ga0163161_101399052 119
410 3300017792 Ga0163161_10153991 Ga0163161_101539912 119
411 3300017792 Ga0163161_10211944 Ga0163161_102119442 119
412 3300017792 Ga0163161_10429485 Ga0163161_104294851 119
413 3300017792 Ga0163161_10931595 Ga0163161_109315951 119
414 3300025315 Ga0207697_10107638 Ga0207697_101076382 119
415 3300025728 Ga0207655_1000008 Ga0207655_1000008370 119
416 3300025735 Ga0207713_1163087 Ga0207713_11630872 119
417 3300025735 Ga0207713_1247042 Ga0207713_12470421 119
418 3300025893 Ga0207682_10029013 Ga0207682_100290132 119
419 3300025899 Ga0207642_10212513 Ga0207642_102125132 119
420 3300025899 Ga0207642_10667951 Ga0207642_106679511 119
421 3300025900 Ga0207710_10015279 Ga0207710_100152792 119
422 3300025901 Ga0207688_10110660 Ga0207688_101106602 119
423 3300025903 Ga0207680_10072531 Ga0207680_100725312 119
424 3300025903 Ga0207680_10088068 Ga0207680_100880682 119
425 3300025903 Ga0207680_11016188 Ga0207680_110161882 119
426 3300025904 Ga0207647_10042205 Ga0207647_100422052 119
427 3300025904 Ga0207647_10222973 Ga0207647_102229732 119
428 3300025907 Ga0207645_10011823 Ga0207645_100118232 119
429 3300025907 Ga0207645_10692343 Ga0207645_106923431 119
430 3300025908 Ga0207643_10400214 Ga0207643_104002142 119
431 3300025908 Ga0207643_10923180 Ga0207643_109231802 119
432 3300025909 Ga0207705_10689300 Ga0207705_106893001 119
433 3300025910 Ga0207684_11352300 Ga0207684_113523002 119
434 3300025911 Ga0207654_10833869 Ga0207654_108338691 119
435 3300025918 Ga0207662_10020618 Ga0207662_100206183 119
436 3300025918 Ga0207662_10459852 Ga0207662_104598522 119
437 3300025919 Ga0207657_10168828 Ga0207657_101688281 119
438 3300025920 Ga0207649_10133661 Ga0207649_101336612 119
439 3300025920 Ga0207649_10428961 Ga0207649_104289612 119
440 3300025921 Ga0207652_10816856 Ga0207652_108168562 119
441 3300025922 Ga0207646_10194660 Ga0207646_101946602 119
442 3300025923 Ga0207681_10140828 Ga0207681_101408282 119
443 3300025923 Ga0207681_11018178 Ga0207681_110181781 119
444 3300025923 Ga0207681_11816878 Ga0207681_118168781 119
445 3300025925 Ga0207650_10035597 Ga0207650_100355975 119
446 3300025925 Ga0207650_10118760 Ga0207650_101187603 119
447 3300025925 Ga0207650_10265935 Ga0207650_102659352 119
448 3300025925 Ga0207650_10316727 Ga0207650_103167272 119
449 3300025925 Ga0207650_11107185 Ga0207650_111071852 119
450 3300025925 Ga0207650_11260871 Ga0207650_112608711 119
451 3300025925 Ga0207650_11332689 Ga0207650_113326892 119
452 3300025926 Ga0207659_10055394 Ga0207659_100553942 119
453 3300025926 Ga0207659_10221808 Ga0207659_102218082 119
454 3300025926 Ga0207659_10416583 Ga0207659_104165832 119
455 3300025926 Ga0207659_11279398 Ga0207659_112793981 119
456 3300025926 Ga0207659_11419690 Ga0207659_114196902 119
457 3300025926 Ga0207659_11692003 Ga0207659_116920031 119
458 3300025928 Ga0207700_11050547 Ga0207700_110505471 119
459 3300025931 Ga0207644_10212241 Ga0207644_102122412 119
460 3300025931 Ga0207644_10433401 Ga0207644_104334012 119
