F477719
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 500 | 578 | 270 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10074482|JGI24739J22299_100744821 |
| Length | 240 |
| Sequence | MAATFQSSLYASRRRRNRISMGLAFAATAFGLSWLVLILAVLLWEGFSGLSLAVFTEMTPPPGSSGGLLNPIVMAEYGRYDRLTTVVRFINDILLSAPSIVVGLFVYEVMVAQMGHFSGWAGAVSLAVIVVPVVVRTTEDMLILVPDTLREAAASIGLPRSLMITXVAYRAALFTALNNQFWSLNLNAPVASLPVVIFQFALSPYHDWQKLAWTGALIITLAVLALSIIARTLAAQRKTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 2 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 3 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 4 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 5 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 6 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 7 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 8 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 9 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 10 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 11 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 12 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 13 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 14 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 15 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 16 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 17 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 18 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 19 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 20 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 21 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 22 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 23 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 24 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 25 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 26 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 27 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 28 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 29 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 30 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 31 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 32 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 33 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 34 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 35 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 36 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 37 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 38 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 39 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 40 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 41 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 42 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 43 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 44 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 45 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 46 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 47 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 48 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 49 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 50 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 51 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 52 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 53 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 54 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 55 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 56 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 57 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 58 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 59 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 60 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 61 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 62 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 63 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 64 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 65 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 66 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 67 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 68 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 69 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 70 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 71 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 72 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 73 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 74 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 75 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 76 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 77 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 78 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 79 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 80 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 81 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 82 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 83 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 84 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 85 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 86 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 87 | 2941479691 | |||
| 88 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 89 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 90 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 91 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 92 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 93 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 94 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 95 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 96 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 97 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 98 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 99 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 100 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 101 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 102 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 103 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 104 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 105 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 106 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 107 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 108 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 109 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 110 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 111 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 112 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 113 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 114 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 115 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 116 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 117 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 118 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 119 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 120 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 121 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 122 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 123 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 124 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 125 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 126 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 127 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 128 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 129 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 130 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 131 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 132 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 133 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 134 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 135 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 136 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 137 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 138 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 139 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 140 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 141 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 142 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 143 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 144 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 145 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 146 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 147 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 148 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 149 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 150 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 151 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 152 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 153 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 154 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 155 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 156 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 157 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 158 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 160 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 161 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 164 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 166 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 167 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 168 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 170 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 171 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 172 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 186 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 189 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 192 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 193 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 194 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 195 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 197 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 198 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 199 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 200 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 201 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 202 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 204 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 206 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 207 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 209 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 210 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 211 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 212 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 213 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 214 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 215 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 216 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 217 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 218 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 219 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 220 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 221 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 222 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 223 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 224 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 225 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 227 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 228 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 229 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 230 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 231 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 232 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 234 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 235 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 244 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 245 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 246 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 247 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 248 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 249 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 250 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 253 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 254 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 255 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 256 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 257 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 258 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 259 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 260 