461 3300025933 Ga0207706_10045661 Ga0207706_100456612 119
462 3300025933 Ga0207706_10074986 Ga0207706_100749862 119
463 3300025933 Ga0207706_10267209 Ga0207706_102672092 119
464 3300025933 Ga0207706_10449222 Ga0207706_104492223 119
465 3300025933 Ga0207706_10696234 Ga0207706_106962342 119
466 3300025934 Ga0207686_10000200 Ga0207686_100002006 119
467 3300025934 Ga0207686_11263386 Ga0207686_112633861 119
468 3300025935 Ga0207709_11240362 Ga0207709_112403621 119
469 3300025936 Ga0207670_10103846 Ga0207670_101038462 119
470 3300025936 Ga0207670_10163574 Ga0207670_101635742 119
471 3300025936 Ga0207670_10284640 Ga0207670_102846401 119
472 3300025936 Ga0207670_11505317 Ga0207670_115053171 119
473 3300025937 Ga0207669_10653424 Ga0207669_106534242 119
474 3300025937 Ga0207669_10976950 Ga0207669_109769502 119
475 3300025937 Ga0207669_11112106 Ga0207669_111121061 119
476 3300025937 Ga0207669_11137177 Ga0207669_111371771 119
477 3300025938 Ga0207704_10658840 Ga0207704_106588401 119
478 3300025938 Ga0207704_10780080 Ga0207704_107800801 119
479 3300025939 Ga0207665_10600284 Ga0207665_106002841 119
480 3300025940 Ga0207691_10090554 Ga0207691_100905545 119
481 3300025940 Ga0207691_10401557 Ga0207691_104015571 119
482 3300025940 Ga0207691_11145204 Ga0207691_111452042 119
483 3300025940 Ga0207691_11667356 Ga0207691_116673561 119
484 3300025941 Ga0207711_11242231 Ga0207711_112422311 119
485 3300025942 Ga0207689_10039743 Ga0207689_100397432 119
486 3300025942 Ga0207689_10169171 Ga0207689_101691712 119
487 3300025942 Ga0207689_10209134 Ga0207689_102091342 119
488 3300025942 Ga0207689_10260045 Ga0207689_102600451 119
489 3300025942 Ga0207689_10374793 Ga0207689_103747931 119
490 3300025942 Ga0207689_10770283 Ga0207689_107702831 119
491 3300025944 Ga0207661_10030202 Ga0207661_100302022 119
492 3300025944 Ga0207661_10226925 Ga0207661_102269252 119
493 3300025945 Ga0207679_10178810 Ga0207679_101788102 119
494 3300025945 Ga0207679_10469833 Ga0207679_104698332 119
495 3300025949 Ga0207667_10749876 Ga0207667_107498761 119
496 3300025960 Ga0207651_10384443 Ga0207651_103844432 119
497 3300025961 Ga0207712_10002897 Ga0207712_100028975 119
498 3300025961 Ga0207712_10004281 Ga0207712_1000428111 119
499 3300025961 Ga0207712_10077710 Ga0207712_100777104 119
500 3300025961 Ga0207712_10134125 Ga0207712_101341252 119
501 3300025961 Ga0207712_10826164 Ga0207712_108261641 119
502 3300025961 Ga0207712_10899806 Ga0207712_108998062 119
503 3300025961 Ga0207712_11963244 Ga0207712_119632441 119
504 3300025972 Ga0207668_10087974 Ga0207668_100879742 119
505 3300025972 Ga0207668_10202832 Ga0207668_102028321 119
506 3300025972 Ga0207668_11799895 Ga0207668_117998951 119
507 3300025981 Ga0207640_10447548 Ga0207640_104475482 119
508 3300025981 Ga0207640_10482078 Ga0207640_104820781 119
509 3300025981 Ga0207640_11266351 Ga0207640_112663512 119
510 3300025986 Ga0207658_10068775 Ga0207658_100687751 119
511 3300025986 Ga0207658_10363666 Ga0207658_103636662 119
512 3300025986 Ga0207658_10403600 Ga0207658_104036002 119
513 3300025986 Ga0207658_10762058 Ga0207658_107620582 119
514 3300025986 Ga0207658_11583956 Ga0207658_115839562 119
515 3300026023 Ga0207677_10033907 Ga0207677_100339071 119
516 3300026023 Ga0207677_10313291 Ga0207677_103132912 119
517 3300026023 Ga0207677_10458983 Ga0207677_104589832 119
518 3300026023 Ga0207677_12140386 Ga0207677_121403861 119
519 3300026035 Ga0207703_10304457 Ga0207703_103044572 119
520 3300026035 Ga0207703_10404519 Ga0207703_104045192 119
521 3300026035 Ga0207703_10795798 Ga0207703_107957982 119
522 3300026041 Ga0207639_10576649 Ga0207639_105766492 119
523 3300026041 Ga0207639_10918954 Ga0207639_109189541 119
524 3300026041 Ga0207639_11990037 Ga0207639_119900371 119
525 3300026067 Ga0207678_10054197 Ga0207678_100541972 119
526 3300026067 Ga0207678_10325103 Ga0207678_103251032 119
527 3300026078 Ga0207702_10983318 Ga0207702_109833182 119
528 3300026078 Ga0207702_10984363 Ga0207702_109843631 119
529 3300026088 Ga0207641_10020162 Ga0207641_100201626 119
530 3300026088 Ga0207641_10041489 Ga0207641_100414892 119
531 3300026088 Ga0207641_11046125 Ga0207641_110461253 119
532 3300026088 Ga0207641_11328397 Ga0207641_113283972 119
533 3300026089 Ga0207648_10047106 Ga0207648_100471062 119
534 3300026089 Ga0207648_10055161 Ga0207648_100551615 119
535 3300026089 Ga0207648_10057539 Ga0207648_100575392 119
536 3300026089 Ga0207648_10181197 Ga0207648_101811972 119
537 3300026089 Ga0207648_10315820 Ga0207648_103158202 119
538 3300026089 Ga0207648_10532132 Ga0207648_105321321 119
539 3300026089 Ga0207648_11332845 Ga0207648_113328452 119
540 3300026089 Ga0207648_11436195 Ga0207648_114361951 119
541 3300026095 Ga0207676_10129917 Ga0207676_101299172 119
542 3300026095 Ga0207676_10156593 Ga0207676_101565932 119
543 3300026095 Ga0207676_10157440 Ga0207676_101574401 119
544 3300026095 Ga0207676_10729483 Ga0207676_107294831 119
545 3300026116 Ga0207674_10019713 Ga0207674_100197137 119
546 3300026116 Ga0207674_10062109 Ga0207674_100621095 119
547 3300026116 Ga0207674_10180762 Ga0207674_101807621 119
548 3300026116 Ga0207674_10909694 Ga0207674_109096942 119
549 3300026118 Ga0207675_100010610 Ga0207675_1000106106 119
550 3300026118 Ga0207675_100034120 Ga0207675_1000341202 119
551 3300026118 Ga0207675_100270961 Ga0207675_1002709612 119
552 3300026118 Ga0207675_100363355 Ga0207675_1003633552 119
553 3300026118 Ga0207675_100632873 Ga0207675_1006328732 119
554 3300026118 Ga0207675_101079257 Ga0207675_1010792571 119
555 3300026118 Ga0207675_101653731 Ga0207675_1016537311 119
556 3300026118 Ga0207675_102247055 Ga0207675_1022470552 119
557 3300026121 Ga0207683_10991110 Ga0207683_109911102 119
558 3300026121 Ga0207683_11012352 Ga0207683_110123522 119
559 3300026142 Ga0207698_10372018 Ga0207698_103720182 119
560 3300026142 Ga0207698_10674453 Ga0207698_106744532 119
561 3300026142 Ga0207698_10971600 Ga0207698_109716001 119
562 3300026142 Ga0207698_11074522 Ga0207698_110745222 119
563 3300026142 Ga0207698_12342274 Ga0207698_123422741 119