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 261 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 262 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 263 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 264 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 265 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 266 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 330 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 331 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 335 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 336 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 337 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 338 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 339 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 340 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 341 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 342 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 343 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 344 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 345 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 346 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 347 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 348 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 349 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 350 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 351 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 352 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 353 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 354 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 355 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 356 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 357 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 358 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 359 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 360 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 361 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 362 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 363 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 364 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 365 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 366 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 367 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 368 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 369 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 370 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 371 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 372 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 373 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 374 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 375 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 376 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 377 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 378 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 379 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 380 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 382 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 383 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 384 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 385 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 386 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 387 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 388 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 389 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 390 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 391 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 392 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 440 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 441 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 442 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 443 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 444 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 445 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 446 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 447 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 448 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 449 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 450 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 451 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 452 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 453 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 454 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 455 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 456 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 457 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 458 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 480 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 481 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 482 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 483 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 488 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 489 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 491 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 492 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 493 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 494 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 495 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 496 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 497 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 498 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 499 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 500 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.5 |
| Metatranscriptomes | 0 |
| Isolates | 20.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.83 |
| Nodule | 15.41 |
| Rhizoplane | 5.23 |
| Rhizosphere | 73.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARCol0yngRDRAFT_1000324 | 3300000652 | Bacteria | 7130 |
| 2 | JGI24746J21847_1000674 | 3300001977 | Bacteria | 5230 |
| 3 | JGI24739J22299_10004845 | 3300001989 | Bacteria | 5129 |
| 4 | JGI24739J22299_10074482 | 3300001989 | Bacteria | 1051 |
| 5 | JGI24737J22298_10005956 | 3300001990 | Bacteria | 4187 |
| 6 | JGI24750J21931_1002279 | 3300002070 | Bacteria | 2322 |
| 7 | JGI24748J21848_1001179 | 3300002074 | Bacteria | 2851 |
| 8 | JGI24738J21930_10001968 | 3300002075 | Bacteria | 5524 |
| 9 | JGI24749J21850_1000794 | 3300002076 | Bacteria | 4538 |
| 10 | JGI24744J21845_10001222 | 3300002077 | Bacteria | 5034 |
| 11 | JGI24035J26624_1000436 | 3300002126 | Bacteria | 3940 |
| 12 | JGI24033J26618_1002235 | 3300002155 | Bacteria | 1962 |
| 13 | JGI24034J26672_10000405 | 3300002239 | Bacteria | 5579 |
| 14 | JGI24742J22300_10000245 | 3300002244 | Bacteria | 8087 |
| 15 | JGI24751J29686_10006394 | 3300002459 | Bacteria | 2400 |
| 16 | JGI25160J50197_1010041 | 3300003354 | Bacteria | 3458 |
| 17 | JGI25404J52841_10003799 | 3300003659 | Bacteria | 3015 |
| 18 | Ga0065712_10001131 | 3300005290 | Bacteria | 11020 |
| 19 | Ga0065712_10241510 | 3300005290 | Bacteria | 983 |
| 20 | Ga0065715_10000443 | 3300005293 | Bacteria | 13431 |
| 21 | Ga0070676_10000464 | 3300005328 | Bacteria | 19426 |
| 22 | Ga0070676_10026538 | 3300005328 | Bacteria | 3280 |
| 23 | Ga0070683_100000585 | 3300005329 | Bacteria | 26003 |
| 24 | Ga0070690_100004127 | 3300005330 | Bacteria | 8043 |
| 25 | Ga0070690_100005765 | 3300005330 | Bacteria | 6979 |
| 26 | Ga0070670_100010943 | 3300005331 | Bacteria | 7750 |
| 27 | Ga0070677_10000046 | 3300005333 | Bacteria | 38785 |
| 28 | Ga0068869_100028330 | 3300005334 | Bacteria | 3913 |
| 29 | Ga0068869_100034606 | 3300005334 | Bacteria | 3575 |
| 30 | Ga0070666_10012206 | 3300005335 | Bacteria | 5413 |
| 31 | Ga0070680_100043888 | 3300005336 | Bacteria | 3632 |
| 32 | Ga0070682_100001270 | 3300005337 | Bacteria | 14321 |
| 33 | Ga0070682_100040756 | 3300005337 | Bacteria | 2859 |
| 34 | Ga0068868_100002324 | 3300005338 | Bacteria | 13150 |
| 35 | Ga0068868_100230861 | 3300005338 | Bacteria | 1552 |
| 36 | Ga0070660_100001207 | 3300005339 | Bacteria | 17536 |
| 37 | Ga0070689_100005142 | 3300005340 | Bacteria | 8898 |
| 38 | Ga0070689_100049104 | 3300005340 | Bacteria | 3257 |
| 39 | Ga0070689_100470882 | 3300005340 | Bacteria | 1072 |
| 40 | Ga0070689_100484771 | 3300005340 | Bacteria | 1057 |
| 41 | Ga0070691_10003924 | 3300005341 | Bacteria | 6729 |
| 42 | Ga0070687_100072675 | 3300005343 | Bacteria | 1852 |
| 43 | Ga0070687_100108054 | 3300005343 | Bacteria | 1570 |
| 44 | Ga0070687_100149722 | 3300005343 | Bacteria | 1368 |
| 45 | Ga0070661_100086226 | 3300005344 | Bacteria | 2321 |
| 46 | Ga0070661_100172735 | 3300005344 | Bacteria | 1642 |
| 47 | Ga0070661_100238990 | 3300005344 | Bacteria | 1398 |
| 48 | Ga0070661_100265548 | 3300005344 | Bacteria | 1328 |
| 49 | Ga0070692_10000212 | 3300005345 | Bacteria | 15753 |
| 50 | Ga0070668_100033083 | 3300005347 | Bacteria | 3935 |
| 51 | Ga0070668_100073512 | 3300005347 | Bacteria | 2665 |
| 52 | Ga0070668_100160282 | 3300005347 | Bacteria | 1825 |
| 53 | Ga0070669_100222875 | 3300005353 | Bacteria | 1491 |
| 54 | Ga0070675_100120641 | 3300005354 | Bacteria | 2227 |
| 55 | Ga0070675_100130395 | 3300005354 | Bacteria | 2142 |
| 56 | Ga0070675_100253106 | 3300005354 | Bacteria | 1542 |
| 57 | Ga0070671_100008864 | 3300005355 | Bacteria | 8071 |
| 58 | Ga0070671_100123364 | 3300005355 | Bacteria | 2181 |
| 59 | Ga0070674_100004876 | 3300005356 | Bacteria | 7689 |
| 60 | Ga0070674_100009575 | 3300005356 | Bacteria | 5804 |
| 61 | Ga0070674_100041789 | 3300005356 | Bacteria | 3110 |
| 62 | Ga0070674_100088270 | 3300005356 | Bacteria | 2231 |
| 63 | Ga0070673_100000632 | 3300005364 | Bacteria | 19293 |
| 64 | Ga0070688_100004634 | 3300005365 | Bacteria | 7178 |
| 65 | Ga0070688_100007302 | 3300005365 | Bacteria | 5952 |
| 66 | Ga0070659_100002503 | 3300005366 | Bacteria | 13048 |
| 67 | Ga0070667_100007002 | 3300005367 | Bacteria | 9373 |
| 68 | Ga0070667_100056496 | 3300005367 | Bacteria | 3316 |
| 69 | Ga0070714_100177943 | 3300005435 | Bacteria | 1934 |
| 70 | Ga0070714_100374512 | 3300005435 | Bacteria | 1341 |
| 71 | Ga0070710_10084507 | 3300005437 | Bacteria | 1860 |
| 72 | Ga0070701_10000116 | 3300005438 | Bacteria | 23157 |
| 73 | Ga0070711_100040960 | 3300005439 | Bacteria | 3126 |
| 74 | Ga0070705_100006545 | 3300005440 | Bacteria | 5718 |
| 75 | Ga0070705_100322455 | 3300005440 | Bacteria | 1116 |
| 76 | Ga0070700_100004259 | 3300005441 | Bacteria | 7469 |
| 77 | Ga0070694_100003022 | 3300005444 | Bacteria | 10020 |
| 78 | Ga0070708_100163082 | 3300005445 | Bacteria | 2078 |
| 79 | Ga0070678_100001304 | 3300005456 | Bacteria | 13226 |
| 80 | Ga0070678_100039306 | 3300005456 | Bacteria | 3336 |
| 81 | Ga0070681_10004628 | 3300005458 | Bacteria | 13135 |
| 82 | Ga0068867_100000619 | 3300005459 | Bacteria | 23562 |
| 83 | Ga0070685_10000856 | 3300005466 | Bacteria | 16575 |
| 84 | Ga0070699_100544628 | 3300005518 | Bacteria | 1056 |
| 85 | Ga0070679_100035049 | 3300005530 | Bacteria | 4977 |
| 86 | Ga0070679_100342111 | 3300005530 | Bacteria | 1444 |
| 87 | Ga0070684_100006410 | 3300005535 | Bacteria | 9104 |
| 88 | Ga0068853_100001956 | 3300005539 | Bacteria | 15182 |
| 89 | Ga0068853_100457985 | 3300005539 | Bacteria | 1200 |
| 90 | Ga0070672_100195097 | 3300005543 | Bacteria | 1692 |
| 91 | Ga0070672_100210276 | 3300005543 | Bacteria | 1629 |
| 92 | Ga0070686_100001494 | 3300005544 | Bacteria | 13151 |
| 93 | Ga0070686_100153304 | 3300005544 | Bacteria | 1616 |
| 94 | Ga0070695_100007956 | 3300005545 | Bacteria | 6278 |
| 95 | Ga0070695_100249970 | 3300005545 | Bacteria | 1290 |
| 96 | Ga0070695_100493746 | 3300005545 | Bacteria | 945 |
| 97 | Ga0070696_100000163 | 3300005546 | Bacteria | 37742 |
| 98 | Ga0070696_100016860 | 3300005546 | Bacteria | 4927 |
| 99 | Ga0070693_100001925 | 3300005547 | Bacteria | 9497 |
| 100 | Ga0070693_100107983 | 3300005547 | Bacteria | 1707 |
| 101 | Ga0070665_100266959 | 3300005548 | Bacteria | 1713 |
| 102 | Ga0070704_100000828 | 3300005549 | Bacteria | 15365 |
| 103 | Ga0070704_100010271 | 3300005549 | Bacteria | 5692 |
| 104 | Ga0070704_100347049 | 3300005549 | Bacteria | 1252 |
| 105 | Ga0068855_100004638 | 3300005563 | Bacteria | 16774 |
| 106 | Ga0068855_100058338 | 3300005563 | Bacteria | 4521 |
| 107 | Ga0070664_100003244 | 3300005564 | Bacteria | 13145 |
| 108 | Ga0070664_100098438 | 3300005564 | Bacteria | 2541 |
| 109 | Ga0070664_100114627 | 3300005564 | Bacteria | 2355 |
| 110 | Ga0070664_100153061 | 3300005564 | Bacteria | 2037 |
| 111 | Ga0068857_100004358 | 3300005577 | Bacteria | 11953 |
| 112 | Ga0068854_100007930 | 3300005578 | Bacteria | 6797 |
| 113 | Ga0068856_100023463 | 3300005614 | Bacteria | 5998 |
| 114 | Ga0070702_100106881 | 3300005615 | Bacteria | 1727 |
| 115 | Ga0068852_100005642 | 3300005616 | Bacteria | 8977 |
| 116 | Ga0068852_100329719 | 3300005616 | Bacteria | 1485 |
| 117 | Ga0068859_100011499 | 3300005617 | Bacteria | 8898 |
| 118 | Ga0068859_100113389 | 3300005617 | Bacteria | 2775 |
| 119 | Ga0068859_100240402 | 3300005617 | Bacteria | 1900 |
| 120 | Ga0068864_100000501 | 3300005618 | Bacteria | 33748 |
| 121 | Ga0068866_10226062 | 3300005718 | Bacteria | 1132 |
| 122 | Ga0068866_10227188 | 3300005718 | Bacteria | 1130 |
| 123 | Ga0068861_100001978 | 3300005719 | Bacteria | 13227 |
| 124 | Ga0068861_100074120 | 3300005719 | Bacteria | 2646 |
| 125 | Ga0068861_100152384 | 3300005719 | Bacteria | 1898 |
| 126 | Ga0068851_10112984 | 3300005834 | Bacteria | 1452 |
| 127 | Ga0068870_10000104 | 3300005840 | Bacteria | 28590 |
| 128 | Ga0068870_10201145 | 3300005840 | Bacteria | 1208 |
| 129 | Ga0068863_100060167 | 3300005841 | Bacteria | 3592 |
| 130 | Ga0068863_100566106 | 3300005841 | Bacteria | 1123 |
| 131 | Ga0068860_100007083 | 3300005843 | Bacteria | 11216 |
| 132 | Ga0068860_100062955 | 3300005843 | Bacteria | 3525 |
| 133 | Ga0068862_100002741 | 3300005844 | Bacteria | 15462 |
| 134 | Ga0068862_100053868 | 3300005844 | Bacteria | 3444 |
| 135 | Ga0081455_10000058 | 3300005937 | Bacteria | 119171 |
| 136 | Ga0081455_10046358 | 3300005937 | Bacteria | 3772 |
| 137 | Ga0081540_1000040 | 3300005983 | Bacteria | 136968 |
| 138 | Ga0081540_1001972 | 3300005983 | Bacteria | 17123 |
| 139 | Ga0070712_100242412 | 3300006175 | Bacteria | 1436 |
| 140 | Ga0097621_100000435 | 3300006237 | Bacteria | 29115 |
| 141 | Ga0097621_100004339 | 3300006237 | Bacteria | 9857 |
| 142 | Ga0075370_10047312 | 3300006353 | Bacteria | 2436 |
| 143 | Ga0068871_100000485 | 3300006358 | Bacteria | 27172 |
| 144 | Ga0068871_100021625 | 3300006358 | Bacteria | 4947 |
| 145 | Ga0075433_10009783 | 3300006852 | Bacteria | 7681 |
| 146 | Ga0075434_100015803 | 3300006871 | Bacteria | 7246 |
| 147 | Ga0075434_100017752 | 3300006871 | Bacteria | 6861 |
| 148 | Ga0075434_100127719 | 3300006871 | Bacteria | 2560 |
| 149 | Ga0068865_100020005 | 3300006881 | Bacteria | 4339 |
| 150 | Ga0075436_100042432 | 3300006914 | Bacteria | 3137 |
| 151 | Ga0075436_100135142 | 3300006914 | Bacteria | 1731 |
| 152 | Ga0097620_100011499 | 3300006931 | Bacteria | 8898 |
| 153 | Ga0097620_100113388 | 3300006931 | Bacteria | 2775 |
| 154 | Ga0097620_100240392 | 3300006931 | Bacteria | 1900 |
| 155 | Ga0075435_100075146 | 3300007076 | Bacteria | 2766 |
| 156 | Ga0099794_10002565 | 3300007265 | Bacteria | 6737 |
| 157 | Ga0105251_10063525 | 3300009011 | Bacteria | 1732 |
| 158 | Ga0105244_10086357 | 3300009036 | Bacteria | 1547 |
| 159 | Ga0105240_10118326 | 3300009093 | Bacteria | 3193 |
| 160 | Ga0111539_10002680 | 3300009094 | Bacteria | 23585 |
| 161 | Ga0105245_10004478 | 3300009098 | Bacteria | 12348 |
| 162 | Ga0105247_10038596 | 3300009101 | Bacteria | 2916 |
| 163 | Ga0114129_10345101 | 3300009147 | Bacteria | 1973 |
| 164 | Ga0105243_10007567 | 3300009148 | Bacteria | 8346 |
| 165 | Ga0105243_10077915 | 3300009148 | Bacteria | 2697 |
| 166 | Ga0105243_10087044 | 3300009148 | Bacteria | 2563 |
| 167 | Ga0105243_10386443 | 3300009148 | Bacteria | 1296 |
| 168 | Ga0105241_10000805 | 3300009174 | Bacteria | 23823 |
| 169 | Ga0105242_10006128 | 3300009176 | Bacteria | 9267 |
| 170 | Ga0105248_10002578 | 3300009177 | Bacteria | 20136 |
| 171 | Ga0105248_10031967 | 3300009177 | Bacteria | 5880 |
| 172 | Ga0105248_10080229 | 3300009177 | Bacteria | 3667 |
| 173 | Ga0105237_10164683 | 3300009545 | Bacteria | 2216 |
| 174 | Ga0105237_10366546 | 3300009545 | Bacteria | 1445 |
| 175 | Ga0105249_10004666 | 3300009553 | Bacteria | 11833 |
| 176 | Ga0105249_10017076 | 3300009553 | Bacteria | 6440 |
| 177 | Ga0105249_10151280 | 3300009553 | Bacteria | 2235 |
| 178 | Ga0105249_10742639 | 3300009553 | Bacteria | 1043 |
| 179 | Ga0099796_10009527 | 3300010159 | Bacteria | 2633 |
| 180 | Ga0105239_10031376 | 3300010375 | Bacteria | 5845 |
| 181 | Ga0105239_10176046 | 3300010375 | Bacteria | 2393 |
| 182 | Ga0105239_10481063 | 3300010375 | Bacteria | 1410 |
| 183 | Ga0105246_10001159 | 3300011119 | Bacteria | 15299 |
| 184 | Ga0105246_10049107 | 3300011119 | Bacteria | 2888 |
| 185 | Ga0157373_10054823 | 3300013100 | Bacteria | 2832 |
| 186 | Ga0157371_10011034 | 3300013102 | Bacteria | 6999 |
| 187 | Ga0157370_10052855 | 3300013104 | Bacteria | 3876 |
| 188 | Ga0157369_10027808 | 3300013105 | Bacteria | 6265 |
| 189 | Ga0157374_10025598 | 3300013296 | Bacteria | 5301 |
| 190 | Ga0157374_10074714 | 3300013296 | Bacteria | 3201 |
| 191 | Ga0157378_10077255 | 3300013297 | Bacteria | 3001 |
| 192 | Ga0163162_10022100 | 3300013306 | Bacteria | 6268 |
| 193 | Ga0163162_10310051 | 3300013306 | Bacteria | 1710 |
| 194 | Ga0157372_10032836 | 3300013307 | Bacteria | 5694 |
| 195 | Ga0157372_10168578 | 3300013307 | Bacteria | 2533 |
| 196 | Ga0157372_10401283 | 3300013307 | Bacteria | 1598 |
| 197 | Ga0157375_10008574 | 3300013308 | Bacteria | 8951 |
| 198 | Ga0157375_10056545 | 3300013308 | Bacteria | 3874 |
| 199 | Ga0163163_10009906 | 3300014325 | Bacteria | 8543 |
| 200 | Ga0163163_10132831 | 3300014325 | Bacteria | 2529 |
| 201 | Ga0157380_10001249 | 3300014326 | Bacteria | 16513 |
| 202 | Ga0157377_10017604 | 3300014745 | Bacteria | 3697 |
| 203 | Ga0157379_10051388 | 3300014968 | Bacteria | 3682 |
| 204 | Ga0157379_10079841 | 3300014968 | Bacteria | 2930 |
| 205 | Ga0157379_10284326 | 3300014968 | Bacteria | 1505 |
| 206 | Ga0157376_10000696 | 3300014969 | Bacteria | 21738 |
| 207 | Ga0163161_10005280 | 3300017792 | Bacteria | 8992 |
| 208 | Ga0163161_10102547 | 3300017792 | Bacteria | 2131 |
| 209 | Ga0163161_10128666 | 3300017792 | Bacteria | 1908 |
| 210 | Ga0207666_1000085 | 3300025271 | Bacteria | 15395 |
| 211 | Ga0207426_1001988 | 3300025302 | Bacteria | 14453 |
| 212 | Ga0207697_10002998 | 3300025315 | Bacteria | 8507 |
| 213 | Ga0207682_10003689 | 3300025893 | Bacteria | 6596 |
| 214 | Ga0207692_10027566 | 3300025898 | Bacteria | 2678 |
| 215 | Ga0207642_10021746 | 3300025899 | Bacteria | 2531 |
| 216 | Ga0207710_10002518 | 3300025900 | Bacteria | 8472 |
| 217 | Ga0207688_10000088 | 3300025901 | Bacteria | 35438 |
| 218 | Ga0207680_10126448 | 3300025903 | Bacteria | 1679 |
| 219 | Ga0207680_10152854 | 3300025903 | Bacteria | 1540 |
| 220 | Ga0207647_10011501 | 3300025904 | Bacteria | 6205 |
| 221 | Ga0207699_10036268 | 3300025906 | Bacteria | 2810 |
| 222 | Ga0207645_10000668 | 3300025907 | Bacteria | 28444 |
| 223 | Ga0207643_10000085 | 3300025908 | Bacteria | 61372 |
| 224 | Ga0207654_10000373 | 3300025911 | Bacteria | 26098 |
| 225 | Ga0207707_10300669 | 3300025912 | Bacteria | 1388 |
| 226 | Ga0207695_10198206 | 3300025913 | Bacteria | 1923 |
| 227 | Ga0207693_10294937 | 3300025915 | Bacteria | 1270 |
| 228 | Ga0207663_10010118 | 3300025916 | Bacteria | 5005 |
| 229 | Ga0207663_10097006 | 3300025916 | Bacteria | 1970 |
| 230 | Ga0207663_10220766 | 3300025916 | Bacteria | 1379 |
| 231 | Ga0207660_10000370 | 3300025917 | Bacteria | 29368 |
| 232 | Ga0207662_10003085 | 3300025918 | Bacteria | 8502 |
| 233 | Ga0207662_10130480 | 3300025918 | Bacteria | 1584 |
| 234 | Ga0207657_10011290 | 3300025919 | Bacteria | 8871 |
| 235 | Ga0207657_10026202 | 3300025919 | Bacteria | 5362 |
| 236 | Ga0207652_10287797 | 3300025921 | Bacteria | 1483 |
| 237 | Ga0207681_10023297 | 3300025923 | Bacteria | 3958 |
| 238 | Ga0207681_10027141 | 3300025923 | Bacteria | 3700 |
| 239 | Ga0207650_10004412 | 3300025925 | Bacteria | 9614 |
| 240 | Ga0207659_10000200 | 3300025926 | Bacteria | 35764 |
| 241 | Ga0207687_10012599 | 3300025927 | Bacteria | 5524 |
| 242 | Ga0207687_10102604 | 3300025927 | Bacteria | 2108 |
| 243 | Ga0207664_10333367 | 3300025929 | Bacteria | 1340 |
| 244 | Ga0207664_10371216 | 3300025929 | Bacteria | 1269 |
| 245 | Ga0207664_10459886 | 3300025929 | Bacteria | 1136 |
| 246 | Ga0207690_10007237 | 3300025932 | Bacteria | 6590 |
| 247 | Ga0207706_10010392 | 3300025933 | Bacteria | 8502 |
| 248 | Ga0207706_10044539 | 3300025933 | Bacteria | 3933 |
| 249 | Ga0207706_10056312 | 3300025933 | Bacteria | 3467 |
| 250 | Ga0207686_10000682 | 3300025934 | Bacteria | 21032 |
| 251 | Ga0207709_10088812 | 3300025935 | Bacteria | 2013 |
| 252 | Ga0207709_10089042 | 3300025935 | Bacteria | 2011 |
| 253 | Ga0207709_10124416 | 3300025935 | Bacteria | 1747 |
| 254 | Ga0207670_10003994 | 3300025936 | Bacteria | 7878 |
| 255 | Ga0207670_10061073 | 3300025936 | Bacteria | 2570 |
| 256 | Ga0207670_10143676 | 3300025936 | Bacteria | 1762 |
| 257 | Ga0207669_10000129 | 3300025937 | Bacteria | 37620 |
| 258 | Ga0207669_10005810 | 3300025937 | Bacteria | 5579 |
| 259 | Ga0207669_10087242 | 3300025937 | Bacteria | 2020 |
| 260 | Ga0207669_10128558 | 3300025937 | Bacteria | 1736 |
| 261 | Ga0207704_10000366 | 3300025938 | Bacteria | 20998 |
| 262 | Ga0207691_10006943 | 3300025940 | Bacteria | 10919 |
| 263 | Ga0207691_10187670 | 3300025940 | Bacteria | 1804 |
| 264 | Ga0207711_10002466 | 3300025941 | Bacteria | 16510 |
| 265 | Ga0207689_10000547 | 3300025942 | Bacteria | 35807 |
| 266 | Ga0207661_10000373 | 3300025944 | Bacteria | 28733 |
| 267 | Ga0207679_10000558 | 3300025945 | Bacteria | 25037 |
| 268 | Ga0207679_10090067 | 3300025945 | Bacteria | 2370 |
| 269 | Ga0207679_10121096 | 3300025945 | Bacteria | 2083 |
| 270 | Ga0207667_10064488 | 3300025949 | Bacteria | 3824 |
| 271 | Ga0207667_10129733 | 3300025949 | Bacteria | 2596 |
| 272 | Ga0207651_10000709 | 3300025960 | Bacteria | 14279 |
| 273 | Ga0207712_10026229 | 3300025961 | Bacteria | 3880 |
| 274 | Ga0207668_10008583 | 3300025972 | Bacteria | 6097 |
| 275 | Ga0207640_10011452 | 3300025981 | Bacteria | 5025 |
| 276 | Ga0207658_10021810 | 3300025986 | Bacteria | 4451 |
| 277 | Ga0207658_10050537 | 3300025986 | Bacteria | 3060 |
| 278 | Ga0207658_10319098 | 3300025986 | Bacteria | 1344 |
| 279 | Ga0207677_10004798 | 3300026023 | Bacteria | 7296 |
| 280 | Ga0207703_10056580 | 3300026035 | Bacteria | 3195 |
| 281 | Ga0207639_10016724 | 3300026041 | Bacteria | 5196 |
| 282 | Ga0207678_10005937 | 3300026067 | Bacteria | 10876 |
| 283 | Ga0207708_10008554 | 3300026075 | Bacteria | 7572 |
| 284 | Ga0207702_10174283 | 3300026078 | Bacteria | 1975 |
| 285 | Ga0207702_10239932 | 3300026078 | Bacteria | 1698 |
| 286 | Ga0207641_10019914 | 3300026088 | Bacteria | 5507 |
| 287 | Ga0207641_10187632 | 3300026088 | Bacteria | 1898 |
| 288 | Ga0207648_10006768 | 3300026089 | Bacteria | 11365 |
| 289 | Ga0207648_10110694 | 3300026089 | Bacteria | 2411 |
| 290 | Ga0207676_10017594 | 3300026095 | Bacteria | 5182 |
| 291 | Ga0207674_10005267 | 3300026116 | Bacteria | 15394 |
| 292 | Ga0207675_100011076 | 3300026118 | Bacteria | 8448 |
| 293 | Ga0207675_100016474 | 3300026118 | Bacteria | 6903 |
| 294 | Ga0207675_100193673 | 3300026118 | Bacteria | 1950 |
| 295 | Ga0207683_10001220 | 3300026121 | Bacteria | 23334 |
| 296 | Ga0207683_10047329 | 3300026121 | Bacteria | 3766 |
| 297 | Ga0207683_10050477 | 3300026121 | Bacteria | 3644 |
| 298 | Ga0207698_10218209 | 3300026142 | Bacteria | 1721 |
| 299 | Ga0210002_1001426 | 3300027617 | Bacteria | 3365 |
| 300 | Ga0209588_1022691 | 3300027671 | Bacteria | 1975 |
| 301 | Ga0209971_1014606 | 3300027682 | Bacteria | 1861 |
| 302 | Ga0209998_10005638 | 3300027717 | Bacteria | 2613 |
| 303 | Ga0209974_10003102 | 3300027876 | Bacteria | 6014 |
| 304 | Ga0207428_10000896 | 3300027907 | Bacteria | 33348 |
| 305 | Ga0265356_1000342 | 3300028017 | Bacteria | 8549 |
| 306 | Ga0268266_10284316 | 3300028379 | Bacteria | 1539 |
| 307 | Ga0268265_10036599 | 3300028380 | Bacteria | 3596 |
| 308 | Ga0268265_10394579 | 3300028380 | Bacteria | 1277 |
| 309 | Ga0268264_10001202 | 3300028381 | Bacteria | 24970 |
| 310 | Ga0268264_10451050 | 3300028381 | Bacteria | 1246 |
| 311 | Ga0265318_10008960 | 3300028577 | Bacteria | 4429 |
| 312 | Ga0265338_10012346 | 3300028800 | Bacteria | 9741 |
| 313 | Ga0265338_10051978 | 3300028800 | Bacteria | 3683 |
| 314 | Ga0265332_10000302 | 3300031238 | Bacteria | 38680 |
| 315 | Ga0265320_10009572 | 3300031240 | Bacteria | 5837 |
| 316 | Ga0265325_10025211 | 3300031241 | Bacteria | 3230 |
| 317 | Ga0265325_10070566 | 3300031241 | Bacteria | 1755 |
| 318 | Ga0265329_10004247 | 3300031242 | Bacteria | 6017 |
| 319 | Ga0265329_10004407 | 3300031242 | Bacteria | 5864 |
| 320 | Ga0265340_10010544 | 3300031247 | Bacteria | 4941 |
| 321 | Ga0265340_10027558 | 3300031247 | Bacteria | 2863 |
| 322 | Ga0265339_10003035 | 3300031249 | Bacteria | 11826 |
| 323 | Ga0265339_10007030 | 3300031249 | Bacteria | 7306 |
| 324 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 325 | Ga0265331_10048154 | 3300031250 | Bacteria | 2050 |
| 326 | Ga0265331_10093620 | 3300031250 | Bacteria | 1387 |
| 327 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 328 | Ga0265316_10016415 | 3300031344 | Bacteria | 6423 |
| 329 | Ga0265316_10078651 | 3300031344 | Bacteria | 2531 |
| 330 | Ga0307509_10170214 | 3300031507 | Bacteria | 2059 |
| 331 | Ga0265313_10015432 | 3300031595 | Bacteria | 4447 |
| 332 | Ga0265313_10017884 | 3300031595 | Bacteria | 4004 |
| 333 | Ga0265313_10074718 | 3300031595 | Bacteria | 1553 |
| 334 | Ga0316575_10004946 | 3300031665 | Bacteria | 4712 |
| 335 | Ga0265314_10047002 | 3300031711 | Bacteria | 3041 |