564 3300027471 Ga0209995_1027606 Ga0209995_10276062 119
565 3300027907 Ga0207428_10672672 Ga0207428_106726721 119
566 3300027907 Ga0207428_11301296 Ga0207428_113012962 119
567 3300028379 Ga0268266_10277028 Ga0268266_102770282 119
568 3300028379 Ga0268266_10468923 Ga0268266_104689232 119
569 3300028380 Ga0268265_10234832 Ga0268265_102348323 119
570 3300028380 Ga0268265_10291949 Ga0268265_102919492 119
571 3300028380 Ga0268265_11009699 Ga0268265_110096992 119
572 3300028380 Ga0268265_11232908 Ga0268265_112329082 119
573 3300028380 Ga0268265_11847226 Ga0268265_118472261 119
574 3300028381 Ga0268264_10005626 Ga0268264_100056268 119
575 3300028381 Ga0268264_10042733 Ga0268264_100427332 119
576 3300028381 Ga0268264_10077236 Ga0268264_100772362 119
577 3300028381 Ga0268264_10156577 Ga0268264_101565773 119
578 3300028381 Ga0268264_11074970 Ga0268264_110749701 119
579 3300028381 Ga0268264_11170489 Ga0268264_111704891 119
580 3300028381 Ga0268264_11616869 Ga0268264_116168691 119
581 3300028794 Ga0307515_10000380 Ga0307515_10000380106 119
582 3300028794 Ga0307515_10006611 Ga0307515_100066118 119
583 3300031507 Ga0307509_10487751 Ga0307509_104877512 119
584 3300031548 Ga0307408_100020641 Ga0307408_1000206413 119
585 3300031727 Ga0316576_10263168 Ga0316576_102631682 119
586 3300031824 Ga0307413_10598496 Ga0307413_105984962 119
587 3300031852 Ga0307410_10000071 Ga0307410_1000007120 119
588 3300031901 Ga0307406_10000037 Ga0307406_1000003735 119
589 3300031903 Ga0307407_10006810 Ga0307407_100068103 119
590 3300031995 Ga0307409_102310819 Ga0307409_1023108191 119
591 3300032002 Ga0307416_102686002 Ga0307416_1026860022 119
592 3300032004 Ga0307414_10000012 Ga0307414_1000001210 119
593 3300032004 Ga0307414_10874760 Ga0307414_108747601 119
594 3300032005 Ga0307411_10800353 Ga0307411_108003532 119
595 3300032005 Ga0307411_11281402 Ga0307411_112814022 119
596 3300035085 Ga0373929_0044557 Ga0373929_0044557_234_596 119
597 3300035086 Ga0373934_0220285 Ga0373934_0220285_201_563 119
598 3300035092 Ga0373952_0029310 Ga0373952_0029310_837_1199 119
599 3300035172 Ga0373955_0325662 Ga0373955_0325662_414_776 119
600 3300035398 Ga0316574_0243033 Ga0316574_0243033_420_794 119
601 3300035410 Ga0373924_0221624 Ga0373924_0221624_362_724 119
602 3300036401 Ga0373937_0067380 Ga0373937_0067380_2556_2918 119
603 3300037418 Ga0395900_1769213 Ga0395900_1769213_151_513 119
604 3300037471 Ga0395905_0179469 Ga0395905_0179469_1290_1652 119
605 3300039437 Ga0436365_0729052 Ga0436365_0729052_1421_1783 119
606 3300039437 Ga0436365_0843457 Ga0436365_0843457_255_614 119
607 3300039437 Ga0436365_0853306 Ga0436365_0853306_1070_1432 119
608 3300039437 Ga0436365_1151340 Ga0436365_1151340_65_427 119
609 3300039437 Ga0436365_1758907 Ga0436365_1758907_275_637 119
610 3300041407 Ga0439447_147320 Ga0439447_147320_68_430 119
611 3300041410 Ga0439461_0093789 Ga0439461_0093789_161_523 119
612 3300041411 Ga0439466_0022583 Ga0439466_0022583_889_1251 119