| 336 | Ga0265314_10084052 | 3300031711 | Bacteria | 2090 |
| 337 | Ga0265314_10235500 | 3300031711 | Bacteria | 1059 |
| 338 | Ga0265342_10000238 | 3300031712 | Bacteria | 61599 |
| 339 | Ga0265342_10012970 | 3300031712 | Bacteria | 5618 |
| 340 | Ga0265342_10017724 | 3300031712 | Bacteria | 4625 |
| 341 | Ga0265342_10130998 | 3300031712 | Bacteria | 1405 |
| 342 | Ga0307516_10000209 | 3300031730 | Bacteria | 75193 |
| 343 | Ga0307518_10165693 | 3300031838 | Bacteria | 1513 |
| 344 | Ga0316583_10000114 | 3300032133 | Bacteria | 18718 |
| 345 | Ga0373948_0000864 | 3300034817 | Bacteria | 4037 |
| 346 | Ga0373938_0000788 | 3300034957 | Bacteria | 5154 |
| 347 | Ga0373928_0002179 | 3300035084 | Bacteria | 3818 |
| 348 | Ga0373929_0008281 | 3300035085 | Bacteria | 1914 |
| 349 | Ga0373949_0002890 | 3300035090 | Bacteria | 4241 |
| 350 | Ga0373951_0004633 | 3300035091 | Bacteria | 3252 |
| 351 | Ga0373952_0002634 | 3300035092 | Bacteria | 3236 |
| 352 | Ga0373923_0012857 | 3300035111 | Bacteria | 3107 |
| 353 | Ga0373932_0000963 | 3300035112 | Bacteria | 8409 |
| 354 | Ga0373936_0000312 | 3300035113 | Bacteria | 16371 |
| 355 | Ga0373939_0000862 | 3300035114 | Bacteria | 7514 |
| 356 | Ga0373939_0001546 | 3300035114 | Bacteria | 5585 |
| 357 | Ga0373939_0065862 | 3300035114 | Bacteria | 1167 |
| 358 | Ga0373941_0011994 | 3300035115 | Bacteria | 2254 |
| 359 | Ga0373945_0123738 | 3300035116 | Bacteria | 1030 |
| 360 | Ga0373953_0013356 | 3300035117 | Bacteria | 2932 |
| 361 | Ga0373956_0005026 | 3300035119 | Bacteria | 5299 |
| 362 | Ga0373960_0027787 | 3300035121 | Bacteria | 1556 |
| 363 | Ga0373955_0000333 | 3300035172 | Bacteria | 19680 |
| 364 | Ga0373955_0002441 | 3300035172 | Bacteria | 8114 |
| 365 | Ga0373961_0005311 | 3300035241 | Bacteria | 3097 |
| 366 | Ga0373961_0005859 | 3300035241 | Bacteria | 2952 |
| 367 | Ga0373961_0046193 | 3300035241 | Bacteria | 1276 |
| 368 | Ga0373962_0007887 | 3300035242 | Bacteria | 2612 |
| 369 | Ga0316574_0159931 | 3300035398 | Bacteria | 1451 |
| 370 | Ga0373924_0002927 | 3300035410 | Bacteria | 5793 |
| 371 | Ga0373931_0011811 | 3300035691 | Bacteria | 4222 |
| 372 | Ga0373931_0013241 | 3300035691 | Bacteria | 4013 |
| 373 | Ga0373931_0279804 | 3300035691 | Bacteria | 1024 |
| 374 | Ga0373935_0000097 | 3300035692 | Bacteria | 38808 |
| 375 | Ga0373935_0051714 | 3300035692 | Bacteria | 2610 |
| 376 | Ga0373935_0346383 | 3300035692 | Bacteria | 1058 |
| 377 | Ga0373927_0010654 | 3300035695 | Bacteria | 6124 |
| 378 | Ga0373927_0068912 | 3300035695 | Bacteria | 2289 |
| 379 | Ga0373933_0002203 | 3300035724 | Bacteria | 11133 |
| 380 | Ga0373933_0006916 | 3300035724 | Bacteria | 6182 |
| 381 | Ga0373947_0000353 | 3300035725 | Bacteria | 26005 |
| 382 | Ga0373937_0000006 | 3300036401 | Bacteria | 194781 |
| 383 | Ga0373937_0004370 | 3300036401 | Bacteria | 12001 |
| 384 | Ga0373937_0452430 | 3300036401 | Bacteria | 1219 |
| 385 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 386 | Ga0373925_0065367 | 3300037068 | Bacteria | 2740 |
| 387 | Ga0395900_0001933 | 3300037418 | Bacteria | 23481 |
| 388 | Ga0395900_0029316 | 3300037418 | Bacteria | 5646 |
| 389 | Ga0395900_0068502 | 3300037418 | Bacteria | 3647 |
| 390 | Ga0395898_0006080 | 3300037466 | Bacteria | 12949 |
| 391 | Ga0395898_0050924 | 3300037466 | Bacteria | 4051 |
| 392 | Ga0395898_0098801 | 3300037466 | Bacteria | 2803 |
| 393 | Ga0395898_0190897 | 3300037466 | Bacteria | 1957 |
| 394 | Ga0395898_0689614 | 3300037466 | Bacteria | 963 |
| 395 | Ga0436364_0106318 | 3300037853 | Bacteria | 6422 |
| 396 | Ga0395901_0006367 | 3300038443 | Bacteria | 11963 |
| 397 | Ga0395901_0019526 | 3300038443 | Bacteria | 6927 |
| 398 | Ga0395901_0868174 | 3300038443 | Bacteria | 886 |
| 399 | Ga0436365_0204082 | 3300039437 | Bacteria | 1305 |
| 400 | Ga0436360_0293200 | 3300039438 | Bacteria | 1400 |
| 401 | Ga0436361_0570470 | 3300039447 | Bacteria | 2231 |
| 402 | Ga0451577_0664849 | 3300042876 | Bacteria | 944 |
| 403 | Ga0466963_0005297 | 3300044694 | Bacteria | 7538 |
| 404 | Ga0451576_0000247 | 3300045051 | Bacteria | 132668 |
| 405 | Ga0466967_0002811 | 3300045976 | Bacteria | 11040 |
| 406 | Ga0466967_0134632 | 3300045976 | Bacteria | 2297 |
| 407 | Ga0495592_0000039 | 3300046454 | Bacteria | 124471 |
| 408 | Ga0495592_0001529 | 3300046454 | Bacteria | 16130 |
| 409 | Ga0495603_0177500 | 3300046455 | Bacteria | 1233 |
| 410 | Ga0495651_0000376 | 3300046462 | Bacteria | 34540 |
| 411 | Ga0495651_0006087 | 3300046462 | Bacteria | 9213 |
| 412 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 413 | Ga0495653_0004466 | 3300046463 | Bacteria | 11299 |
| 414 | Ga0495605_0011168 | 3300046474 | Bacteria | 5017 |
| 415 | Ga0495605_0079102 | 3300046474 | Bacteria | 1540 |
| 416 | Ga0495662_0002816 | 3300046476 | Bacteria | 8801 |
| 417 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 418 | Ga0495664_0023178 | 3300046477 | Bacteria | 3601 |
| 419 | Ga0495584_0022014 | 3300046491 | Bacteria | 3236 |
| 420 | Ga0495583_0103628 | 3300046506 | Bacteria | 1212 |
| 421 | Ga0495606_0008491 | 3300046507 | Bacteria | 8912 |
| 422 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 423 | Ga0495608_0000910 | 3300046511 | Bacteria | 20753 |
| 424 | Ga0495618_0000027 | 3300046514 | Bacteria | 112522 |
| 425 | Ga0495618_0007318 | 3300046514 | Bacteria | 6679 |
| 426 | Ga0495618_0135135 | 3300046514 | Bacteria | 1578 |
| 427 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 428 | Ga0495628_0005038 | 3300046516 | Bacteria | 11611 |
| 429 | Ga0495630_0000950 | 3300046517 | Bacteria | 20249 |
| 430 | Ga0495648_0032023 | 3300046524 | Bacteria | 3456 |
| 431 | Ga0495666_0102814 | 3300046526 | Bacteria | 1346 |
| 432 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 433 | Ga0495652_0007044 | 3300046529 | Bacteria | 10390 |
| 434 | Ga0495665_0037244 | 3300046531 | Bacteria | 2597 |
| 435 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 436 | Ga0495640_0019009 | 3300046533 | Bacteria | 5080 |
| 437 | Ga0495640_0141888 | 3300046533 | Bacteria | 1548 |
| 438 | Ga0495640_0215047 | 3300046533 | Bacteria | 1214 |
| 439 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 440 | Ga0495587_0005121 | 3300046536 | Bacteria | 8567 |
| 441 | Ga0495587_0084851 | 3300046536 | Bacteria | 1834 |
| 442 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 443 | Ga0495645_0095777 | 3300046543 | Bacteria | 2116 |
| 444 | Ga0495622_0164736 | 3300046557 | Bacteria | 999 |
| 445 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 446 | Ga0495667_0010461 | 3300046559 | Bacteria | 6276 |
| 447 | Ga0495634_0000022 | 3300046642 | Bacteria | 118988 |
| 448 | Ga0495625_0179835 | 3300046660 | Bacteria | 1407 |
| 449 | Ga0495635_0000022 | 3300046663 | Bacteria | 160907 |
| 450 | Ga0495635_0001031 | 3300046663 | Bacteria | 18442 |
| 451 | Ga0495588_0053247 | 3300046674 | Bacteria | 2087 |
| 452 | Ga0495657_0000072 | 3300046675 | Bacteria | 91747 |
| 453 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 454 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 455 | Ga0495623_0004889 | 3300046679 | Bacteria | 8786 |
| 456 | Ga0495646_0000014 | 3300046680 | Bacteria | 143781 |
| 457 | Ga0495646_0001814 | 3300046680 | Bacteria | 12814 |
| 458 | Ga0495647_0145225 | 3300046681 | Bacteria | 1014 |
| 459 | Ga0495658_0261294 | 3300046683 | Bacteria | 1090 |
| 460 | Ga0495669_0078650 | 3300046684 | Bacteria | 1511 |
| 461 | Ga0495613_0007082 | 3300046689 | Bacteria | 8349 |
| 462 | Ga0495613_0059897 | 3300046689 | Bacteria | 2789 |
| 463 | Ga0495624_0055473 | 3300046690 | Bacteria | 2496 |
| 464 | Ga0495649_0003847 | 3300046694 | Bacteria | 9942 |
| 465 | Ga0495600_0000006 | 3300046809 | Bacteria | 151916 |
| 466 | Ga0495600_0003474 | 3300046809 | Bacteria | 9268 |
| 467 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 468 | Ga0495604_0002346 | 3300047317 | Bacteria | 15172 |
| 469 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 470 | Ga0495680_0002479 | 3300047322 | Bacteria | 18871 |
| 471 | Ga0495680_0004228 | 3300047322 | Bacteria | 13784 |
| 472 | Ga0495683_0151633 | 3300047323 | Bacteria | 1078 |
| 473 | Ga0495675_0000010 | 3300047444 | Bacteria | 153375 |
| 474 | Ga0495675_0001356 | 3300047444 | Bacteria | 14820 |
| 475 | Ga0495685_054157 | 3300047447 | Bacteria | 1358 |
| 476 | Ga0495684_0000028 | 3300047471 | Bacteria | 123549 |
| 477 | Ga0495684_0026180 | 3300047471 | Bacteria | 4481 |
| 478 | Ga0495593_0001828 | 3300047673 | Bacteria | 12660 |
| 479 | Ga0495593_0038416 | 3300047673 | Bacteria | 2586 |
| 480 | Ga0495602_0000054 | 3300048088 | Bacteria | 111411 |
| 481 | Ga0495602_0106413 | 3300048088 | Bacteria | 2290 |
| 482 | Ga0496100_0019839 | 3300048903 | Bacteria | 4020 |
| 483 | Ga0496101_0012308 | 3300048904 | Bacteria | 5705 |
| 484 | Ga0496101_0014887 | 3300048904 | Bacteria | 5234 |
| 485 | Ga0496102_0367253 | 3300048905 | Bacteria | 1354 |
| 486 | Ga0496103_0173437 | 3300048906 | Bacteria | 1385 |
| 487 | Ga0496104_0011140 | 3300048907 | Bacteria | 8046 |
| 488 | Ga0496104_0020522 | 3300048907 | Bacteria | 6057 |
| 489 | Ga0496104_0143355 | 3300048907 | Bacteria | 2295 |
| 490 | Ga0496105_0009320 | 3300048908 | Bacteria | 7674 |
| 491 | Ga0496106_0009382 | 3300048909 | Bacteria | 7231 |
| 492 | Ga0496106_0167436 | 3300048909 | Bacteria | 1740 |
| 493 | Ga0496106_0317803 | 3300048909 | Bacteria | 1250 |
| 494 | Ga0496107_0007600 | 3300048910 | Bacteria | 7480 |
| 495 | Ga0496107_0196162 | 3300048910 | Bacteria | 1500 |
| 496 | Ga0496107_0198403 | 3300048910 | Bacteria | 1491 |
| 497 | Ga0496108_0001956 | 3300048911 | Bacteria | 16502 |
| 498 | Ga0496108_0033980 | 3300048911 | Bacteria | 4235 |
| 499 | Ga0496108_0613553 | 3300048911 | Bacteria | 947 |
| 500 | Ga0496109_0003867 | 3300048912 | Bacteria | 12504 |
| 501 | Ga0496109_0016699 | 3300048912 | Bacteria | 6422 |
| 502 | Ga0496109_0065297 | 3300048912 | Bacteria | 3331 |
| 503 | Ga0496109_0625009 | 3300048912 | Bacteria | 1014 |
| 504 | Ga0496110_0020613 | 3300048913 | Bacteria | 5569 |
| 505 | Ga0496111_0009164 | 3300048914 | Bacteria | 6589 |
| 506 | Ga0496112_0011458 | 3300048915 | Bacteria | 8098 |
| 507 | Ga0496112_0012548 | 3300048915 | Bacteria | 7785 |
| 508 | Ga0496112_0088275 | 3300048915 | Bacteria | 3069 |
| 509 | Ga0496112_0439065 | 3300048915 | Bacteria | 1243 |
| 510 | Ga0496113_0000507 | 3300048916 | Bacteria | 19242 |
| 511 | Ga0496113_0098034 | 3300048916 | Bacteria | 2269 |
| 512 | Ga0496113_0353569 | 3300048916 | Bacteria | 1179 |
| 513 | Ga0496114_0062257 | 3300048917 | Bacteria | 3123 |
| 514 | Ga0496114_0228852 | 3300048917 | Bacteria | 1633 |
| 515 | Ga0496114_0391407 | 3300048917 | Bacteria | 1231 |
| 516 | Ga0496114_0531729 | 3300048917 | Bacteria | 1039 |
| 517 | Ga0496115_0022877 | 3300048918 | Bacteria | 4848 |
| 518 | Ga0496115_0183050 | 3300048918 | Bacteria | 1731 |
| 519 | Ga0496121_0084892 | 3300048924 | Bacteria | 2494 |
| 520 | Ga0496125_0230035 | 3300048928 | Bacteria | 1186 |
| 521 | Ga0501032_0017557 | 3300049569 | Bacteria | 5022 |
| 522 | Ga0501033_0006409 | 3300049570 | Bacteria | 9215 |
| 523 | Ga0501034_0002129 | 3300049571 | Bacteria | 24602 |
| 524 | Ga0501037_0005851 | 3300049573 | Bacteria | 8981 |
| 525 | Ga0501037_0200460 | 3300049573 | Bacteria | 1411 |
| 526 | Ga0501038_0000878 | 3300049574 | Bacteria | 26652 |
| 527 | Ga0501038_0009352 | 3300049574 | Bacteria | 8991 |
| 528 | Ga0501039_0023153 | 3300049575 | Bacteria | 4766 |
| 529 | Ga0501043_0010496 | 3300049579 | Bacteria | 7254 |
| 530 | Ga0501046_0001587 | 3300049580 | Bacteria | 21740 |
| 531 | Ga0501047_0004529 | 3300049581 | Bacteria | 13064 |
| 532 | Ga0501047_0030359 | 3300049581 | Bacteria | 5211 |
| 533 | Ga0501047_0687704 | 3300049581 | Bacteria | 841 |
| 534 | Ga0501048_0015440 | 3300049582 | Bacteria | 5641 |
| 535 | Ga0501068_0021181 | 3300049584 | Bacteria | 3795 |
| 536 | Ga0501069_0001129 | 3300049585 | Bacteria | 12885 |
| 537 | Ga0501069_0193553 | 3300049585 | Bacteria | 1177 |
| 538 | Ga0501070_0005624 | 3300049586 | Bacteria | 10688 |
| 539 | Ga0501070_0046333 | 3300049586 | Bacteria | 3616 |
| 540 | Ga0501073_0000996 | 3300049589 | Bacteria | 20447 |
| 541 | Ga0501073_0065041 | 3300049589 | Bacteria | 2543 |
| 542 | Ga0501073_0131458 | 3300049589 | Bacteria | 1735 |
| 543 | Ga0501074_0001724 | 3300049590 | Bacteria | 14933 |
| 544 | Ga0501074_0244139 | 3300049590 | Bacteria | 1277 |
| 545 | Ga0501077_0123740 | 3300049593 | Bacteria | 1639 |
| 546 | Ga0501077_0206841 | 3300049593 | Bacteria | 1247 |
| 547 | Ga0501080_0006117 | 3300049742 | Bacteria | 10790 |
| 548 | Ga0501081_0383896 | 3300049743 | Bacteria | 1038 |
| 549 | Ga0501083_0019158 | 3300049744 | Bacteria | 4766 |
| 550 | Ga0501083_0031714 | 3300049744 | Bacteria | 3627 |
| 551 | Ga0501035_0000484 | 3300049822 | Bacteria | 44772 |
| 552 | Ga0501035_0002346 | 3300049822 | Bacteria | 18647 |
| 553 | Ga0501044_0607218 | 3300049823 | Bacteria | 987 |
| 554 | Ga0501045_0089567 | 3300049824 | Bacteria | 2273 |
| 555 | nmdc:mga08y16_81856_c1 | 3300050511 | Bacteria | 3366 |
| 556 | nmdc:mga0n895_176560_c1 | 3300050512 | Bacteria | 2167 |
| 557 | nmdc:mga0n895_26501_c1 | 3300050512 | Bacteria | 5491 |
| 558 | nmdc:mga0rr50_114052_c1 | 3300050513 | Bacteria | 2142 |
| 559 | nmdc:mga0rr50_45633_c1 | 3300050513 | Bacteria | 3222 |
| 560 | nmdc:mga08x19_134673_c1 | 3300050514 | Bacteria | 1665 |
| 561 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 562 | Ga0495601_0008398 | 3300053077 | Bacteria | 6099 |
| 563 | Ga0495601_0046672 | 3300053077 | Bacteria | 2726 |
| 564 | Ga0495601_0277664 | 3300053077 | Bacteria | 1092 |
| 565 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 566 | Ga0495612_0004077 | 3300053078 | Bacteria | 6053 |
| 567 | Ga0495595_0000008 | 3300053084 | Bacteria | 196206 |
| 568 | Ga0495595_0005255 | 3300053084 | Bacteria | 5230 |
| 569 | Ga0495595_0122066 | 3300053084 | Bacteria | 1269 |
| 570 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 571 | Ga0495619_0002154 | 3300053085 | Bacteria | 13053 |
| 572 | Ga0500600_0006015 | 3300053149 | Bacteria | 7206 |
| 573 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 574 | Ga0500616_0017264 | 3300053153 | Bacteria | 4098 |
| 575 | Ga0501084_0002039 | 3300054114 | Bacteria | 16134 |
| 576 | Ga0501082_0001669 | 3300060353 | Bacteria | 19564 |
| 577 | Ga0501082_0077847 | 3300060353 | Bacteria | 2859 |
| 578 | Ga0530510_0279492 | 3300061734 | Bacteria | 1247 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0689614 | Ga0395898_0689614_201_947 | 198 |
| 2 | 3300050513 | nmdc:mga0rr50_45633_c1 | nmdc:mga0rr50_45633_c1_444_1274 | 204 |
| 3 | 3300048916 | Ga0496113_0353569 | Ga0496113_0353569_54_893 | 206 |
| 4 | 3300037466 | Ga0395898_0098801 | Ga0395898_0098801_1993_2769 | 208 |
| 5 | 3300049574 | Ga0501038_0009352 | Ga0501038_0009352_6592_7437 | 208 |
| 6 | 3300049823 | Ga0501044_0607218 | Ga0501044_0607218_107_952 | 208 |
| 7 | 3300005983 | Ga0081540_1000040 | Ga0081540_100004030 | 211 |
| 8 | 3300035114 | Ga0373939_0065862 | Ga0373939_0065862_98_901 | 213 |
| 9 | 3300031711 | Ga0265314_10084052 | Ga0265314_100840522 | 214 |
| 10 | 3300031712 | Ga0265342_10130998 | Ga0265342_101309982 | 214 |
| 11 | 3300028800 | Ga0265338_10051978 | Ga0265338_100519783 | 215 |
| 12 | 3300031242 | Ga0265329_10004407 | Ga0265329_100044076 | 215 |
| 13 | 3300031344 | Ga0265316_10016415 | Ga0265316_100164154 | 215 |
| 14 | iso_pu_bacteria | 2643221595 | 2643988704 | 217 |
| 15 | 3300006175 | Ga0070712_100242412 | Ga0070712_1002424122 | 218 |
| 16 | 3300039437 | Ga0436365_0204082 | Ga0436365_0204082_34_825 | 218 |
| 17 | 3300005841 | Ga0068863_100566106 | Ga0068863_1005661062 | 219 |
| 18 | 3300035398 | Ga0316574_0159931 | Ga0316574_0159931_416_1255 | 219 |
| 19 | 3300005334 | Ga0068869_100034606 | Ga0068869_1000346062 | 220 |
| 20 | 3300035116 | Ga0373945_0123738 | Ga0373945_0123738_159_956 | 220 |
| 21 | 3300046533 | Ga0495640_0215047 | Ga0495640_0215047_29_826 | 220 |
| 22 | 3300046557 | Ga0495622_0164736 | Ga0495622_0164736_191_988 | 220 |
| 23 | 3300046674 | Ga0495588_0053247 | Ga0495588_0053247_254_1051 | 220 |
| 24 | 3300049581 | Ga0501047_0687704 | Ga0501047_0687704_16_813 | 220 |
| 25 | 3300049743 | Ga0501081_0383896 | Ga0501081_0383896_224_1021 | 220 |
| 26 | 3300031730 | Ga0307516_10000209 | Ga0307516_1000020920 | 222 |
| 27 | 3300037418 | Ga0395900_0029316 | Ga0395900_0029316_4190_5029 | 223 |
| 28 | 3300037466 | Ga0395898_0006080 | Ga0395898_0006080_10117_10956 | 223 |
| 29 | 3300037466 | Ga0395898_0050924 | Ga0395898_0050924_1440_2279 | 223 |
| 30 | 3300038443 | Ga0395901_0006367 | Ga0395901_0006367_2216_3055 | 223 |
| 31 | 3300038443 | Ga0395901_0868174 | Ga0395901_0868174_37_876 | 223 |
| 32 | 3300005937 | Ga0081455_10000058 | Ga0081455_1000005871 | 224 |
| 33 | 3300049569 | Ga0501032_0017557 | Ga0501032_0017557_1848_2684 | 224 |
| 34 | 3300049570 | Ga0501033_0006409 | Ga0501033_0006409_8209_9045 | 224 |
| 35 | 3300049573 | Ga0501037_0005851 | Ga0501037_0005851_590_1426 | 224 |
| 36 | 3300049574 | Ga0501038_0000878 | Ga0501038_0000878_24150_24986 | 224 |
| 37 | 3300049575 | Ga0501039_0023153 | Ga0501039_0023153_3241_4077 | 224 |
| 38 | 3300049579 | Ga0501043_0010496 | Ga0501043_0010496_4668_5504 | 224 |
| 39 | 3300049580 | Ga0501046_0001587 | Ga0501046_0001587_7855_8691 | 224 |
| 40 | 3300049581 | Ga0501047_0004529 | Ga0501047_0004529_3066_3902 | 224 |
| 41 | 3300049582 | Ga0501048_0015440 | Ga0501048_0015440_3201_4037 | 224 |
| 42 | 3300049584 | Ga0501068_0021181 | Ga0501068_0021181_1247_2083 | 224 |
| 43 | 3300049585 | Ga0501069_0001129 | Ga0501069_0001129_194_1030 | 224 |
| 44 | 3300049586 | Ga0501070_0005624 | Ga0501070_0005624_9163_9999 | 224 |
| 45 | 3300049589 | Ga0501073_0000996 | Ga0501073_0000996_8687_9523 | 224 |
| 46 | 3300049590 | Ga0501074_0001724 | Ga0501074_0001724_11859_12695 | 224 |
| 47 | 3300049742 | Ga0501080_0006117 | Ga0501080_0006117_792_1628 | 224 |
| 48 | 3300049744 | Ga0501083_0019158 | Ga0501083_0019158_1795_2631 | 224 |
| 49 | 3300049822 | Ga0501035_0000484 | Ga0501035_0000484_7983_8819 | 224 |
| 50 | 3300049824 | Ga0501045_0089567 | Ga0501045_0089567_1360_2196 | 224 |
| 51 | 3300054114 | Ga0501084_0002039 | Ga0501084_0002039_6501_7337 | 224 |
| 52 | 3300060353 | Ga0501082_0001669 | Ga0501082_0001669_2357_3193 | 224 |
| 53 | 3300005546 | Ga0070696_100000163 | Ga0070696_10000016312 | 225 |
| 54 | 3300013105 | Ga0157369_10027808 | Ga0157369_100278084 | 226 |
| 55 | 3300005937 | Ga0081455_10046358 | Ga0081455_100463582 | 227 |
| 56 | 3300042876 | Ga0451577_0664849 | Ga0451577_0664849_81_929 | 227 |
| 57 | 3300045051 | Ga0451576_0000247 | Ga0451576_0000247_51964_52812 | 227 |
| 58 | 3300005340 | Ga0070689_100484771 | Ga0070689_1004847712 | 229 |
| 59 | 3300005347 | Ga0070668_100073512 | Ga0070668_1000735123 | 229 |
| 60 | 3300005347 | Ga0070668_100160282 | Ga0070668_1001602822 | 229 |
| 61 | 3300005354 | Ga0070675_100253106 | Ga0070675_1002531062 | 229 |
| 62 | 3300005356 | Ga0070674_100041789 | Ga0070674_1000417894 | 229 |
| 63 | 3300005367 | Ga0070667_100056496 | Ga0070667_1000564963 | 229 |
| 64 | 3300005543 | Ga0070672_100210276 | Ga0070672_1002102762 | 229 |
| 65 | 3300005545 | Ga0070695_100249970 | Ga0070695_1002499702 | 229 |
| 66 | 3300005615 | Ga0070702_100106881 | Ga0070702_1001068812 | 229 |
| 67 | 3300005617 | Ga0068859_100240402 | Ga0068859_1002404022 | 229 |
| 68 | 3300005718 | Ga0068866_10226062 | Ga0068866_102260622 | 229 |
| 69 | 3300005719 | Ga0068861_100074120 | Ga0068861_1000741202 | 229 |
| 70 | 3300005843 | Ga0068860_100062955 | Ga0068860_1000629552 | 229 |
| 71 | 3300005844 | Ga0068862_100053868 | Ga0068862_1000538683 | 229 |
| 72 | 3300006931 | Ga0097620_100240392 | Ga0097620_1002403922 | 229 |
| 73 | 3300017792 | Ga0163161_10102547 | Ga0163161_101025472 | 229 |
| 74 | 3300025916 | Ga0207663_10220766 | Ga0207663_102207662 | 229 |
| 75 | 3300025986 | Ga0207658_10050537 | Ga0207658_100505372 | 229 |
| 76 | 3300026118 | Ga0207675_100016474 | Ga0207675_1000164747 | 229 |
| 77 | 3300028380 | Ga0268265_10036599 | Ga0268265_100365993 | 229 |
| 78 | 3300048917 | Ga0496114_0062257 | Ga0496114_0062257_588_1451 | 229 |
| 79 | iso_pu_bacteria | 2818991461 | 2819686069 | 230 |
| 80 | iso_pu_bacteria | 8005658619 | 8005659083 | 230 |
| 81 | iso_pu_bacteria | 2523231067 | 2523466633 | 231 |
| 82 | iso_pu_bacteria | 2738541317 | 2738947656 | 231 |
| 83 | iso_pu_bacteria | 2738543031 | 2739348489 | 231 |
| 84 | iso_pu_bacteria | 2837678835 | 2837683315 | 231 |
| 85 | iso_pu_bacteria | 2913308742 | 2913311691 | 231 |
| 86 | 3300005530 | Ga0070679_100342111 | Ga0070679_1003421112 | 232 |
| 87 | 3300005549 | Ga0070704_100010271 | Ga0070704_1000102714 | 232 |
| 88 | 3300013104 | Ga0157370_10052855 | Ga0157370_100528552 | 232 |
| 89 | 3300025921 | Ga0207652_10287797 | Ga0207652_102877972 | 232 |
| 90 | 3300046474 | Ga0495605_0011168 | Ga0495605_0011168_3825_4658 | 232 |
| 91 | iso_pu_bacteria | 2643221551 | 2643777093 | 232 |
| 92 | iso_pu_bacteria | 2643221555 | 2643795541 | 232 |
| 93 | 3300005435 | Ga0070714_100177943 | Ga0070714_1001779431 | 233 |
| 94 | 3300025929 | Ga0207664_10459886 | Ga0207664_104598862 | 233 |
| 95 | 3300031507 | Ga0307509_10170214 | Ga0307509_101702142 | 233 |
| 96 | 3300049571 | Ga0501034_0002129 | Ga0501034_0002129_16616_17452 | 233 |
| 97 | 3300049581 | Ga0501047_0030359 | Ga0501047_0030359_3668_4504 | 233 |
| 98 | 3300053077 | Ga0495601_0046672 | Ga0495601_0046672_245_1081 | 233 |
| 99 | 3300005546 | Ga0070696_100016860 | Ga0070696_1000168602 | 234 |
| 100 | 3300005563 | Ga0068855_100058338 | Ga0068855_1000583385 | 234 |
| 101 | 3300006237 | Ga0097621_100004339 | Ga0097621_1000043396 | 234 |
| 102 | 3300006914 | Ga0075436_100042432 | Ga0075436_1000424323 | 234 |
| 103 | 3300007265 | Ga0099794_10002565 | Ga0099794_100025654 | 234 |
| 104 | 3300009148 | Ga0105243_10087044 | Ga0105243_100870443 | 234 |
| 105 | 3300009553 | Ga0105249_10004666 | Ga0105249_100046665 | 234 |
| 106 | 3300010159 | Ga0099796_10009527 | Ga0099796_100095273 | 234 |
| 107 | 3300013307 | Ga0157372_10401283 | Ga0157372_104012832 | 234 |
| 108 | 3300025906 | Ga0207699_10036268 | Ga0207699_100362682 | 234 |
| 109 | 3300025915 | Ga0207693_10294937 | Ga0207693_102949371 | 234 |
| 110 | 3300025929 | Ga0207664_10333367 | Ga0207664_103333672 | 234 |
| 111 | 3300025935 | Ga0207709_10088812 | Ga0207709_100888122 | 234 |
| 112 | 3300025949 | Ga0207667_10129733 | Ga0207667_101297333 | 234 |
| 113 | 3300025961 | Ga0207712_10026229 | Ga0207712_100262295 | 234 |
| 114 | 3300027671 | Ga0209588_1022691 | Ga0209588_10226912 | 234 |
| 115 | 3300028017 | Ga0265356_1000342 | Ga0265356_10003424 | 234 |
| 116 | 3300028800 | Ga0265338_10012346 | Ga0265338_100123468 | 234 |
| 117 | 3300031249 | Ga0265339_10007030 | Ga0265339_100070308 | 234 |
| 118 | 3300031595 | Ga0265313_10074718 | Ga0265313_100747182 | 234 |
| 119 | 3300031712 | Ga0265342_10017724 | Ga0265342_100177245 | 234 |
| 120 | 3300035695 | Ga0373927_0068912 | Ga0373927_0068912_1184_2023 | 234 |
| 121 | 3300036401 | Ga0373937_0452430 | Ga0373937_0452430_16_855 | 234 |
| 122 | 3300037068 | Ga0373925_0065367 | Ga0373925_0065367_106_945 | 234 |
| 123 | 3300037418 | Ga0395900_0001933 | Ga0395900_0001933_15184_16023 | 234 |
| 124 | 3300037853 | Ga0436364_0106318 | Ga0436364_0106318_2031_2870 | 234 |
| 125 | 3300038443 | Ga0395901_0019526 | Ga0395901_0019526_458_1297 | 234 |
| 126 | 3300044694 | Ga0466963_0005297 | Ga0466963_0005297_3645_4484 | 234 |
| 127 | 3300045976 | Ga0466967_0002811 | Ga0466967_0002811_10012_10851 | 234 |
| 128 | 3300046690 | Ga0495624_0055473 | Ga0495624_0055473_833_1672 | 234 |
| 129 | 3300048907 | Ga0496104_0020522 | Ga0496104_0020522_4298_5137 | 234 |
| 130 | 3300053149 | Ga0500600_0006015 | Ga0500600_0006015_4219_5058 | 234 |
| 131 | iso_pu_bacteria | 2508501123 | 2509113465 | 234 |
| 132 | iso_pu_bacteria | 2509276022 | 2509394378 | 234 |
| 133 | iso_pu_bacteria | 2512875016 | 2512933148 | 234 |
| 134 | iso_pu_bacteria | 2512875024 | 2512961210 | 234 |
| 135 | iso_pu_bacteria | 2513237090 | 2513610227 | 234 |
| 136 | iso_pu_bacteria | 2513237164 | 2514035250 | 234 |
| 137 | iso_pu_bacteria | 2588253730 | 2588519208 | 234 |
| 138 | iso_pu_bacteria | 2599185301 | 2599941020 | 234 |
| 139 | iso_pu_bacteria | 2643221621 | 2644120775 | 234 |
| 140 | iso_pu_bacteria | 2643221627 | 2644155204 | 234 |
| 141 | iso_pu_bacteria | 2671180139 | 2671691945 | 234 |
| 142 | iso_pu_bacteria | 2693429783 | 2694634144 | 234 |
| 143 | iso_pu_bacteria | 2756170246 | 2756674142 | 234 |
| 144 | iso_pu_bacteria | 2791355123 | 2792750558 | 234 |
| 145 | iso_pu_bacteria | 2844002411 | 2844009337 | 234 |
| 146 | iso_pu_bacteria | 2847670302 | 2847674520 | 234 |
| 147 | iso_pu_bacteria | 2847686936 | 2847690626 | 234 |
| 148 | iso_pu_bacteria | 2856314179 | 2856317594 | 234 |
| 149 | iso_pu_bacteria | 2856320880 | 2856321561 | 234 |
| 150 | iso_pu_bacteria | 2856364286 | 2856366607 | 234 |
| 151 | iso_pu_bacteria | 2857349434 | 2857356714 | 234 |
| 152 | iso_pu_bacteria | 2857537821 | 2857541609 | 234 |
| 153 | iso_pu_bacteria | 2869162929 | 2869163681 | 234 |
| 154 | iso_pu_bacteria | 2869278585 | 2869285490 | 234 |
| 155 | iso_pu_bacteria | 2869285874 | 2869287982 | 234 |
| 156 | iso_pu_bacteria | 2871429161 | 2871429870 | 234 |
| 157 | iso_pu_bacteria | 2871444079 | 2871448010 | 234 |
| 158 | iso_pu_bacteria | 2871466892 | 2871467568 | 234 |
| 159 | iso_pu_bacteria | 2871495908 | 2871497909 | 234 |
| 160 | iso_pu_bacteria | 2874102143 | 2874108043 | 234 |
| 161 | iso_pu_bacteria | 2874139085 | 2874146266 | 234 |
| 162 | iso_pu_bacteria | 2874146452 | 2874151615 | 234 |
| 163 | iso_pu_bacteria | 2874155637 | 2874159247 | 234 |
| 164 | iso_pu_bacteria | 2876363079 | 2876364604 | 234 |
| 165 | iso_pu_bacteria | 2876369609 | 2876373493 | 234 |
| 166 | iso_pu_bacteria | 2876377896 | 2876379009 | 234 |
| 167 | iso_pu_bacteria | 2876392853 | 2876396368 | 234 |
| 168 | iso_pu_bacteria | 2876413966 | 2876417666 | 234 |
| 169 | iso_pu_bacteria | 2878035449 | 2878038652 | 234 |
| 170 | iso_pu_bacteria | 2878738818 | 2878741309 | 234 |
| 171 | iso_pu_bacteria | 2878745973 | 2878749493 | 234 |
| 172 | iso_pu_bacteria | 2878760144 | 2878762131 | 234 |
| 173 | iso_pu_bacteria | 2878767105 | 2878769098 | 234 |