613 3300041411 Ga0439466_0152692 Ga0439466_0152692_237_599 119
614 3300041459 Ga0451800_0578341 Ga0451800_0578341_23_385 119
615 3300041460 Ga0451802_0144258 Ga0451802_0144258_62_424 119
616 3300041460 Ga0451802_0831830 Ga0451802_0831830_61_423 119
617 3300041486 Ga0451807_1994737 Ga0451807_1994737_209_571 119
618 3300041491 Ga0451833_1296905 Ga0451833_1296905_64_426 119
619 3300041496 Ga0451839_0785002 Ga0451839_0785002_403_765 119
620 3300041509 Ga0451843_0767574 Ga0451843_0767574_321_683 119
621 3300041512 Ga0451853_3843889 Ga0451853_3843889_370_732 119
622 3300041997 Ga0439431_0233793 Ga0439431_0233793_37_399 119
623 3300042004 Ga0439445_0117259 Ga0439445_0117259_276_638 119
624 3300042437 Ga0439444_0039841 Ga0439444_0039841_200_562 119
625 3300042437 Ga0439444_0200902 Ga0439444_0200902_26_388 119
626 3300042461 Ga0439460_0169504 Ga0439460_0169504_101_463 119
627 3300042876 Ga0451577_0001044 Ga0451577_0001044_19868_20236 119
628 3300042876 Ga0451577_0266645 Ga0451577_0266645_355_729 119
629 3300042876 Ga0451577_0526212 Ga0451577_0526212_509_871 119
630 3300044673 Ga0453683_0000005 Ga0453683_0000005_536614_536988 119
631 3300044673 Ga0453683_0000792 Ga0453683_0000792_10648_11025 119
632 3300044673 Ga0453683_0007079 Ga0453683_0007079_3077_3481 119
633 3300044673 Ga0453683_0009838 Ga0453683_0009838_818_1186 119
634 3300044673 Ga0453683_0135617 Ga0453683_0135617_97_471 119
635 3300044673 Ga0453683_0523355 Ga0453683_0523355_363_737 119
636 3300044673 Ga0453683_1127602 Ga0453683_1127602_106_468 119
637 3300044712 Ga0453684_0000610 Ga0453684_0000610_105362_105730 119
638 3300044712 Ga0453684_0037330 Ga0453684_0037330_292_666 119
639 3300044712 Ga0453684_0041845 Ga0453684_0041845_3606_4010 119
640 3300044712 Ga0453684_0073834 Ga0453684_0073834_562_927 119
641 3300044712 Ga0453684_0187867 Ga0453684_0187867_83_457 119
642 3300044712 Ga0453684_0261375 Ga0453684_0261375_594_998 119
643 3300044712 Ga0453684_0310964 Ga0453684_0310964_875_1249 119
644 3300044712 Ga0453684_0358626 Ga0453684_0358626_723_1097 119
645 3300044712 Ga0453684_0730654 Ga0453684_0730654_162_539 119
646 3300045051 Ga0451576_0000193 Ga0451576_0000193_48375_48743 119
647 3300045051 Ga0451576_0006040 Ga0451576_0006040_5667_6044 119
648 3300045051 Ga0451576_0006802 Ga0451576_0006802_8039_8443 119
649 3300045051 Ga0451576_0011516 Ga0451576_0011516_1567_1935 119
650 3300045051 Ga0451576_0238042 Ga0451576_0238042_1517_1882 119
651 3300045051 Ga0451576_0858618 Ga0451576_0858618_491_865 119
652 3300045051 Ga0451576_1095975 Ga0451576_1095975_131_496 119
653 3300046454 Ga0495592_0445143 Ga0495592_0445143_323_685 119
654 3300046460 Ga0495638_0027584 Ga0495638_0027584_434_796 119
655 3300046460 Ga0495638_0309182 Ga0495638_0309182_428_790 119
656 3300046507 Ga0495606_0000021 Ga0495606_0000021_130021_130383 119
657 3300046512 Ga0495610_0000279 Ga0495610_0000279_19329_19691 119
658 3300046512 Ga0495610_0001345 Ga0495610_0001345_10271_10633 119
659 3300046516 Ga0495628_0299785 Ga0495628_0299785_279_641 119