| 174 | iso_pu_bacteria | 2881147464 | 2881149278 | 234 |
| 175 | iso_pu_bacteria | 2881161766 | 2881166101 | 234 |
| 176 | iso_pu_bacteria | 2885305155 | 2885307591 | 234 |
| 177 | iso_pu_bacteria | 2885326080 | 2885327413 | 234 |
| 178 | iso_pu_bacteria | 2888337043 | 2888337809 | 234 |
| 179 | iso_pu_bacteria | 2888350351 | 2888354353 | 234 |
| 180 | iso_pu_bacteria | 2889010040 | 2889016044 | 234 |
| 181 | iso_pu_bacteria | 2889016732 | 2889018915 | 234 |
| 182 | iso_pu_bacteria | 2903448605 | 2903454870 | 234 |
| 183 | iso_pu_bacteria | 2903492973 | 2903493723 | 234 |
| 184 | iso_pu_bacteria | 2903521522 | 2903522660 | 234 |
| 185 | iso_pu_bacteria | 2903528002 | 2903529039 | 234 |
| 186 | iso_pu_bacteria | 2903540706 | 2903542707 | 234 |
| 187 | iso_pu_bacteria | 2904659560 | 2904663144 | 234 |
| 188 | iso_pu_bacteria | 2906308376 | 2906310531 | 234 |
| 189 | iso_pu_bacteria | 2906321335 | 2906324596 | 234 |
| 190 | iso_pu_bacteria | 2906328253 | 2906333392 | 234 |
| 191 | iso_pu_bacteria | 2906354277 | 2906356960 | 234 |
| 192 | iso_pu_bacteria | 2906378014 | 2906381193 | 234 |
| 193 | iso_pu_bacteria | 2906414383 | 2906417659 | 234 |
| 194 | iso_pu_bacteria | 2922158528 | 2922163720 | 234 |
| 195 | iso_pu_bacteria | 2922185730 | 2922193652 | 234 |
| 196 | iso_pu_bacteria | 2924718760 | 2924723092 | 234 |
| 197 | iso_pu_bacteria | 2924726620 | 2924732451 | 234 |
| 198 | iso_pu_bacteria | 2924776078 | 2924778991 | 234 |
| 199 | iso_pu_bacteria | 2937813078 | 2937817360 | 234 |
| 200 | iso_pu_bacteria | 2937848649 | 2937853498 | 234 |
| 201 | iso_pu_bacteria | 2937877337 | 2937883348 | 234 |
| 202 | iso_pu_bacteria | 2937891427 | 2937898323 | 234 |
| 203 | iso_pu_bacteria | 2937972304 | 2937979031 | 234 |
| 204 | iso_pu_bacteria | 2937994558 | 2937996559 | 234 |
| 205 | iso_pu_bacteria | 2938014810 | 2938015339 | 234 |
| 206 | iso_pu_bacteria | 2941479691 | 2941480595 | 234 |
| 207 | iso_pu_bacteria | 2958034702 | 2958041195 | 234 |
| 208 | iso_pu_bacteria | 2958041894 | 2958049228 | 234 |
| 209 | iso_pu_bacteria | 2958041894 | 2958057689 | 234 |
| 210 | iso_pu_bacteria | 2958064165 | 2958069930 | 234 |
| 211 | iso_pu_bacteria | 2958084443 | 2958090515 | 234 |
| 212 | iso_pu_bacteria | 2958092219 | 2958092607 | 234 |
| 213 | iso_pu_bacteria | 2958115193 | 2958116041 | 234 |
| 214 | iso_pu_bacteria | 2958130278 | 2958132386 | 234 |
| 215 | iso_pu_bacteria | 2958144490 | 2958151983 | 234 |
| 216 | iso_pu_bacteria | 2958165035 | 2958167030 | 234 |
| 217 | iso_pu_bacteria | 2958172287 | 2958176132 | 234 |
| 218 | iso_pu_bacteria | 2958179912 | 2958182200 | 234 |
| 219 | iso_pu_bacteria | 2961077736 | 2961080044 | 234 |
| 220 | iso_pu_bacteria | 2961114664 | 2961118171 | 234 |
| 221 | iso_pu_bacteria | 2961163497 | 2961165499 | 234 |
| 222 | iso_pu_bacteria | 2963644680 | 2963646060 | 234 |
| 223 | iso_pu_bacteria | 2965018300 | 2965020322 | 234 |
| 224 | iso_pu_bacteria | 2965119406 | 2965122114 | 234 |
| 225 | iso_pu_bacteria | 2968016561 | 2968022795 | 234 |
| 226 | iso_pu_bacteria | 2968083720 | 2968089572 | 234 |
| 227 | iso_pu_bacteria | 2968091066 | 2968091543 | 234 |
| 228 | iso_pu_bacteria | 2968097103 | 2968097472 | 234 |
| 229 | iso_pu_bacteria | 2968110612 | 2968114232 | 234 |
| 230 | iso_pu_bacteria | 2968117919 | 2968123355 | 234 |
| 231 | iso_pu_bacteria | 2968128360 | 2968133487 | 234 |
| 232 | iso_pu_bacteria | 2968171901 | 2968173901 | 234 |
| 233 | iso_pu_bacteria | 2970469710 | 2970475380 | 234 |
| 234 | iso_pu_bacteria | 2970554993 | 2970556987 | 234 |
| 235 | iso_pu_bacteria | 2970593180 | 2970600106 | 234 |
| 236 | iso_pu_bacteria | 2977843712 | 2977847647 | 234 |
| 237 | iso_pu_bacteria | 2977858184 | 2977860410 | 234 |
| 238 | iso_pu_bacteria | 2977864932 | 2977871124 | 234 |
| 239 | iso_pu_bacteria | 2977922695 | 2977928710 | 234 |
| 240 | iso_pu_bacteria | 2977942078 | 2977942960 | 234 |
| 241 | iso_pu_bacteria | 2977971508 | 2977980175 | 234 |
| 242 | iso_pu_bacteria | 2977986579 | 2977992748 | 234 |
| 243 | iso_pu_bacteria | 2979710463 | 2979712803 | 234 |
| 244 | iso_pu_bacteria | 2979742915 | 2979745135 | 234 |
| 245 | iso_pu_bacteria | 2979779861 | 2979785434 | 234 |
| 246 | iso_pu_bacteria | 2987636660 | 2987643995 | 234 |
| 247 | iso_pu_bacteria | 2987652177 | 2987657773 | 234 |
| 248 | iso_pu_bacteria | 2987659509 | 2987661507 | 234 |
| 249 | iso_pu_bacteria | 2996341866 | 2996342575 | 234 |
| 250 | iso_pu_bacteria | 2996348954 | 2996353196 | 234 |
| 251 | iso_pu_bacteria | 3004188549 | 3004190556 | 234 |
| 252 | iso_pu_bacteria | 3004203850 | 3004208144 | 234 |
| 253 | iso_pu_bacteria | 3004211236 | 3004211352 | 234 |
| 254 | iso_pu_bacteria | 3004218560 | 3004225099 | 234 |
| 255 | iso_pu_bacteria | 3004275668 | 3004279878 | 234 |
| 256 | iso_pu_bacteria | 3004289098 | 3004295582 | 234 |
| 257 | iso_pu_bacteria | 3004334049 | 3004336362 | 234 |
| 258 | iso_pu_bacteria | 637000159 | 637076230 | 234 |
| 259 | iso_pu_bacteria | 8004387939 | 8004389770 | 234 |
| 260 | iso_pu_bacteria | 8004445564 | 8004450899 | 234 |
| 261 | iso_pu_bacteria | 8004640170 | 8004645625 | 234 |
| 262 | iso_pu_bacteria | 8004703790 | 8004704406 | 234 |
| 263 | iso_pu_bacteria | 8004714634 | 8004718167 | 234 |
| 264 | iso_pu_bacteria | 8018150411 | 8018153511 | 234 |
| 265 | 3300003354 | JGI25160J50197_1010041 | JGI25160J50197_10100413 | 235 |
| 266 | 3300003659 | JGI25404J52841_10003799 | JGI25404J52841_100037993 | 235 |
| 267 | 3300005328 | Ga0070676_10026538 | Ga0070676_100265383 | 235 |
| 268 | 3300005330 | Ga0070690_100005765 | Ga0070690_1000057653 | 235 |
| 269 | 3300005340 | Ga0070689_100049104 | Ga0070689_1000491042 | 235 |
| 270 | 3300005343 | Ga0070687_100072675 | Ga0070687_1000726752 | 235 |
| 271 | 3300005343 | Ga0070687_100108054 | Ga0070687_1001080541 | 235 |
| 272 | 3300005344 | Ga0070661_100172735 | Ga0070661_1001727352 | 235 |
| 273 | 3300005344 | Ga0070661_100238990 | Ga0070661_1002389902 | 235 |
| 274 | 3300005354 | Ga0070675_100130395 | Ga0070675_1001303952 | 235 |
| 275 | 3300005356 | Ga0070674_100004876 | Ga0070674_1000048768 | 235 |
| 276 | 3300005356 | Ga0070674_100088270 | Ga0070674_1000882702 | 235 |
| 277 | 3300005365 | Ga0070688_100007302 | Ga0070688_1000073022 | 235 |
| 278 | 3300005539 | Ga0068853_100457985 | Ga0068853_1004579852 | 235 |
| 279 | 3300005543 | Ga0070672_100195097 | Ga0070672_1001950972 | 235 |
| 280 | 3300005549 | Ga0070704_100347049 | Ga0070704_1003470492 | 235 |
| 281 | 3300005564 | Ga0070664_100114627 | Ga0070664_1001146273 | 235 |
| 282 | 3300005616 | Ga0068852_100329719 | Ga0068852_1003297192 | 235 |
| 283 | 3300005617 | Ga0068859_100113389 | Ga0068859_1001133892 | 235 |
| 284 | 3300005718 | Ga0068866_10227188 | Ga0068866_102271881 | 235 |
| 285 | 3300005719 | Ga0068861_100152384 | Ga0068861_1001523842 | 235 |
| 286 | 3300005840 | Ga0068870_10201145 | Ga0068870_102011452 | 235 |
| 287 | 3300005983 | Ga0081540_1001972 | Ga0081540_10019727 | 235 |
| 288 | 3300006871 | Ga0075434_100017752 | Ga0075434_1000177522 | 235 |
| 289 | 3300006931 | Ga0097620_100113388 | Ga0097620_1001133882 | 235 |
| 290 | 3300009148 | Ga0105243_10386443 | Ga0105243_103864431 | 235 |
| 291 | 3300010375 | Ga0105239_10481063 | Ga0105239_104810632 | 235 |
| 292 | 3300013306 | Ga0163162_10310051 | Ga0163162_103100512 | 235 |
| 293 | 3300013307 | Ga0157372_10168578 | Ga0157372_101685782 | 235 |
| 294 | 3300014325 | Ga0163163_10132831 | Ga0163163_101328312 | 235 |
| 295 | 3300025302 | Ga0207426_1001988 | Ga0207426_10019883 | 235 |
| 296 | 3300025918 | Ga0207662_10130480 | Ga0207662_101304802 | 235 |
| 297 | 3300025923 | Ga0207681_10027141 | Ga0207681_100271413 | 235 |
| 298 | 3300025933 | Ga0207706_10056312 | Ga0207706_100563122 | 235 |
| 299 | 3300025936 | Ga0207670_10003994 | Ga0207670_100039943 | 235 |
| 300 | 3300025937 | Ga0207669_10005810 | Ga0207669_100058102 | 235 |
| 301 | 3300025937 | Ga0207669_10087242 | Ga0207669_100872422 | 235 |
| 302 | 3300025940 | Ga0207691_10187670 | Ga0207691_101876702 | 235 |
| 303 | 3300025945 | Ga0207679_10121096 | Ga0207679_101210962 | 235 |
| 304 | 3300026089 | Ga0207648_10110694 | Ga0207648_101106942 | 235 |
| 305 | 3300026118 | Ga0207675_100193673 | Ga0207675_1001936732 | 235 |
| 306 | 3300026121 | Ga0207683_10050477 | Ga0207683_100504773 | 235 |
| 307 | 3300028380 | Ga0268265_10394579 | Ga0268265_103945792 | 235 |
| 308 | 3300031238 | Ga0265332_10000302 | Ga0265332_1000030216 | 235 |
| 309 | 3300031247 | Ga0265340_10010544 | Ga0265340_100105442 | 235 |
| 310 | 3300031249 | Ga0265339_10003035 | Ga0265339_100030354 | 235 |
| 311 | 3300031250 | Ga0265331_10000008 | Ga0265331_10000008180 | 235 |
| 312 | 3300031250 | Ga0265331_10093620 | Ga0265331_100936202 | 235 |
| 313 | 3300031251 | Ga0265327_10000036 | Ga0265327_1000003660 | 235 |
| 314 | 3300031711 | Ga0265314_10235500 | Ga0265314_102355002 | 235 |
| 315 | 3300031712 | Ga0265342_10000238 | Ga0265342_1000023852 | 235 |
| 316 | 3300031838 | Ga0307518_10165693 | Ga0307518_101656932 | 235 |
| 317 | 3300035111 | Ga0373923_0012857 | Ga0373923_0012857_240_1082 | 235 |
| 318 | 3300035113 | Ga0373936_0000312 | Ga0373936_0000312_1453_2295 | 235 |
| 319 | 3300035117 | Ga0373953_0013356 | Ga0373953_0013356_787_1629 | 235 |
| 320 | 3300035172 | Ga0373955_0000333 | Ga0373955_0000333_12434_13276 | 235 |
| 321 | 3300035241 | Ga0373961_0005859 | Ga0373961_0005859_84_926 | 235 |
| 322 | 3300035241 | Ga0373961_0046193 | Ga0373961_0046193_186_1028 | 235 |
| 323 | 3300035410 | Ga0373924_0002927 | Ga0373924_0002927_3053_3895 | 235 |
| 324 | 3300035691 | Ga0373931_0011811 | Ga0373931_0011811_3058_3900 | 235 |
| 325 | 3300035692 | Ga0373935_0000097 | Ga0373935_0000097_1891_2733 | 235 |
| 326 | 3300035695 | Ga0373927_0010654 | Ga0373927_0010654_606_1448 | 235 |
| 327 | 3300035724 | Ga0373933_0006916 | Ga0373933_0006916_708_1550 | 235 |
| 328 | 3300035725 | Ga0373947_0000353 | Ga0373947_0000353_4672_5514 | 235 |
| 329 | 3300036401 | Ga0373937_0000006 | Ga0373937_0000006_31979_32821 | 235 |
| 330 | 3300037068 | Ga0373925_0000002 | Ga0373925_0000002_163555_164397 | 235 |
| 331 | 3300045976 | Ga0466967_0134632 | Ga0466967_0134632_922_1767 | 235 |
| 332 | 3300046454 | Ga0495592_0000039 | Ga0495592_0000039_36801_37643 | 235 |
| 333 | 3300046455 | Ga0495603_0177500 | Ga0495603_0177500_228_1073 | 235 |
| 334 | 3300046462 | Ga0495651_0000376 | Ga0495651_0000376_27038_27880 | 235 |
| 335 | 3300046463 | Ga0495653_0000006 | Ga0495653_0000006_163703_164545 | 235 |
| 336 | 3300046474 | Ga0495605_0079102 | Ga0495605_0079102_367_1212 | 235 |
| 337 | 3300046476 | Ga0495662_0002816 | Ga0495662_0002816_4821_5663 | 235 |
| 338 | 3300046477 | Ga0495664_0000002 | Ga0495664_0000002_199337_200179 | 235 |
| 339 | 3300046506 | Ga0495583_0103628 | Ga0495583_0103628_283_1128 | 235 |
| 340 | 3300046507 | Ga0495606_0008491 | Ga0495606_0008491_621_1466 | 235 |
| 341 | 3300046511 | Ga0495608_0000006 | Ga0495608_0000006_14367_15209 | 235 |
| 342 | 3300046514 | Ga0495618_0000027 | Ga0495618_0000027_22429_23271 | 235 |
| 343 | 3300046514 | Ga0495618_0135135 | Ga0495618_0135135_65_907 | 235 |
| 344 | 3300046516 | Ga0495628_0000002 | Ga0495628_0000002_163722_164564 | 235 |
| 345 | 3300046517 | Ga0495630_0000950 | Ga0495630_0000950_11418_12260 | 235 |
| 346 | 3300046524 | Ga0495648_0032023 | Ga0495648_0032023_2031_2876 | 235 |
| 347 | 3300046529 | Ga0495652_0000004 | Ga0495652_0000004_424319_425161 | 235 |
| 348 | 3300046531 | Ga0495665_0037244 | Ga0495665_0037244_1423_2265 | 235 |
| 349 | 3300046533 | Ga0495640_0000005 | Ga0495640_0000005_280271_281113 | 235 |
| 350 | 3300046533 | Ga0495640_0141888 | Ga0495640_0141888_123_965 | 235 |
| 351 | 3300046536 | Ga0495587_0000007 | Ga0495587_0000007_37129_37971 | 235 |
| 352 | 3300046536 | Ga0495587_0084851 | Ga0495587_0084851_639_1481 | 235 |
| 353 | 3300046543 | Ga0495645_0000003 | Ga0495645_0000003_144973_145815 | 235 |
| 354 | 3300046543 | Ga0495645_0095777 | Ga0495645_0095777_40_882 | 235 |
| 355 | 3300046559 | Ga0495667_0000002 | Ga0495667_0000002_273159_274001 | 235 |
| 356 | 3300046642 | Ga0495634_0000022 | Ga0495634_0000022_117475_118317 | 235 |
| 357 | 3300046660 | Ga0495625_0179835 | Ga0495625_0179835_505_1350 | 235 |
| 358 | 3300046663 | Ga0495635_0000022 | Ga0495635_0000022_134005_134847 | 235 |
| 359 | 3300046675 | Ga0495657_0000072 | Ga0495657_0000072_15518_16360 | 235 |
| 360 | 3300046678 | Ga0495599_0000001 | Ga0495599_0000001_302400_303242 | 235 |
| 361 | 3300046679 | Ga0495623_0000001 | Ga0495623_0000001_71345_72187 | 235 |
| 362 | 3300046680 | Ga0495646_0000014 | Ga0495646_0000014_65749_66591 | 235 |
| 363 | 3300046689 | Ga0495613_0007082 | Ga0495613_0007082_1369_2211 | 235 |
| 364 | 3300046694 | Ga0495649_0003847 | Ga0495649_0003847_5624_6469 | 235 |
| 365 | 3300046809 | Ga0495600_0000006 | Ga0495600_0000006_32880_33722 | 235 |
| 366 | 3300047317 | Ga0495604_0000005 | Ga0495604_0000005_189366_190208 | 235 |
| 367 | 3300047319 | Ga0495674_0000003 | Ga0495674_0000003_397562_398404 | 235 |
| 368 | 3300047322 | Ga0495680_0002479 | Ga0495680_0002479_15487_16329 | 235 |
| 369 | 3300047323 | Ga0495683_0151633 | Ga0495683_0151633_167_1012 | 235 |