660 3300046519 Ga0495632_0296989 Ga0495632_0296989_316_678 119
661 3300046520 Ga0495637_0088822 Ga0495637_0088822_136_498 119
662 3300046522 Ga0495643_0255454 Ga0495643_0255454_214_576 119
663 3300046536 Ga0495587_0129525 Ga0495587_0129525_756_1118 119
664 3300046537 Ga0495598_0148551 Ga0495598_0148551_183_545 119
665 3300046539 Ga0495621_0304944 Ga0495621_0304944_269_631 119
666 3300046543 Ga0495645_0143842 Ga0495645_0143842_453_818 119
667 3300046558 Ga0495633_0005737 Ga0495633_0005737_2022_2384 119
668 3300046559 Ga0495667_0106133 Ga0495667_0106133_1359_1721 119
669 3300046616 Ga0495668_0000097 Ga0495668_0000097_35509_35877 119
670 3300046616 Ga0495668_0013869 Ga0495668_0013869_3198_3560 119
671 3300046665 Ga0495661_0022788 Ga0495661_0022788_181_543 119
672 3300046689 Ga0495613_0533742 Ga0495613_0533742_219_581 119
673 3300046692 Ga0495671_0314262 Ga0495671_0314262_149_511 119
674 3300047317 Ga0495604_0288924 Ga0495604_0288924_129_491 119
675 3300047319 Ga0495674_0838556 Ga0495674_0838556_129_491 119
676 3300047320 Ga0495672_0395622 Ga0495672_0395622_145_507 119
677 3300047322 Ga0495680_0259306 Ga0495680_0259306_712_1074 119
678 3300047472 Ga0495686_0000625 Ga0495686_0000625_15339_15707 119
679 3300048903 Ga0496100_0514093 Ga0496100_0514093_152_514 119
680 3300048907 Ga0496104_0943806 Ga0496104_0943806_339_701 119
681 3300048913 Ga0496110_0220839 Ga0496110_0220839_1170_1532 119
682 3300048913 Ga0496110_1696769 Ga0496110_1696769_17_379 119
683 3300048914 Ga0496111_0086257 Ga0496111_0086257_1142_1504 119
684 3300048914 Ga0496111_0180514 Ga0496111_0180514_636_998 119
685 3300048915 Ga0496112_1227484 Ga0496112_1227484_161_523 119
686 3300048915 Ga0496112_1500157 Ga0496112_1500157_40_402 119
687 3300048916 Ga0496113_0896284 Ga0496113_0896284_97_459 119
688 3300048917 Ga0496114_0062136 Ga0496114_0062136_15_377 119
689 3300048919 Ga0496116_0000032 Ga0496116_0000032_411176_411538 119
690 3300048924 Ga0496121_0233147 Ga0496121_0233147_909_1271 119
691 3300048927 Ga0496124_0299158 Ga0496124_0299158_52_414 119
692 3300048928 Ga0496125_0000111 Ga0496125_0000111_34810_35172 119
693 3300048929 Ga0496126_0004578 Ga0496126_0004578_15592_15954 119
694 3300048929 Ga0496126_0167088 Ga0496126_0167088_128_490 119
695 3300049513 Ga0501290_062370 Ga0501290_062370_27_389 119
696 3300049574 Ga0501038_0086325 Ga0501038_0086325_955_1323 119
697 3300049671 Ga0501238_000090 Ga0501238_000090_10928_11290 119
698 3300049679 Ga0501249_043346 Ga0501249_043346_343_705 119
699 3300049763 Ga0501266_016963 Ga0501266_016963_51_413 119
700 3300049776 Ga0501280_001826 Ga0501280_001826_786_1148 119
701 3300050496 nmdc:mga07m45_686929_c1 nmdc:mga07m45_686929_c1_120_482 119
702 3300050507 nmdc:mga05p37_231810_c1 nmdc:mga05p37_231810_c1_720_1082 119
703 3300050507 nmdc:mga05p37_439472_c1 nmdc:mga05p37_439472_c1_24_386 119
704 3300050507 nmdc:mga05p37_46311_c1 nmdc:mga05p37_46311_c1_4958_5320 119
705 3300050508 nmdc:mga09592_208367_c1 nmdc:mga09592_208367_c1_565_927 119
706 3300050508 nmdc:mga09592_375511_c1 nmdc:mga09592_375511_c1_721_1083 119
707 3300050509 nmdc:mga0qj67_1193098_c1 nmdc:mga0qj67_1193098_c1_89_451 119
708 3300050510 nmdc:mga06r32_1072593_c1 nmdc:mga06r32_1072593_c1_298_660 119
709 3300050510 nmdc:mga06r32_360646_c1 nmdc:mga06r32_360646_c1_530_892 119
710 3300050511 nmdc:mga08y16_1495192_c1 nmdc:mga08y16_1495192_c1_86_448 119
711 3300050511 nmdc:mga08y16_1640127_c1 nmdc:mga08y16_1640127_c1_56_418 119
712 3300050511 nmdc:mga08y16_285380_c1 nmdc:mga08y16_285380_c1_837_1199 119
713 3300050511 nmdc:mga08y16_771138_c1 nmdc:mga08y16_771138_c1_418_780 119
714 3300050511 nmdc:mga08y16_897432_c1 nmdc:mga08y16_897432_c1_92_454 119
715 3300050512 nmdc:mga0n895_179543_c1 nmdc:mga0n895_179543_c1_854_1216 119
716 3300053080 Ga0500635_0082404 Ga0500635_0082404_642_1004 119
717 3300053088 Ga0500644_0166812 Ga0500644_0166812_296_658 119
718 3300053090 Ga0500646_0136625 Ga0500646_0136625_209_571 119
719 3300053091 Ga0500647_0085727 Ga0500647_0085727_288_650 119
720 3300053092 Ga0500583_0154170 Ga0500583_0154170_564_926 119
721 3300053096 Ga0500641_0000020 Ga0500641_0000020_101294_101656 119
722 3300053130 Ga0500642_0007034 Ga0500642_0007034_1303_1674 119
723 3300053140 Ga0500573_0352650 Ga0500573_0352650_341_703 119
724 3300053151 Ga0500604_0011813 Ga0500604_0011813_1099_1461 119
725 3300053153 Ga0500616_0033668 Ga0500616_0033668_1359_1727 119
726 3300053158 Ga0500627_0002345 Ga0500627_0002345_3438_3806 119
727 3300053726 Ga0500584_040179 Ga0500584_040179_523_885 119
728 3300053727 Ga0500611_000020 Ga0500611_000020_86974_87336 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

22

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8811 2 66
3zec-assembly1.cif.gz_A fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp 0.872 13 67
1sd6-assembly1.cif.gz_B crystal structure of native meci at 2.65 a 0.8605 1 116
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8602 8 66
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.857 2 66
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9047 4 65 1.10.10.10
2xigA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8983 6 68 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8857 18 66 3.30.230.130
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8804 5 67 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8775 4 65 1.10.10.10
ID Description Score Start End GO Terms
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9788 1 74 GO:0003677
GO:0005737
GO:0045892
AF-A0A519RYD7-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9766 2 118 GO:0003677
GO:0005737
GO:0045892
AF-A0A1M5N177-F1-model_v4 Predicted transcriptional regulator 0.9736 1 118 GO:0003677
GO:0005737
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9684 1 78
AF-A0A1F3P524-F1-model_v4 Transcriptional regulator 0.9679 1 78 GO:0003677
GO:0005737
GO:0045892

Feature Viewer

pLDDT pTM Quality
93.42 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map