| 370 | 3300047444 | Ga0495675_0000010 | Ga0495675_0000010_152423_153265 | 235 |
| 371 | 3300047447 | Ga0495685_054157 | Ga0495685_054157_172_1029 | 235 |
| 372 | 3300047471 | Ga0495684_0000028 | Ga0495684_0000028_85714_86556 | 235 |
| 373 | 3300047673 | Ga0495593_0001828 | Ga0495593_0001828_2795_3637 | 235 |
| 374 | 3300048088 | Ga0495602_0000054 | Ga0495602_0000054_2566_3408 | 235 |
| 375 | 3300048906 | Ga0496103_0173437 | Ga0496103_0173437_388_1230 | 235 |
| 376 | 3300048909 | Ga0496106_0317803 | Ga0496106_0317803_289_1131 | 235 |
| 377 | 3300048912 | Ga0496109_0625009 | Ga0496109_0625009_137_979 | 235 |
| 378 | 3300048915 | Ga0496112_0439065 | Ga0496112_0439065_27_869 | 235 |
| 379 | 3300048917 | Ga0496114_0228852 | Ga0496114_0228852_481_1323 | 235 |
| 380 | 3300048917 | Ga0496114_0391407 | Ga0496114_0391407_197_1042 | 235 |
| 381 | 3300048917 | Ga0496114_0531729 | Ga0496114_0531729_17_862 | 235 |
| 382 | 3300048924 | Ga0496121_0084892 | Ga0496121_0084892_1434_2279 | 235 |
| 383 | 3300048928 | Ga0496125_0230035 | Ga0496125_0230035_309_1154 | 235 |
| 384 | 3300049585 | Ga0501069_0193553 | Ga0501069_0193553_297_1142 | 235 |
| 385 | 3300049586 | Ga0501070_0046333 | Ga0501070_0046333_503_1348 | 235 |
| 386 | 3300049590 | Ga0501074_0244139 | Ga0501074_0244139_258_1103 | 235 |
| 387 | 3300049593 | Ga0501077_0123740 | Ga0501077_0123740_625_1467 | 235 |
| 388 | 3300049744 | Ga0501083_0031714 | Ga0501083_0031714_1687_2529 | 235 |
| 389 | 3300050514 | nmdc:mga08x19_134673_c1 | nmdc:mga08x19_134673_c1_714_1556 | 235 |
| 390 | 3300053077 | Ga0495601_0000008 | Ga0495601_0000008_158178_159020 | 235 |
| 391 | 3300053077 | Ga0495601_0277664 | Ga0495601_0277664_98_940 | 235 |
| 392 | 3300053078 | Ga0495612_0000002 | Ga0495612_0000002_75318_76160 | 235 |
| 393 | 3300053084 | Ga0495595_0000008 | Ga0495595_0000008_158306_159148 | 235 |
| 394 | 3300053084 | Ga0495595_0122066 | Ga0495595_0122066_117_959 | 235 |
| 395 | 3300053085 | Ga0495619_0000002 | Ga0495619_0000002_163725_164567 | 235 |
| 396 | 3300053153 | Ga0500616_0017264 | Ga0500616_0017264_55_897 | 235 |
| 397 | 3300060353 | Ga0501082_0077847 | Ga0501082_0077847_1585_2430 | 235 |
| 398 | iso_pu_bacteria | 2881927736 | 2881929582 | 235 |
| 399 | iso_pu_bacteria | 2895511927 | 2895517180 | 235 |
| 400 | 3300005338 | Ga0068868_100230861 | Ga0068868_1002308612 | 236 |
| 401 | 3300005355 | Ga0070671_100123364 | Ga0070671_1001233642 | 236 |
| 402 | 3300005435 | Ga0070714_100374512 | Ga0070714_1003745122 | 236 |
| 403 | 3300005437 | Ga0070710_10084507 | Ga0070710_100845072 | 236 |
| 404 | 3300005439 | Ga0070711_100040960 | Ga0070711_1000409604 | 236 |
| 405 | 3300005440 | Ga0070705_100322455 | Ga0070705_1003224552 | 236 |
| 406 | 3300005456 | Ga0070678_100039306 | Ga0070678_1000393063 | 236 |
| 407 | 3300005545 | Ga0070695_100493746 | Ga0070695_1004937461 | 236 |
| 408 | 3300005547 | Ga0070693_100107983 | Ga0070693_1001079832 | 236 |
| 409 | 3300005548 | Ga0070665_100266959 | Ga0070665_1002669592 | 236 |
| 410 | 3300005564 | Ga0070664_100098438 | Ga0070664_1000984382 | 236 |
| 411 | 3300006358 | Ga0068871_100021625 | Ga0068871_1000216256 | 236 |
| 412 | 3300009098 | Ga0105245_10004478 | Ga0105245_100044789 | 236 |
| 413 | 3300009177 | Ga0105248_10080229 | Ga0105248_100802292 | 236 |
| 414 | 3300009545 | Ga0105237_10366546 | Ga0105237_103665462 | 236 |
| 415 | 3300009553 | Ga0105249_10151280 | Ga0105249_101512803 | 236 |
| 416 | 3300010375 | Ga0105239_10176046 | Ga0105239_101760462 | 236 |
| 417 | 3300011119 | Ga0105246_10049107 | Ga0105246_100491072 | 236 |
| 418 | 3300013296 | Ga0157374_10074714 | Ga0157374_100747142 | 236 |
| 419 | 3300013308 | Ga0157375_10056545 | Ga0157375_100565452 | 236 |
| 420 | 3300014968 | Ga0157379_10079841 | Ga0157379_100798413 | 236 |
| 421 | 3300017792 | Ga0163161_10128666 | Ga0163161_101286662 | 236 |
| 422 | 3300025898 | Ga0207692_10027566 | Ga0207692_100275661 | 236 |
| 423 | 3300025903 | Ga0207680_10126448 | Ga0207680_101264482 | 236 |
| 424 | 3300025916 | Ga0207663_10010118 | Ga0207663_100101187 | 236 |
| 425 | 3300025919 | Ga0207657_10026202 | Ga0207657_100262024 | 236 |
| 426 | 3300025927 | Ga0207687_10102604 | Ga0207687_101026042 | 236 |
| 427 | 3300025929 | Ga0207664_10371216 | Ga0207664_103712162 | 236 |
| 428 | 3300025933 | Ga0207706_10044539 | Ga0207706_100445393 | 236 |
| 429 | 3300025937 | Ga0207669_10128558 | Ga0207669_101285582 | 236 |
| 430 | 3300025986 | Ga0207658_10319098 | Ga0207658_103190982 | 236 |
| 431 | 3300026035 | Ga0207703_10056580 | Ga0207703_100565803 | 236 |
| 432 | 3300026078 | Ga0207702_10239932 | Ga0207702_102399322 | 236 |
| 433 | 3300026121 | Ga0207683_10047329 | Ga0207683_100473294 | 236 |
| 434 | 3300028379 | Ga0268266_10284316 | Ga0268266_102843162 | 236 |
| 435 | 3300028381 | Ga0268264_10451050 | Ga0268264_104510502 | 236 |
| 436 | 3300031595 | Ga0265313_10015432 | Ga0265313_100154324 | 236 |
| 437 | 3300035119 | Ga0373956_0005026 | Ga0373956_0005026_3013_3858 | 236 |
| 438 | 3300035172 | Ga0373955_0002441 | Ga0373955_0002441_524_1369 | 236 |
| 439 | 3300035692 | Ga0373935_0346383 | Ga0373935_0346383_144_989 | 236 |
| 440 | 3300035724 | Ga0373933_0002203 | Ga0373933_0002203_802_1647 | 236 |
| 441 | 3300036401 | Ga0373937_0004370 | Ga0373937_0004370_8233_9078 | 236 |
| 442 | 3300039438 | Ga0436360_0293200 | Ga0436360_0293200_477_1322 | 236 |
| 443 | 3300046454 | Ga0495592_0001529 | Ga0495592_0001529_8482_9327 | 236 |
| 444 | 3300046462 | Ga0495651_0006087 | Ga0495651_0006087_8010_8855 | 236 |
| 445 | 3300046463 | Ga0495653_0004466 | Ga0495653_0004466_6702_7547 | 236 |
| 446 | 3300046477 | Ga0495664_0023178 | Ga0495664_0023178_725_1570 | 236 |
| 447 | 3300046511 | Ga0495608_0000910 | Ga0495608_0000910_6037_6882 | 236 |
| 448 | 3300046514 | Ga0495618_0007318 | Ga0495618_0007318_1506_2351 | 236 |
| 449 | 3300046516 | Ga0495628_0005038 | Ga0495628_0005038_8233_9078 | 236 |
| 450 | 3300046529 | Ga0495652_0007044 | Ga0495652_0007044_6776_7621 | 236 |
| 451 | 3300046533 | Ga0495640_0019009 | Ga0495640_0019009_2227_3072 | 236 |
| 452 | 3300046536 | Ga0495587_0005121 | Ga0495587_0005121_3825_4670 | 236 |
| 453 | 3300046559 | Ga0495667_0010461 | Ga0495667_0010461_2770_3615 | 236 |
| 454 | 3300046663 | Ga0495635_0001031 | Ga0495635_0001031_5930_6775 | 236 |
| 455 | 3300046679 | Ga0495623_0004889 | Ga0495623_0004889_310_1155 | 236 |
| 456 | 3300046680 | Ga0495646_0001814 | Ga0495646_0001814_8482_9327 | 236 |
| 457 | 3300046689 | Ga0495613_0059897 | Ga0495613_0059897_306_1151 | 236 |
| 458 | 3300046809 | Ga0495600_0003474 | Ga0495600_0003474_1701_2546 | 236 |
| 459 | 3300047317 | Ga0495604_0002346 | Ga0495604_0002346_6226_7071 | 236 |
| 460 | 3300047322 | Ga0495680_0004228 | Ga0495680_0004228_4711_5556 | 236 |
| 461 | 3300047444 | Ga0495675_0001356 | Ga0495675_0001356_6737_7582 | 236 |
| 462 | 3300047471 | Ga0495684_0026180 | Ga0495684_0026180_3236_4081 | 236 |
| 463 | 3300047673 | Ga0495593_0038416 | Ga0495593_0038416_1549_2394 | 236 |
| 464 | 3300048088 | Ga0495602_0106413 | Ga0495602_0106413_1249_2094 | 236 |
| 465 | 3300048904 | Ga0496101_0014887 | Ga0496101_0014887_1258_2103 | 236 |
| 466 | 3300048905 | Ga0496102_0367253 | Ga0496102_0367253_147_992 | 236 |
| 467 | 3300048907 | Ga0496104_0011140 | Ga0496104_0011140_2383_3228 | 236 |
| 468 | 3300048908 | Ga0496105_0009320 | Ga0496105_0009320_1276_2121 | 236 |
| 469 | 3300048909 | Ga0496106_0167436 | Ga0496106_0167436_683_1528 | 236 |
| 470 | 3300048910 | Ga0496107_0196162 | Ga0496107_0196162_363_1208 | 236 |
| 471 | 3300048911 | Ga0496108_0613553 | Ga0496108_0613553_88_933 | 236 |
| 472 | 3300048912 | Ga0496109_0016699 | Ga0496109_0016699_3505_4350 | 236 |
| 473 | 3300048915 | Ga0496112_0012548 | Ga0496112_0012548_5071_5916 | 236 |
| 474 | 3300048918 | Ga0496115_0183050 | Ga0496115_0183050_662_1507 | 236 |
| 475 | 3300049593 | Ga0501077_0206841 | Ga0501077_0206841_202_1047 | 236 |
| 476 | 3300053077 | Ga0495601_0008398 | Ga0495601_0008398_2534_3379 | 236 |
| 477 | 3300053078 | Ga0495612_0004077 | Ga0495612_0004077_2534_3379 | 236 |
| 478 | 3300053084 | Ga0495595_0005255 | Ga0495595_0005255_1372_2217 | 236 |
| 479 | 3300053085 | Ga0495619_0002154 | Ga0495619_0002154_8721_9566 | 236 |
| 480 | 3300061734 | Ga0530510_0279492 | Ga0530510_0279492_27_872 | 236 |
| 481 | 3300005340 | Ga0070689_100470882 | Ga0070689_1004708821 | 237 |
| 482 | iso_pu_bacteria | 2958122699 | 2958124939 | 237 |
| 483 | iso_pu_bacteria | 2977872689 | 2977876218 | 237 |
| 484 | 3300009147 | Ga0114129_10345101 | Ga0114129_103451012 | 238 |
| 485 | 3300025912 | Ga0207707_10300669 | Ga0207707_103006692 | 238 |
| 486 | 3300025916 | Ga0207663_10097006 | Ga0207663_100970062 | 238 |
| 487 | 3300028577 | Ga0265318_10008960 | Ga0265318_100089604 | 238 |
| 488 | 3300031240 | Ga0265320_10009572 | Ga0265320_100095723 | 238 |
| 489 | 3300031241 | Ga0265325_10025211 | Ga0265325_100252112 | 238 |
| 490 | 3300031242 | Ga0265329_10004247 | Ga0265329_100042476 | 238 |
| 491 | 3300031247 | Ga0265340_10027558 | Ga0265340_100275583 | 238 |
| 492 | 3300031250 | Ga0265331_10048154 | Ga0265331_100481542 | 238 |
| 493 | 3300031344 | Ga0265316_10078651 | Ga0265316_100786513 | 238 |
| 494 | 3300031595 | Ga0265313_10017884 | Ga0265313_100178842 | 238 |
| 495 | 3300031665 | Ga0316575_10004946 | Ga0316575_100049464 | 238 |
| 496 | 3300031711 | Ga0265314_10047002 | Ga0265314_100470023 | 238 |
| 497 | 3300031712 | Ga0265342_10012970 | Ga0265342_100129701 | 238 |
| 498 | 3300037418 | Ga0395900_0068502 | Ga0395900_0068502_2278_3129 | 238 |
| 499 | 3300037466 | Ga0395898_0190897 | Ga0395898_0190897_882_1733 | 238 |
| 500 | 3300049573 | Ga0501037_0200460 | Ga0501037_0200460_243_1094 | 238 |
| 501 | 3300049589 | Ga0501073_0065041 | Ga0501073_0065041_675_1526 | 238 |
| 502 | 3300049589 | Ga0501073_0131458 | Ga0501073_0131458_91_942 | 238 |
| 503 | 3300049822 | Ga0501035_0002346 | Ga0501035_0002346_5082_5933 | 238 |
| 504 | 3300001977 | JGI24746J21847_1000674 | JGI24746J21847_10006743 | 239 |
| 505 | 3300001989 | JGI24739J22299_10004845 | JGI24739J22299_100048456 | 239 |
| 506 | 3300001990 | JGI24737J22298_10005956 | JGI24737J22298_100059564 | 239 |
| 507 | 3300002070 | JGI24750J21931_1002279 | JGI24750J21931_10022793 | 239 |
| 508 | 3300002074 | JGI24748J21848_1001179 | JGI24748J21848_10011793 | 239 |
| 509 | 3300002075 | JGI24738J21930_10001968 | JGI24738J21930_100019686 | 239 |
| 510 | 3300002076 | JGI24749J21850_1000794 | JGI24749J21850_10007942 | 239 |
| 511 | 3300002077 | JGI24744J21845_10001222 | JGI24744J21845_100012223 | 239 |
| 512 | 3300002126 | JGI24035J26624_1000436 | JGI24035J26624_10004363 | 239 |
| 513 | 3300002155 | JGI24033J26618_1002235 | JGI24033J26618_10022352 | 239 |
| 514 | 3300002239 | JGI24034J26672_10000405 | JGI24034J26672_100004053 | 239 |
| 515 | 3300002244 | JGI24742J22300_10000245 | JGI24742J22300_100002455 | 239 |
| 516 | 3300002459 | JGI24751J29686_10006394 | JGI24751J29686_100063942 | 239 |
| 517 | 3300005290 | Ga0065712_10001131 | Ga0065712_100011315 | 239 |
| 518 | 3300005290 | Ga0065712_10241510 | Ga0065712_102415101 | 239 |
| 519 | 3300005293 | Ga0065715_10000443 | Ga0065715_100004432 | 239 |
| 520 | 3300005328 | Ga0070676_10000464 | Ga0070676_1000046413 | 239 |
| 521 | 3300005329 | Ga0070683_100000585 | Ga0070683_1000005858 | 239 |
| 522 | 3300005330 | Ga0070690_100004127 | Ga0070690_1000041275 | 239 |
| 523 | 3300005331 | Ga0070670_100010943 | Ga0070670_1000109438 | 239 |
| 524 | 3300005333 | Ga0070677_10000046 | Ga0070677_1000004627 | 239 |
| 525 | 3300005334 | Ga0068869_100028330 | Ga0068869_1000283305 | 239 |
| 526 | 3300005335 | Ga0070666_10012206 | Ga0070666_100122065 | 239 |
| 527 | 3300005336 | Ga0070680_100043888 | Ga0070680_1000438883 | 239 |
| 528 | 3300005337 | Ga0070682_100001270 | Ga0070682_10000127013 | 239 |
| 529 | 3300005337 | Ga0070682_100040756 | Ga0070682_1000407564 | 239 |
| 530 | 3300005338 | Ga0068868_100002324 | Ga0068868_10000232410 | 239 |
| 531 | 3300005339 | Ga0070660_100001207 | Ga0070660_10000120714 | 239 |
| 532 | 3300005340 | Ga0070689_100005142 | Ga0070689_1000051426 | 239 |
| 533 | 3300005341 | Ga0070691_10003924 | Ga0070691_100039243 | 239 |
| 534 | 3300005343 | Ga0070687_100149722 | Ga0070687_1001497221 | 239 |
| 535 | 3300005344 | Ga0070661_100086226 | Ga0070661_1000862262 | 239 |
| 536 | 3300005345 | Ga0070692_10000212 | Ga0070692_1000021213 | 239 |
| 537 | 3300005347 | Ga0070668_100033083 | Ga0070668_1000330832 | 239 |
| 538 | 3300005353 | Ga0070669_100222875 | Ga0070669_1002228752 | 239 |
| 539 | 3300005354 | Ga0070675_100120641 | Ga0070675_1001206413 | 239 |
| 540 | 3300005355 | Ga0070671_100008864 | Ga0070671_1000088645 | 239 |
| 541 | 3300005356 | Ga0070674_100009575 | Ga0070674_1000095753 | 239 |
| 542 | 3300005364 | Ga0070673_100000632 | Ga0070673_10000063215 | 239 |
| 543 | 3300005365 | Ga0070688_100004634 | Ga0070688_1000046346 | 239 |
| 544 | 3300005366 | Ga0070659_100002503 | Ga0070659_10000250312 | 239 |
| 545 | 3300005367 | Ga0070667_100007002 | Ga0070667_1000070023 | 239 |
| 546 | 3300005438 | Ga0070701_10000116 | Ga0070701_1000011621 | 239 |
| 547 | 3300005440 | Ga0070705_100006545 | Ga0070705_1000065451 | 239 |
| 548 | 3300005441 | Ga0070700_100004259 | Ga0070700_1000042594 | 239 |
| 549 | 3300005444 | Ga0070694_100003022 | Ga0070694_1000030227 | 239 |
| 550 | 3300005445 | Ga0070708_100163082 | Ga0070708_1001630822 | 239 |
| 551 | 3300005456 | Ga0070678_100001304 | Ga0070678_1000013043 | 239 |
| 552 | 3300005458 | Ga0070681_10004628 | Ga0070681_100046283 | 239 |
| 553 | 3300005459 | Ga0068867_100000619 | Ga0068867_1000006195 | 239 |
| 554 | 3300005466 | Ga0070685_10000856 | Ga0070685_1000085616 | 239 |
| 555 | 3300005518 | Ga0070699_100544628 | Ga0070699_1005446281 | 239 |
| 556 | 3300005530 | Ga0070679_100035049 | Ga0070679_1000350495 | 239 |
| 557 | 3300005535 | Ga0070684_100006410 | Ga0070684_1000064106 | 239 |
| 558 | 3300005539 | Ga0068853_100001956 | Ga0068853_10000195612 | 239 |
| 559 | 3300005544 | Ga0070686_100001494 | Ga0070686_1000014943 | 239 |
| 560 | 3300005544 | Ga0070686_100153304 | Ga0070686_1001533042 | 239 |
| 561 | 3300005545 | Ga0070695_100007956 | Ga0070695_1000079565 | 239 |
| 562 | 3300005547 | Ga0070693_100001925 | Ga0070693_1000019259 | 239 |
| 563 | 3300005549 | Ga0070704_100000828 | Ga0070704_10000082813 | 239 |
| 564 | 3300005563 | Ga0068855_100004638 | Ga0068855_1000046384 | 239 |
| 565 | 3300005564 | Ga0070664_100003244 | Ga0070664_1000032443 | 239 |
| 566 | 3300005577 | Ga0068857_100004358 | Ga0068857_1000043583 | 239 |
| 567 | 3300005578 | Ga0068854_100007930 | Ga0068854_1000079303 | 239 |
| 568 | 3300005614 | Ga0068856_100023463 | Ga0068856_1000234637 | 239 |
| 569 | 3300005616 | Ga0068852_100005642 | Ga0068852_1000056425 | 239 |
| 570 | 3300005617 | Ga0068859_100011499 | Ga0068859_1000114996 | 239 |
| 571 | 3300005618 | Ga0068864_100000501 | Ga0068864_10000050136 | 239 |
| 572 | 3300005719 | Ga0068861_100001978 | Ga0068861_1000019783 | 239 |
| 573 | 3300005834 | Ga0068851_10112984 | Ga0068851_101129841 | 239 |
| 574 | 3300005840 | Ga0068870_10000104 | Ga0068870_100001044 | 239 |
| 575 | 3300005841 | Ga0068863_100060167 | Ga0068863_1000601673 | 239 |
| 576 | 3300005843 | Ga0068860_100007083 | Ga0068860_10000708313 | 239 |
| 577 | 3300005844 | Ga0068862_100002741 | Ga0068862_1000027413 | 239 |
| 578 | 3300006237 | Ga0097621_100000435 | Ga0097621_10000043521 | 239 |
| 579 | 3300006353 | Ga0075370_10047312 | Ga0075370_100473122 | 239 |
| 580 | 3300006358 | Ga0068871_100000485 | Ga0068871_1000004858 | 239 |
| 581 | 3300006852 | Ga0075433_10009783 | Ga0075433_100097837 | 239 |
| 582 | 3300006871 | Ga0075434_100015803 | Ga0075434_1000158034 | 239 |
| 583 | 3300006881 | Ga0068865_100020005 | Ga0068865_1000200053 | 239 |
| 584 | 3300006914 | Ga0075436_100135142 | Ga0075436_1001351422 | 239 |
| 585 | 3300006931 | Ga0097620_100011499 | Ga0097620_1000114996 | 239 |
| 586 | 3300007076 | Ga0075435_100075146 | Ga0075435_1000751462 | 239 |
| 587 | 3300009011 | Ga0105251_10063525 | Ga0105251_100635252 | 239 |
| 588 | 3300009036 | Ga0105244_10086357 | Ga0105244_100863572 | 239 |
| 589 | 3300009093 | Ga0105240_10118326 | Ga0105240_101183264 | 239 |
| 590 | 3300009094 | Ga0111539_10002680 | Ga0111539_100026804 | 239 |
| 591 | 3300009101 | Ga0105247_10038596 | Ga0105247_100385962 | 239 |
| 592 | 3300009148 | Ga0105243_10007567 | Ga0105243_100075672 | 239 |
| 593 | 3300009174 | Ga0105241_10000805 | Ga0105241_100008056 | 239 |
| 594 | 3300009176 | Ga0105242_10006128 | Ga0105242_100061285 | 239 |
| 595 | 3300009177 | Ga0105248_10002578 | Ga0105248_1000257814 | 239 |
| 596 | 3300009177 | Ga0105248_10031967 | Ga0105248_100319674 | 239 |
| 597 | 3300009545 | Ga0105237_10164683 | Ga0105237_101646833 | 239 |
| 598 | 3300009553 | Ga0105249_10017076 | Ga0105249_100170762 | 239 |
| 599 | 3300010375 | Ga0105239_10031376 | Ga0105239_100313762 | 239 |
| 600 | 3300011119 | Ga0105246_10001159 | Ga0105246_1000115913 | 239 |
| 601 | 3300013100 | Ga0157373_10054823 | Ga0157373_100548232 | 239 |
| 602 | 3300013102 | Ga0157371_10011034 | Ga0157371_100110346 | 239 |
| 603 | 3300013296 | Ga0157374_10025598 | Ga0157374_100255983 | 239 |
| 604 | 3300013297 | Ga0157378_10077255 | Ga0157378_100772552 | 239 |
| 605 | 3300013306 | Ga0163162_10022100 | Ga0163162_100221002 | 239 |
| 606 | 3300013307 | Ga0157372_10032836 | Ga0157372_100328363 | 239 |
| 607 | 3300013308 | Ga0157375_10008574 | Ga0157375_100085742 | 239 |
| 608 | 3300014325 | Ga0163163_10009906 | Ga0163163_100099069 | 239 |
| 609 | 3300014326 | Ga0157380_10001249 | Ga0157380_1000124913 | 239 |
| 610 | 3300014745 | Ga0157377_10017604 | Ga0157377_100176043 | 239 |
| 611 | 3300014968 | Ga0157379_10051388 | Ga0157379_100513883 | 239 |
| 612 | 3300014969 | Ga0157376_10000696 | Ga0157376_100006968 | 239 |
| 613 | 3300017792 | Ga0163161_10005280 | Ga0163161_100052802 | 239 |
| 614 | 3300025271 | Ga0207666_1000085 | Ga0207666_10000855 | 239 |
| 615 | 3300025315 | Ga0207697_10002998 | Ga0207697_100029985 | 239 |
| 616 | 3300025893 | Ga0207682_10003689 | Ga0207682_100036893 | 239 |
| 617 | 3300025899 | Ga0207642_10021746 | Ga0207642_100217463 | 239 |
| 618 | 3300025900 | Ga0207710_10002518 | Ga0207710_100025186 | 239 |
| 619 | 3300025901 | Ga0207688_10000088 | Ga0207688_1000008813 | 239 |
| 620 | 3300025903 | Ga0207680_10152854 | Ga0207680_101528541 | 239 |
| 621 | 3300025904 | Ga0207647_10011501 | Ga0207647_100115012 | 239 |
| 622 | 3300025907 | Ga0207645_10000668 | Ga0207645_100006688 | 239 |
| 623 | 3300025908 | Ga0207643_10000085 | Ga0207643_1000008535 | 239 |
| 624 | 3300025911 | Ga0207654_10000373 | Ga0207654_1000037320 | 239 |
| 625 | 3300025913 | Ga0207695_10198206 | Ga0207695_101982062 | 239 |
| 626 | 3300025917 | Ga0207660_10000370 | Ga0207660_1000037027 | 239 |
| 627 | 3300025918 | Ga0207662_10003085 | Ga0207662_100030855 | 239 |
| 628 | 3300025919 | Ga0207657_10011290 | Ga0207657_100112905 | 239 |
| 629 | 3300025923 | Ga0207681_10023297 | Ga0207681_100232973 | 239 |
| 630 | 3300025925 | Ga0207650_10004412 | Ga0207650_100044129 | 239 |
| 631 | 3300025926 | Ga0207659_10000200 | Ga0207659_1000020014 | 239 |
| 632 | 3300025927 | Ga0207687_10012599 | Ga0207687_100125992 | 239 |
| 633 | 3300025932 | Ga0207690_10007237 | Ga0207690_100072374 | 239 |
| 634 | 3300025933 | Ga0207706_10010392 | Ga0207706_100103925 | 239 |
| 635 | 3300025934 | Ga0207686_10000682 | Ga0207686_1000068220 | 239 |
| 636 | 3300025935 | Ga0207709_10124416 | Ga0207709_101244162 | 239 |
| 637 | 3300025936 | Ga0207670_10061073 | Ga0207670_100610732 | 239 |
| 638 | 3300025936 | Ga0207670_10143676 | Ga0207670_101436762 | 239 |
| 639 | 3300025937 | Ga0207669_10000129 | Ga0207669_1000012918 | 239 |
| 640 | 3300025938 | Ga0207704_10000366 | Ga0207704_100003663 | 239 |
| 641 | 3300025940 | Ga0207691_10006943 | Ga0207691_100069438 | 239 |
| 642 | 3300025941 | Ga0207711_10002466 | Ga0207711_1000246615 | 239 |
| 643 | 3300025942 | Ga0207689_10000547 | Ga0207689_1000054730 | 239 |
| 644 | 3300025944 | Ga0207661_10000373 | Ga0207661_1000037322 | 239 |
| 645 | 3300025945 | Ga0207679_10000558 | Ga0207679_100005586 | 239 |
| 646 | 3300025945 | Ga0207679_10090067 | Ga0207679_100900673 | 239 |
| 647 | 3300025949 | Ga0207667_10064488 | Ga0207667_100644882 | 239 |
| 648 | 3300025960 | Ga0207651_10000709 | Ga0207651_100007094 | 239 |
| 649 | 3300025972 | Ga0207668_10008583 | Ga0207668_100085836 | 239 |
| 650 | 3300025981 | Ga0207640_10011452 | Ga0207640_100114526 | 239 |
| 651 | 3300025986 | Ga0207658_10021810 | Ga0207658_100218102 | 239 |
| 652 | 3300026023 | Ga0207677_10004798 | Ga0207677_100047986 | 239 |
| 653 | 3300026041 | Ga0207639_10016724 | Ga0207639_100167243 | 239 |
| 654 | 3300026067 | Ga0207678_10005937 | Ga0207678_100059375 | 239 |
| 655 | 3300026075 | Ga0207708_10008554 | Ga0207708_100085545 | 239 |
| 656 | 3300026078 | Ga0207702_10174283 | Ga0207702_101742832 | 239 |
| 657 | 3300026088 | Ga0207641_10019914 | Ga0207641_100199145 | 239 |
| 658 | 3300026088 | Ga0207641_10187632 | Ga0207641_101876321 | 239 |
| 659 | 3300026089 | Ga0207648_10006768 | Ga0207648_100067689 | 239 |
| 660 | 3300026095 | Ga0207676_10017594 | Ga0207676_100175942 | 239 |
| 661 | 3300026116 | Ga0207674_10005267 | Ga0207674_100052675 | 239 |
| 662 | 3300026118 | Ga0207675_100011076 | Ga0207675_1000110765 | 239 |
| 663 | 3300026121 | Ga0207683_10001220 | Ga0207683_100012205 | 239 |
| 664 | 3300026142 | Ga0207698_10218209 | Ga0207698_102182092 | 239 |
| 665 | 3300027682 | Ga0209971_1014606 | Ga0209971_10146062 | 239 |
| 666 | 3300027876 | Ga0209974_10003102 | Ga0209974_100031024 | 239 |
| 667 | 3300027907 | Ga0207428_10000896 | Ga0207428_100008965 | 239 |
| 668 | 3300028381 | Ga0268264_10001202 | Ga0268264_100012025 | 239 |
| 669 | 3300034817 | Ga0373948_0000864 | Ga0373948_0000864_3160_4017 | 239 |
| 670 | 3300034957 | Ga0373938_0000788 | Ga0373938_0000788_3310_4167 | 239 |
| 671 | 3300035084 | Ga0373928_0002179 | Ga0373928_0002179_696_1553 | 239 |
| 672 | 3300035085 | Ga0373929_0008281 | Ga0373929_0008281_291_1148 | 239 |
| 673 | 3300035090 | Ga0373949_0002890 | Ga0373949_0002890_485_1342 | 239 |
| 674 | 3300035091 | Ga0373951_0004633 | Ga0373951_0004633_544_1401 | 239 |
| 675 | 3300035092 | Ga0373952_0002634 | Ga0373952_0002634_1790_2647 | 239 |
| 676 | 3300035112 | Ga0373932_0000963 | Ga0373932_0000963_3814_4671 | 239 |
| 677 | 3300035114 | Ga0373939_0000862 | Ga0373939_0000862_6179_7036 | 239 |
| 678 | 3300035115 | Ga0373941_0011994 | Ga0373941_0011994_1341_2198 | 239 |
| 679 | 3300035121 | Ga0373960_0027787 | Ga0373960_0027787_291_1148 | 239 |
| 680 | 3300035241 | Ga0373961_0005311 | Ga0373961_0005311_493_1350 | 239 |
| 681 | 3300035242 | Ga0373962_0007887 | Ga0373962_0007887_1345_2202 | 239 |
| 682 | 3300035691 | Ga0373931_0013241 | Ga0373931_0013241_539_1396 | 239 |
| 683 | 3300035691 | Ga0373931_0279804 | Ga0373931_0279804_68_925 | 239 |
| 684 | 3300039447 | Ga0436361_0570470 | Ga0436361_0570470_809_1663 | 239 |
| 685 | 3300046491 | Ga0495584_0022014 | Ga0495584_0022014_91_948 | 239 |
| 686 | 3300046684 | Ga0495669_0078650 | Ga0495669_0078650_427_1284 | 239 |
| 687 | 3300048903 | Ga0496100_0019839 | Ga0496100_0019839_1853_2710 | 239 |
| 688 | 3300048904 | Ga0496101_0012308 | Ga0496101_0012308_260_1117 | 239 |
| 689 | 3300048907 | Ga0496104_0143355 | Ga0496104_0143355_1049_1906 | 239 |
| 690 | 3300048909 | Ga0496106_0009382 | Ga0496106_0009382_1451_2308 | 239 |
| 691 | 3300048910 | Ga0496107_0007600 | Ga0496107_0007600_3012_3869 | 239 |
| 692 | 3300048910 | Ga0496107_0198403 | Ga0496107_0198403_606_1463 | 239 |
| 693 | 3300048911 | Ga0496108_0001956 | Ga0496108_0001956_7630_8487 | 239 |
| 694 | 3300048911 | Ga0496108_0033980 | Ga0496108_0033980_896_1753 | 239 |
| 695 | 3300048912 | Ga0496109_0003867 | Ga0496109_0003867_7896_8753 | 239 |
| 696 | 3300048912 | Ga0496109_0065297 | Ga0496109_0065297_229_1086 | 239 |
| 697 | 3300048913 | Ga0496110_0020613 | Ga0496110_0020613_4595_5452 | 239 |
| 698 | 3300048915 | Ga0496112_0011458 | Ga0496112_0011458_3419_4276 | 239 |
| 699 | 3300048916 | Ga0496113_0000507 | Ga0496113_0000507_10302_11159 | 239 |
| 700 | 3300048916 | Ga0496113_0098034 | Ga0496113_0098034_468_1325 | 239 |
| 701 | 3300048918 | Ga0496115_0022877 | Ga0496115_0022877_688_1545 | 239 |
| 702 | 3300050511 | nmdc:mga08y16_81856_c1 | nmdc:mga08y16_81856_c1_1853_2710 | 239 |
| 703 | 3300050512 | nmdc:mga0n895_26501_c1 | nmdc:mga0n895_26501_c1_3738_4595 | 239 |
| 704 | 3300050513 | nmdc:mga0rr50_114052_c1 | nmdc:mga0rr50_114052_c1_1270_2127 | 239 |
| 705 | 3300000652 | ARCol0yngRDRAFT_1000324 | ARCol0yngRDRAFT_10003244 | 240 |
| 706 | 3300001989 | JGI24739J22299_10074482 | JGI24739J22299_100744821 | 240 |
| 707 | 3300005344 | Ga0070661_100265548 | Ga0070661_1002655482 | 240 |
| 708 | 3300005564 | Ga0070664_100153061 | Ga0070664_1001530612 | 240 |
| 709 | 3300006871 | Ga0075434_100127719 | Ga0075434_1001277192 | 240 |
| 710 | 3300009148 | Ga0105243_10077915 | Ga0105243_100779152 | 240 |
| 711 | 3300009553 | Ga0105249_10742639 | Ga0105249_107426392 | 240 |
| 712 | 3300014968 | Ga0157379_10284326 | Ga0157379_102843262 | 240 |
| 713 | 3300025935 | Ga0207709_10089042 | Ga0207709_100890422 | 240 |
| 714 | 3300027617 | Ga0210002_1001426 | Ga0210002_10014262 | 240 |
| 715 | 3300027717 | Ga0209998_10005638 | Ga0209998_100056382 | 240 |
| 716 | 3300031241 | Ga0265325_10070566 | Ga0265325_100705662 | 240 |
| 717 | 3300032133 | Ga0316583_10000114 | Ga0316583_100001149 | 240 |
| 718 | 3300035114 | Ga0373939_0001546 | Ga0373939_0001546_4039_4902 | 240 |
| 719 | 3300035692 | Ga0373935_0051714 | Ga0373935_0051714_1471_2328 | 240 |
| 720 | 3300046526 | Ga0495666_0102814 | Ga0495666_0102814_414_1271 | 240 |
| 721 | 3300046681 | Ga0495647_0145225 | Ga0495647_0145225_27_884 | 240 |
| 722 | 3300046683 | Ga0495658_0261294 | Ga0495658_0261294_202_1059 | 240 |
| 723 | 3300048914 | Ga0496111_0009164 | Ga0496111_0009164_4029_4889 | 240 |
| 724 | 3300048915 | Ga0496112_0088275 | Ga0496112_0088275_1590_2447 | 240 |
| 725 | 3300050512 | nmdc:mga0n895_176560_c1 | nmdc:mga0n895_176560_c1_660_1559 | 240 |
| 726 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_527088_527975 | 240 |
| 727 | iso_pu_bacteria | 8054002106 | 8054007663 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
67
237
0.85
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar