F477719

General Info

Members Datasets Scaffolds Average Seq Length
727 500 578 270

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10074482|JGI24739J22299_100744821
Length 240
Sequence MAATFQSSLYASRRRRNRISMGLAFAATAFGLSWLVLILAVLLWEGFSGLSLAVFTEMTPPPGSSGGLLNPIVMAEYGRYDRLTTVVRFINDILLSAPSIVVGLFVYEVMVAQMGHFSGWAGAVSLAVIVVPVVVRTTEDMLILVPDTLREAAASIGLPRSLMITXVAYRAALFTALNNQFWSLNLNAPVASLPVVIFQFALSPYHDWQKLAWTGALIITLAVLALSIIARTLAAQRKTS

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
6 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
7 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
10 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
11 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
12 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
13 2643221621 Achromobacter sp. Root83 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
16 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
17 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
18 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
19 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
20 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
21 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
22 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
23 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
24 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
25 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
26 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
29 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
30 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
31 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
32 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
33 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
34 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
35 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
36 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
37 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
38 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
39 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
40 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
41 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
42 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
43 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
44 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
45 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
46 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
47 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
48 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
49 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
50 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
51 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
52 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
53 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
54 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
55 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
56 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
57 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
58 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
59 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
60 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
61 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
62 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
63 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
64 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
65 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
66 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
67 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
68 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
69 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
70 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
71 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
72 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
73 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
74 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
75 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
76 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
77 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
78 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
79 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
80 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
81 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
82 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
83 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
84 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
85 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
86 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
87 2941479691
88 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
89 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
90 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
91 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
92 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
93 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
94 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
95 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
96 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
97 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
98 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
99 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
100 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
101 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
102 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
103 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
104 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
105 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
106 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
107 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
108 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
109 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
110 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
111 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
112 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
113 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
114 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
115 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
116 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
117 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
118 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
119 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
120 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
121 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
122 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
123 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
124 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
125 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
126 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
127 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
128 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
129 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
130 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
131 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
132 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
133 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
134 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
135 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
136 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
137 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
138 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
139 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
140 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
141 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
142 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
143 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
144 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
145 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
146 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
147 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
148 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
149 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
150 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
151 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
152 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
153 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
154 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
155 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
156 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
157 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
159 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
160 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
161 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
162 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
163 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
164 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
165 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
166 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
167 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
168 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
169 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
170 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
171 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
185 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
186 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
187 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
188 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
189 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
192 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
193 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
194 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
195 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
196 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
197 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
198 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
199 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
200 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
201 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
202 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
203 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
204 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
205 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
206 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
207 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
208 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
209 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
210 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
211 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
212 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
213 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
214 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
215 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
216 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
217 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
218 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
219 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
220 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
221 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
222 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
223 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
224 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
225 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
227 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
228 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
229 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
230 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
231 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
232 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
233 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
234 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
235 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
236 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
237 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
238 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
239 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
240 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
241 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
242 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
243 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
244 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
245 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
246 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
247 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
248 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
249 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
250 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
251 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
252 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
253 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
254 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
255 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
256 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
257 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
258 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
259 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
260 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
261 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
262 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
263 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
264 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
265 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
266 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
268 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
330 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
331 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
335 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
336 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
337 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
338 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
339 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
340 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
341 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
342 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
343 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
344 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
345 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
346 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
347 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
348 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
349 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
350 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
351 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
352 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
353 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
354 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
355 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
356 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
357 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
358 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
359 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
360 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
362 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
363 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
364 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
365 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
366 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
367 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
368 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
369 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
370 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
371 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
372 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
373 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
374 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
375 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
376 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
377 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
378 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
379 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
380 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
382 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
383 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
384 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
385 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
386 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
387 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
388 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
389 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
390 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
391 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
392 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
393 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
394 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
395 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
396 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
397 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
398 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
399 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
400 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
401 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
402 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
403 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
404 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
405 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
406 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
407 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
408 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
409 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
410 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
411 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
412 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
413 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
414 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
415 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
416 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
417 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
418 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
419 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
420 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
421 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
422 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
423 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
424 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
425 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
426 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
427 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
428 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
429 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
430 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
431 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
432 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
433 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
434 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
435 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
436 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
437 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
438 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
439 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
440 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
441 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
442 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
443 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
444 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
445 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
446 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
447 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
448 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
452 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
453 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
454 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
455 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
456 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
457 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
468 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
469 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
470 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
471 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
472 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
473 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
474 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
475 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
476 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
477 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
478 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
479 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
480 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
481 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
482 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
483 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
484 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
485 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
486 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
487 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
490 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
491 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
492 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
493 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
494 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
495 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
496 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
497 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
498 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
499 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
500 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 79.5
Metatranscriptomes 0
Isolates 20.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 15.41
Rhizoplane 5.23
Rhizosphere 73.31
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARCol0yngRDRAFT_1000324 3300000652 Bacteria 7130
2 JGI24746J21847_1000674 3300001977 Bacteria 5230
3 JGI24739J22299_10004845 3300001989 Bacteria 5129
4 JGI24739J22299_10074482 3300001989 Bacteria 1051
5 JGI24737J22298_10005956 3300001990 Bacteria 4187
6 JGI24750J21931_1002279 3300002070 Bacteria 2322
7 JGI24748J21848_1001179 3300002074 Bacteria 2851
8 JGI24738J21930_10001968 3300002075 Bacteria 5524
9 JGI24749J21850_1000794 3300002076 Bacteria 4538
10 JGI24744J21845_10001222 3300002077 Bacteria 5034
11 JGI24035J26624_1000436 3300002126 Bacteria 3940
12 JGI24033J26618_1002235 3300002155 Bacteria 1962
13 JGI24034J26672_10000405 3300002239 Bacteria 5579
14 JGI24742J22300_10000245 3300002244 Bacteria 8087
15 JGI24751J29686_10006394 3300002459 Bacteria 2400
16 JGI25160J50197_1010041 3300003354 Bacteria 3458
17 JGI25404J52841_10003799 3300003659 Bacteria 3015
18 Ga0065712_10001131 3300005290 Bacteria 11020
19 Ga0065712_10241510 3300005290 Bacteria 983
20 Ga0065715_10000443 3300005293 Bacteria 13431
21 Ga0070676_10000464 3300005328 Bacteria 19426
22 Ga0070676_10026538 3300005328 Bacteria 3280
23 Ga0070683_100000585 3300005329 Bacteria 26003
24 Ga0070690_100004127 3300005330 Bacteria 8043
25 Ga0070690_100005765 3300005330 Bacteria 6979
26 Ga0070670_100010943 3300005331 Bacteria 7750
27 Ga0070677_10000046 3300005333 Bacteria 38785
28 Ga0068869_100028330 3300005334 Bacteria 3913
29 Ga0068869_100034606 3300005334 Bacteria 3575
30 Ga0070666_10012206 3300005335 Bacteria 5413
31 Ga0070680_100043888 3300005336 Bacteria 3632
32 Ga0070682_100001270 3300005337 Bacteria 14321
33 Ga0070682_100040756 3300005337 Bacteria 2859
34 Ga0068868_100002324 3300005338 Bacteria 13150
35 Ga0068868_100230861 3300005338 Bacteria 1552
36 Ga0070660_100001207 3300005339 Bacteria 17536
37 Ga0070689_100005142 3300005340 Bacteria 8898
38 Ga0070689_100049104 3300005340 Bacteria 3257
39 Ga0070689_100470882 3300005340 Bacteria 1072
40 Ga0070689_100484771 3300005340 Bacteria 1057
41 Ga0070691_10003924 3300005341 Bacteria 6729
42 Ga0070687_100072675 3300005343 Bacteria 1852
43 Ga0070687_100108054 3300005343 Bacteria 1570
44 Ga0070687_100149722 3300005343 Bacteria 1368
45 Ga0070661_100086226 3300005344 Bacteria 2321
46 Ga0070661_100172735 3300005344 Bacteria 1642
47 Ga0070661_100238990 3300005344 Bacteria 1398
48 Ga0070661_100265548 3300005344 Bacteria 1328
49 Ga0070692_10000212 3300005345 Bacteria 15753
50 Ga0070668_100033083 3300005347 Bacteria 3935
51 Ga0070668_100073512 3300005347 Bacteria 2665
52 Ga0070668_100160282 3300005347 Bacteria 1825
53 Ga0070669_100222875 3300005353 Bacteria 1491
54 Ga0070675_100120641 3300005354 Bacteria 2227
55 Ga0070675_100130395 3300005354 Bacteria 2142
56 Ga0070675_100253106 3300005354 Bacteria 1542
57 Ga0070671_100008864 3300005355 Bacteria 8071
58 Ga0070671_100123364 3300005355 Bacteria 2181
59 Ga0070674_100004876 3300005356 Bacteria 7689
60 Ga0070674_100009575 3300005356 Bacteria 5804
61 Ga0070674_100041789 3300005356 Bacteria 3110
62 Ga0070674_100088270 3300005356 Bacteria 2231
63 Ga0070673_100000632 3300005364 Bacteria 19293
64 Ga0070688_100004634 3300005365 Bacteria 7178
65 Ga0070688_100007302 3300005365 Bacteria 5952
66 Ga0070659_100002503 3300005366 Bacteria 13048
67 Ga0070667_100007002 3300005367 Bacteria 9373
68 Ga0070667_100056496 3300005367 Bacteria 3316
69 Ga0070714_100177943 3300005435 Bacteria 1934
70 Ga0070714_100374512 3300005435 Bacteria 1341
71 Ga0070710_10084507 3300005437 Bacteria 1860
72 Ga0070701_10000116 3300005438 Bacteria 23157
73 Ga0070711_100040960 3300005439 Bacteria 3126
74 Ga0070705_100006545 3300005440 Bacteria 5718
75 Ga0070705_100322455 3300005440 Bacteria 1116
76 Ga0070700_100004259 3300005441 Bacteria 7469
77 Ga0070694_100003022 3300005444 Bacteria 10020
78 Ga0070708_100163082 3300005445 Bacteria 2078
79 Ga0070678_100001304 3300005456 Bacteria 13226
80 Ga0070678_100039306 3300005456 Bacteria 3336
81 Ga0070681_10004628 3300005458 Bacteria 13135
82 Ga0068867_100000619 3300005459 Bacteria 23562
83 Ga0070685_10000856 3300005466 Bacteria 16575
84 Ga0070699_100544628 3300005518 Bacteria 1056
85 Ga0070679_100035049 3300005530 Bacteria 4977
86 Ga0070679_100342111 3300005530 Bacteria 1444
87 Ga0070684_100006410 3300005535 Bacteria 9104
88 Ga0068853_100001956 3300005539 Bacteria 15182
89 Ga0068853_100457985 3300005539 Bacteria 1200
90 Ga0070672_100195097 3300005543 Bacteria 1692
91 Ga0070672_100210276 3300005543 Bacteria 1629
92 Ga0070686_100001494 3300005544 Bacteria 13151
93 Ga0070686_100153304 3300005544 Bacteria 1616
94 Ga0070695_100007956 3300005545 Bacteria 6278
95 Ga0070695_100249970 3300005545 Bacteria 1290
96 Ga0070695_100493746 3300005545 Bacteria 945
97 Ga0070696_100000163 3300005546 Bacteria 37742
98 Ga0070696_100016860 3300005546 Bacteria 4927
99 Ga0070693_100001925 3300005547 Bacteria 9497
100 Ga0070693_100107983 3300005547 Bacteria 1707
101 Ga0070665_100266959 3300005548 Bacteria 1713
102 Ga0070704_100000828 3300005549 Bacteria 15365
103 Ga0070704_100010271 3300005549 Bacteria 5692
104 Ga0070704_100347049 3300005549 Bacteria 1252
105 Ga0068855_100004638 3300005563 Bacteria 16774
106 Ga0068855_100058338 3300005563 Bacteria 4521
107 Ga0070664_100003244 3300005564 Bacteria 13145
108 Ga0070664_100098438 3300005564 Bacteria 2541
109 Ga0070664_100114627 3300005564 Bacteria 2355
110 Ga0070664_100153061 3300005564 Bacteria 2037
111 Ga0068857_100004358 3300005577 Bacteria 11953
112 Ga0068854_100007930 3300005578 Bacteria 6797
113 Ga0068856_100023463 3300005614 Bacteria 5998
114 Ga0070702_100106881 3300005615 Bacteria 1727
115 Ga0068852_100005642 3300005616 Bacteria 8977
116 Ga0068852_100329719 3300005616 Bacteria 1485
117 Ga0068859_100011499 3300005617 Bacteria 8898
118 Ga0068859_100113389 3300005617 Bacteria 2775
119 Ga0068859_100240402 3300005617 Bacteria 1900
120 Ga0068864_100000501 3300005618 Bacteria 33748
121 Ga0068866_10226062 3300005718 Bacteria 1132
122 Ga0068866_10227188 3300005718 Bacteria 1130
123 Ga0068861_100001978 3300005719 Bacteria 13227
124 Ga0068861_100074120 3300005719 Bacteria 2646
125 Ga0068861_100152384 3300005719 Bacteria 1898
126 Ga0068851_10112984 3300005834 Bacteria 1452
127 Ga0068870_10000104 3300005840 Bacteria 28590
128 Ga0068870_10201145 3300005840 Bacteria 1208
129 Ga0068863_100060167 3300005841 Bacteria 3592
130 Ga0068863_100566106 3300005841 Bacteria 1123
131 Ga0068860_100007083 3300005843 Bacteria 11216
132 Ga0068860_100062955 3300005843 Bacteria 3525
133 Ga0068862_100002741 3300005844 Bacteria 15462
134 Ga0068862_100053868 3300005844 Bacteria 3444
135 Ga0081455_10000058 3300005937 Bacteria 119171
136 Ga0081455_10046358 3300005937 Bacteria 3772
137 Ga0081540_1000040 3300005983 Bacteria 136968
138 Ga0081540_1001972 3300005983 Bacteria 17123
139 Ga0070712_100242412 3300006175 Bacteria 1436
140 Ga0097621_100000435 3300006237 Bacteria 29115
141 Ga0097621_100004339 3300006237 Bacteria 9857
142 Ga0075370_10047312 3300006353 Bacteria 2436
143 Ga0068871_100000485 3300006358 Bacteria 27172
144 Ga0068871_100021625 3300006358 Bacteria 4947
145 Ga0075433_10009783 3300006852 Bacteria 7681
146 Ga0075434_100015803 3300006871 Bacteria 7246
147 Ga0075434_100017752 3300006871 Bacteria 6861
148 Ga0075434_100127719 3300006871 Bacteria 2560
149 Ga0068865_100020005 3300006881 Bacteria 4339
150 Ga0075436_100042432 3300006914 Bacteria 3137
151 Ga0075436_100135142 3300006914 Bacteria 1731
152 Ga0097620_100011499 3300006931 Bacteria 8898
153 Ga0097620_100113388 3300006931 Bacteria 2775
154 Ga0097620_100240392 3300006931 Bacteria 1900
155 Ga0075435_100075146 3300007076 Bacteria 2766
156 Ga0099794_10002565 3300007265 Bacteria 6737
157 Ga0105251_10063525 3300009011 Bacteria 1732
158 Ga0105244_10086357 3300009036 Bacteria 1547
159 Ga0105240_10118326 3300009093 Bacteria 3193
160 Ga0111539_10002680 3300009094 Bacteria 23585
161 Ga0105245_10004478 3300009098 Bacteria 12348
162 Ga0105247_10038596 3300009101 Bacteria 2916
163 Ga0114129_10345101 3300009147 Bacteria 1973
164 Ga0105243_10007567 3300009148 Bacteria 8346
165 Ga0105243_10077915 3300009148 Bacteria 2697
166 Ga0105243_10087044 3300009148 Bacteria 2563
167 Ga0105243_10386443 3300009148 Bacteria 1296
168 Ga0105241_10000805 3300009174 Bacteria 23823
169 Ga0105242_10006128 3300009176 Bacteria 9267
170 Ga0105248_10002578 3300009177 Bacteria 20136
171 Ga0105248_10031967 3300009177 Bacteria 5880
172 Ga0105248_10080229 3300009177 Bacteria 3667
173 Ga0105237_10164683 3300009545 Bacteria 2216
174 Ga0105237_10366546 3300009545 Bacteria 1445
175 Ga0105249_10004666 3300009553 Bacteria 11833
176 Ga0105249_10017076 3300009553 Bacteria 6440
177 Ga0105249_10151280 3300009553 Bacteria 2235
178 Ga0105249_10742639 3300009553 Bacteria 1043
179 Ga0099796_10009527 3300010159 Bacteria 2633
180 Ga0105239_10031376 3300010375 Bacteria 5845
181 Ga0105239_10176046 3300010375 Bacteria 2393
182 Ga0105239_10481063 3300010375 Bacteria 1410
183 Ga0105246_10001159 3300011119 Bacteria 15299
184 Ga0105246_10049107 3300011119 Bacteria 2888
185 Ga0157373_10054823 3300013100 Bacteria 2832
186 Ga0157371_10011034 3300013102 Bacteria 6999
187 Ga0157370_10052855 3300013104 Bacteria 3876
188 Ga0157369_10027808 3300013105 Bacteria 6265
189 Ga0157374_10025598 3300013296 Bacteria 5301
190 Ga0157374_10074714 3300013296 Bacteria 3201
191 Ga0157378_10077255 3300013297 Bacteria 3001
192 Ga0163162_10022100 3300013306 Bacteria 6268
193 Ga0163162_10310051 3300013306 Bacteria 1710
194 Ga0157372_10032836 3300013307 Bacteria 5694
195 Ga0157372_10168578 3300013307 Bacteria 2533
196 Ga0157372_10401283 3300013307 Bacteria 1598
197 Ga0157375_10008574 3300013308 Bacteria 8951
198 Ga0157375_10056545 3300013308 Bacteria 3874
199 Ga0163163_10009906 3300014325 Bacteria 8543
200 Ga0163163_10132831 3300014325 Bacteria 2529
201 Ga0157380_10001249 3300014326 Bacteria 16513
202 Ga0157377_10017604 3300014745 Bacteria 3697
203 Ga0157379_10051388 3300014968 Bacteria 3682
204 Ga0157379_10079841 3300014968 Bacteria 2930
205 Ga0157379_10284326 3300014968 Bacteria 1505
206 Ga0157376_10000696 3300014969 Bacteria 21738
207 Ga0163161_10005280 3300017792 Bacteria 8992
208 Ga0163161_10102547 3300017792 Bacteria 2131
209 Ga0163161_10128666 3300017792 Bacteria 1908
210 Ga0207666_1000085 3300025271 Bacteria 15395
211 Ga0207426_1001988 3300025302 Bacteria 14453
212 Ga0207697_10002998 3300025315 Bacteria 8507
213 Ga0207682_10003689 3300025893 Bacteria 6596
214 Ga0207692_10027566 3300025898 Bacteria 2678
215 Ga0207642_10021746 3300025899 Bacteria 2531
216 Ga0207710_10002518 3300025900 Bacteria 8472
217 Ga0207688_10000088 3300025901 Bacteria 35438
218 Ga0207680_10126448 3300025903 Bacteria 1679
219 Ga0207680_10152854 3300025903 Bacteria 1540
220 Ga0207647_10011501 3300025904 Bacteria 6205
221 Ga0207699_10036268 3300025906 Bacteria 2810
222 Ga0207645_10000668 3300025907 Bacteria 28444
223 Ga0207643_10000085 3300025908 Bacteria 61372
224 Ga0207654_10000373 3300025911 Bacteria 26098
225 Ga0207707_10300669 3300025912 Bacteria 1388
226 Ga0207695_10198206 3300025913 Bacteria 1923
227 Ga0207693_10294937 3300025915 Bacteria 1270
228 Ga0207663_10010118 3300025916 Bacteria 5005
229 Ga0207663_10097006 3300025916 Bacteria 1970
230 Ga0207663_10220766 3300025916 Bacteria 1379
231 Ga0207660_10000370 3300025917 Bacteria 29368
232 Ga0207662_10003085 3300025918 Bacteria 8502
233 Ga0207662_10130480 3300025918 Bacteria 1584
234 Ga0207657_10011290 3300025919 Bacteria 8871
235 Ga0207657_10026202 3300025919 Bacteria 5362
236 Ga0207652_10287797 3300025921 Bacteria 1483
237 Ga0207681_10023297 3300025923 Bacteria 3958
238 Ga0207681_10027141 3300025923 Bacteria 3700
239 Ga0207650_10004412 3300025925 Bacteria 9614
240 Ga0207659_10000200 3300025926 Bacteria 35764
241 Ga0207687_10012599 3300025927 Bacteria 5524
242 Ga0207687_10102604 3300025927 Bacteria 2108
243 Ga0207664_10333367 3300025929 Bacteria 1340
244 Ga0207664_10371216 3300025929 Bacteria 1269
245 Ga0207664_10459886 3300025929 Bacteria 1136
246 Ga0207690_10007237 3300025932 Bacteria 6590
247 Ga0207706_10010392 3300025933 Bacteria 8502
248 Ga0207706_10044539 3300025933 Bacteria 3933
249 Ga0207706_10056312 3300025933 Bacteria 3467
250 Ga0207686_10000682 3300025934 Bacteria 21032
251 Ga0207709_10088812 3300025935 Bacteria 2013
252 Ga0207709_10089042 3300025935 Bacteria 2011
253 Ga0207709_10124416 3300025935 Bacteria 1747
254 Ga0207670_10003994 3300025936 Bacteria 7878
255 Ga0207670_10061073 3300025936 Bacteria 2570
256 Ga0207670_10143676 3300025936 Bacteria 1762
257 Ga0207669_10000129 3300025937 Bacteria 37620
258 Ga0207669_10005810 3300025937 Bacteria 5579
259 Ga0207669_10087242 3300025937 Bacteria 2020
260 Ga0207669_10128558 3300025937 Bacteria 1736
261 Ga0207704_10000366 3300025938 Bacteria 20998
262 Ga0207691_10006943 3300025940 Bacteria 10919
263 Ga0207691_10187670 3300025940 Bacteria 1804
264 Ga0207711_10002466 3300025941 Bacteria 16510
265 Ga0207689_10000547 3300025942 Bacteria 35807
266 Ga0207661_10000373 3300025944 Bacteria 28733
267 Ga0207679_10000558 3300025945 Bacteria 25037
268 Ga0207679_10090067 3300025945 Bacteria 2370
269 Ga0207679_10121096 3300025945 Bacteria 2083
270 Ga0207667_10064488 3300025949 Bacteria 3824
271 Ga0207667_10129733 3300025949 Bacteria 2596
272 Ga0207651_10000709 3300025960 Bacteria 14279
273 Ga0207712_10026229 3300025961 Bacteria 3880
274 Ga0207668_10008583 3300025972 Bacteria 6097
275 Ga0207640_10011452 3300025981 Bacteria 5025
276 Ga0207658_10021810 3300025986 Bacteria 4451
277 Ga0207658_10050537 3300025986 Bacteria 3060
278 Ga0207658_10319098 3300025986 Bacteria 1344
279 Ga0207677_10004798 3300026023 Bacteria 7296
280 Ga0207703_10056580 3300026035 Bacteria 3195
281 Ga0207639_10016724 3300026041 Bacteria 5196
282 Ga0207678_10005937 3300026067 Bacteria 10876
283 Ga0207708_10008554 3300026075 Bacteria 7572
284 Ga0207702_10174283 3300026078 Bacteria 1975
285 Ga0207702_10239932 3300026078 Bacteria 1698
286 Ga0207641_10019914 3300026088 Bacteria 5507
287 Ga0207641_10187632 3300026088 Bacteria 1898
288 Ga0207648_10006768 3300026089 Bacteria 11365
289 Ga0207648_10110694 3300026089 Bacteria 2411
290 Ga0207676_10017594 3300026095 Bacteria 5182
291 Ga0207674_10005267 3300026116 Bacteria 15394
292 Ga0207675_100011076 3300026118 Bacteria 8448
293 Ga0207675_100016474 3300026118 Bacteria 6903
294 Ga0207675_100193673 3300026118 Bacteria 1950
295 Ga0207683_10001220 3300026121 Bacteria 23334
296 Ga0207683_10047329 3300026121 Bacteria 3766
297 Ga0207683_10050477 3300026121 Bacteria 3644
298 Ga0207698_10218209 3300026142 Bacteria 1721
299 Ga0210002_1001426 3300027617 Bacteria 3365
300 Ga0209588_1022691 3300027671 Bacteria 1975
301 Ga0209971_1014606 3300027682 Bacteria 1861
302 Ga0209998_10005638 3300027717 Bacteria 2613
303 Ga0209974_10003102 3300027876 Bacteria 6014
304 Ga0207428_10000896 3300027907 Bacteria 33348
305 Ga0265356_1000342 3300028017 Bacteria 8549
306 Ga0268266_10284316 3300028379 Bacteria 1539
307 Ga0268265_10036599 3300028380 Bacteria 3596
308 Ga0268265_10394579 3300028380 Bacteria 1277
309 Ga0268264_10001202 3300028381 Bacteria 24970
310 Ga0268264_10451050 3300028381 Bacteria 1246
311 Ga0265318_10008960 3300028577 Bacteria 4429
312 Ga0265338_10012346 3300028800 Bacteria 9741
313 Ga0265338_10051978 3300028800 Bacteria 3683
314 Ga0265332_10000302 3300031238 Bacteria 38680
315 Ga0265320_10009572 3300031240 Bacteria 5837
316 Ga0265325_10025211 3300031241 Bacteria 3230
317 Ga0265325_10070566 3300031241 Bacteria 1755
318 Ga0265329_10004247 3300031242 Bacteria 6017
319 Ga0265329_10004407 3300031242 Bacteria 5864
320 Ga0265340_10010544 3300031247 Bacteria 4941
321 Ga0265340_10027558 3300031247 Bacteria 2863
322 Ga0265339_10003035 3300031249 Bacteria 11826
323 Ga0265339_10007030 3300031249 Bacteria 7306
324 Ga0265331_10000008 3300031250 Bacteria 324311
325 Ga0265331_10048154 3300031250 Bacteria 2050
326 Ga0265331_10093620 3300031250 Bacteria 1387
327 Ga0265327_10000036 3300031251 Bacteria 312827
328 Ga0265316_10016415 3300031344 Bacteria 6423
329 Ga0265316_10078651 3300031344 Bacteria 2531
330 Ga0307509_10170214 3300031507 Bacteria 2059
331 Ga0265313_10015432 3300031595 Bacteria 4447
332 Ga0265313_10017884 3300031595 Bacteria 4004
333 Ga0265313_10074718 3300031595 Bacteria 1553
334 Ga0316575_10004946 3300031665 Bacteria 4712
335 Ga0265314_10047002 3300031711 Bacteria 3041
336 Ga0265314_10084052 3300031711 Bacteria 2090
337 Ga0265314_10235500 3300031711 Bacteria 1059
338 Ga0265342_10000238 3300031712 Bacteria 61599
339 Ga0265342_10012970 3300031712 Bacteria 5618
340 Ga0265342_10017724 3300031712 Bacteria 4625
341 Ga0265342_10130998 3300031712 Bacteria 1405
342 Ga0307516_10000209 3300031730 Bacteria 75193
343 Ga0307518_10165693 3300031838 Bacteria 1513
344 Ga0316583_10000114 3300032133 Bacteria 18718
345 Ga0373948_0000864 3300034817 Bacteria 4037
346 Ga0373938_0000788 3300034957 Bacteria 5154
347 Ga0373928_0002179 3300035084 Bacteria 3818
348 Ga0373929_0008281 3300035085 Bacteria 1914
349 Ga0373949_0002890 3300035090 Bacteria 4241
350 Ga0373951_0004633 3300035091 Bacteria 3252
351 Ga0373952_0002634 3300035092 Bacteria 3236
352 Ga0373923_0012857 3300035111 Bacteria 3107
353 Ga0373932_0000963 3300035112 Bacteria 8409
354 Ga0373936_0000312 3300035113 Bacteria 16371
355 Ga0373939_0000862 3300035114 Bacteria 7514
356 Ga0373939_0001546 3300035114 Bacteria 5585
357 Ga0373939_0065862 3300035114 Bacteria 1167
358 Ga0373941_0011994 3300035115 Bacteria 2254
359 Ga0373945_0123738 3300035116 Bacteria 1030
360 Ga0373953_0013356 3300035117 Bacteria 2932
361 Ga0373956_0005026 3300035119 Bacteria 5299
362 Ga0373960_0027787 3300035121 Bacteria 1556
363 Ga0373955_0000333 3300035172 Bacteria 19680
364 Ga0373955_0002441 3300035172 Bacteria 8114
365 Ga0373961_0005311 3300035241 Bacteria 3097
366 Ga0373961_0005859 3300035241 Bacteria 2952
367 Ga0373961_0046193 3300035241 Bacteria 1276
368 Ga0373962_0007887 3300035242 Bacteria 2612
369 Ga0316574_0159931 3300035398 Bacteria 1451
370 Ga0373924_0002927 3300035410 Bacteria 5793
371 Ga0373931_0011811 3300035691 Bacteria 4222
372 Ga0373931_0013241 3300035691 Bacteria 4013
373 Ga0373931_0279804 3300035691 Bacteria 1024
374 Ga0373935_0000097 3300035692 Bacteria 38808
375 Ga0373935_0051714 3300035692 Bacteria 2610
376 Ga0373935_0346383 3300035692 Bacteria 1058
377 Ga0373927_0010654 3300035695 Bacteria 6124
378 Ga0373927_0068912 3300035695 Bacteria 2289
379 Ga0373933_0002203 3300035724 Bacteria 11133
380 Ga0373933_0006916 3300035724 Bacteria 6182
381 Ga0373947_0000353 3300035725 Bacteria 26005
382 Ga0373937_0000006 3300036401 Bacteria 194781
383 Ga0373937_0004370 3300036401 Bacteria 12001
384 Ga0373937_0452430 3300036401 Bacteria 1219
385 Ga0373925_0000002 3300037068 Bacteria 368879
386 Ga0373925_0065367 3300037068 Bacteria 2740
387 Ga0395900_0001933 3300037418 Bacteria 23481
388 Ga0395900_0029316 3300037418 Bacteria 5646
389 Ga0395900_0068502 3300037418 Bacteria 3647
390 Ga0395898_0006080 3300037466 Bacteria 12949
391 Ga0395898_0050924 3300037466 Bacteria 4051
392 Ga0395898_0098801 3300037466 Bacteria 2803
393 Ga0395898_0190897 3300037466 Bacteria 1957
394 Ga0395898_0689614 3300037466 Bacteria 963
395 Ga0436364_0106318 3300037853 Bacteria 6422
396 Ga0395901_0006367 3300038443 Bacteria 11963
397 Ga0395901_0019526 3300038443 Bacteria 6927
398 Ga0395901_0868174 3300038443 Bacteria 886
399 Ga0436365_0204082 3300039437 Bacteria 1305
400 Ga0436360_0293200 3300039438 Bacteria 1400
401 Ga0436361_0570470 3300039447 Bacteria 2231
402 Ga0451577_0664849 3300042876 Bacteria 944
403 Ga0466963_0005297 3300044694 Bacteria 7538
404 Ga0451576_0000247 3300045051 Bacteria 132668
405 Ga0466967_0002811 3300045976 Bacteria 11040
406 Ga0466967_0134632 3300045976 Bacteria 2297
407 Ga0495592_0000039 3300046454 Bacteria 124471
408 Ga0495592_0001529 3300046454 Bacteria 16130
409 Ga0495603_0177500 3300046455 Bacteria 1233
410 Ga0495651_0000376 3300046462 Bacteria 34540
411 Ga0495651_0006087 3300046462 Bacteria 9213
412 Ga0495653_0000006 3300046463 Bacteria 363285
413 Ga0495653_0004466 3300046463 Bacteria 11299
414 Ga0495605_0011168 3300046474 Bacteria 5017
415 Ga0495605_0079102 3300046474 Bacteria 1540
416 Ga0495662_0002816 3300046476 Bacteria 8801
417 Ga0495664_0000002 3300046477 Bacteria 625183
418 Ga0495664_0023178 3300046477 Bacteria 3601
419 Ga0495584_0022014 3300046491 Bacteria 3236
420 Ga0495583_0103628 3300046506 Bacteria 1212
421 Ga0495606_0008491 3300046507 Bacteria 8912
422 Ga0495608_0000006 3300046511 Bacteria 324334
423 Ga0495608_0000910 3300046511 Bacteria 20753
424 Ga0495618_0000027 3300046514 Bacteria 112522
425 Ga0495618_0007318 3300046514 Bacteria 6679
426 Ga0495618_0135135 3300046514 Bacteria 1578
427 Ga0495628_0000002 3300046516 Bacteria 589399
428 Ga0495628_0005038 3300046516 Bacteria 11611
429 Ga0495630_0000950 3300046517 Bacteria 20249
430 Ga0495648_0032023 3300046524 Bacteria 3456
431 Ga0495666_0102814 3300046526 Bacteria 1346
432 Ga0495652_0000004 3300046529 Bacteria 588877
433 Ga0495652_0007044 3300046529 Bacteria 10390
434 Ga0495665_0037244 3300046531 Bacteria 2597
435 Ga0495640_0000005 3300046533 Bacteria 318271
436 Ga0495640_0019009 3300046533 Bacteria 5080
437 Ga0495640_0141888 3300046533 Bacteria 1548
438 Ga0495640_0215047 3300046533 Bacteria 1214
439 Ga0495587_0000007 3300046536 Bacteria 290788
440 Ga0495587_0005121 3300046536 Bacteria 8567
441 Ga0495587_0084851 3300046536 Bacteria 1834
442 Ga0495645_0000003 3300046543 Bacteria 570133
443 Ga0495645_0095777 3300046543 Bacteria 2116
444 Ga0495622_0164736 3300046557 Bacteria 999
445 Ga0495667_0000002 3300046559 Bacteria 437535
446 Ga0495667_0010461 3300046559 Bacteria 6276
447 Ga0495634_0000022 3300046642 Bacteria 118988
448 Ga0495625_0179835 3300046660 Bacteria 1407
449 Ga0495635_0000022 3300046663 Bacteria 160907
450 Ga0495635_0001031 3300046663 Bacteria 18442
451 Ga0495588_0053247 3300046674 Bacteria 2087
452 Ga0495657_0000072 3300046675 Bacteria 91747
453 Ga0495599_0000001 3300046678 Bacteria 537563
454 Ga0495623_0000001 3300046679 Bacteria 313861
455 Ga0495623_0004889 3300046679 Bacteria 8786
456 Ga0495646_0000014 3300046680 Bacteria 143781
457 Ga0495646_0001814 3300046680 Bacteria 12814
458 Ga0495647_0145225 3300046681 Bacteria 1014
459 Ga0495658_0261294 3300046683 Bacteria 1090
460 Ga0495669_0078650 3300046684 Bacteria 1511
461 Ga0495613_0007082 3300046689 Bacteria 8349
462 Ga0495613_0059897 3300046689 Bacteria 2789
463 Ga0495624_0055473 3300046690 Bacteria 2496
464 Ga0495649_0003847 3300046694 Bacteria 9942
465 Ga0495600_0000006 3300046809 Bacteria 151916
466 Ga0495600_0003474 3300046809 Bacteria 9268
467 Ga0495604_0000005 3300047317 Bacteria 424516
468 Ga0495604_0002346 3300047317 Bacteria 15172
469 Ga0495674_0000003 3300047319 Bacteria 562126
470 Ga0495680_0002479 3300047322 Bacteria 18871
471 Ga0495680_0004228 3300047322 Bacteria 13784
472 Ga0495683_0151633 3300047323 Bacteria 1078
473 Ga0495675_0000010 3300047444 Bacteria 153375
474 Ga0495675_0001356 3300047444 Bacteria 14820
475 Ga0495685_054157 3300047447 Bacteria 1358
476 Ga0495684_0000028 3300047471 Bacteria 123549
477 Ga0495684_0026180 3300047471 Bacteria 4481
478 Ga0495593_0001828 3300047673 Bacteria 12660
479 Ga0495593_0038416 3300047673 Bacteria 2586
480 Ga0495602_0000054 3300048088 Bacteria 111411
481 Ga0495602_0106413 3300048088 Bacteria 2290
482 Ga0496100_0019839 3300048903 Bacteria 4020
483 Ga0496101_0012308 3300048904 Bacteria 5705
484 Ga0496101_0014887 3300048904 Bacteria 5234
485 Ga0496102_0367253 3300048905 Bacteria 1354
486 Ga0496103_0173437 3300048906 Bacteria 1385
487 Ga0496104_0011140 3300048907 Bacteria 8046
488 Ga0496104_0020522 3300048907 Bacteria 6057
489 Ga0496104_0143355 3300048907 Bacteria 2295
490 Ga0496105_0009320 3300048908 Bacteria 7674
491 Ga0496106_0009382 3300048909 Bacteria 7231
492 Ga0496106_0167436 3300048909 Bacteria 1740
493 Ga0496106_0317803 3300048909 Bacteria 1250
494 Ga0496107_0007600 3300048910 Bacteria 7480
495 Ga0496107_0196162 3300048910 Bacteria 1500
496 Ga0496107_0198403 3300048910 Bacteria 1491
497 Ga0496108_0001956 3300048911 Bacteria 16502
498 Ga0496108_0033980 3300048911 Bacteria 4235
499 Ga0496108_0613553 3300048911 Bacteria 947
500 Ga0496109_0003867 3300048912 Bacteria 12504
501 Ga0496109_0016699 3300048912 Bacteria 6422
502 Ga0496109_0065297 3300048912 Bacteria 3331
503 Ga0496109_0625009 3300048912 Bacteria 1014
504 Ga0496110_0020613 3300048913 Bacteria 5569
505 Ga0496111_0009164 3300048914 Bacteria 6589
506 Ga0496112_0011458 3300048915 Bacteria 8098
507 Ga0496112_0012548 3300048915 Bacteria 7785
508 Ga0496112_0088275 3300048915 Bacteria 3069
509 Ga0496112_0439065 3300048915 Bacteria 1243
510 Ga0496113_0000507 3300048916 Bacteria 19242
511 Ga0496113_0098034 3300048916 Bacteria 2269
512 Ga0496113_0353569 3300048916 Bacteria 1179
513 Ga0496114_0062257 3300048917 Bacteria 3123
514 Ga0496114_0228852 3300048917 Bacteria 1633
515 Ga0496114_0391407 3300048917 Bacteria 1231
516 Ga0496114_0531729 3300048917 Bacteria 1039
517 Ga0496115_0022877 3300048918 Bacteria 4848
518 Ga0496115_0183050 3300048918 Bacteria 1731
519 Ga0496121_0084892 3300048924 Bacteria 2494
520 Ga0496125_0230035 3300048928 Bacteria 1186
521 Ga0501032_0017557 3300049569 Bacteria 5022
522 Ga0501033_0006409 3300049570 Bacteria 9215
523 Ga0501034_0002129 3300049571 Bacteria 24602
524 Ga0501037_0005851 3300049573 Bacteria 8981
525 Ga0501037_0200460 3300049573 Bacteria 1411
526 Ga0501038_0000878 3300049574 Bacteria 26652
527 Ga0501038_0009352 3300049574 Bacteria 8991
528 Ga0501039_0023153 3300049575 Bacteria 4766
529 Ga0501043_0010496 3300049579 Bacteria 7254
530 Ga0501046_0001587 3300049580 Bacteria 21740
531 Ga0501047_0004529 3300049581 Bacteria 13064
532 Ga0501047_0030359 3300049581 Bacteria 5211
533 Ga0501047_0687704 3300049581 Bacteria 841
534 Ga0501048_0015440 3300049582 Bacteria 5641
535 Ga0501068_0021181 3300049584 Bacteria 3795
536 Ga0501069_0001129 3300049585 Bacteria 12885
537 Ga0501069_0193553 3300049585 Bacteria 1177
538 Ga0501070_0005624 3300049586 Bacteria 10688
539 Ga0501070_0046333 3300049586 Bacteria 3616
540 Ga0501073_0000996 3300049589 Bacteria 20447
541 Ga0501073_0065041 3300049589 Bacteria 2543
542 Ga0501073_0131458 3300049589 Bacteria 1735
543 Ga0501074_0001724 3300049590 Bacteria 14933
544 Ga0501074_0244139 3300049590 Bacteria 1277
545 Ga0501077_0123740 3300049593 Bacteria 1639
546 Ga0501077_0206841 3300049593 Bacteria 1247
547 Ga0501080_0006117 3300049742 Bacteria 10790
548 Ga0501081_0383896 3300049743 Bacteria 1038
549 Ga0501083_0019158 3300049744 Bacteria 4766
550 Ga0501083_0031714 3300049744 Bacteria 3627
551 Ga0501035_0000484 3300049822 Bacteria 44772
552 Ga0501035_0002346 3300049822 Bacteria 18647
553 Ga0501044_0607218 3300049823 Bacteria 987
554 Ga0501045_0089567 3300049824 Bacteria 2273
555 nmdc:mga08y16_81856_c1 3300050511 Bacteria 3366
556 nmdc:mga0n895_176560_c1 3300050512 Bacteria 2167
557 nmdc:mga0n895_26501_c1 3300050512 Bacteria 5491
558 nmdc:mga0rr50_114052_c1 3300050513 Bacteria 2142
559 nmdc:mga0rr50_45633_c1 3300050513 Bacteria 3222
560 nmdc:mga08x19_134673_c1 3300050514 Bacteria 1665
561 Ga0495601_0000008 3300053077 Bacteria 362152
562 Ga0495601_0008398 3300053077 Bacteria 6099
563 Ga0495601_0046672 3300053077 Bacteria 2726
564 Ga0495601_0277664 3300053077 Bacteria 1092
565 Ga0495612_0000002 3300053078 Bacteria 310466
566 Ga0495612_0004077 3300053078 Bacteria 6053
567 Ga0495595_0000008 3300053084 Bacteria 196206
568 Ga0495595_0005255 3300053084 Bacteria 5230
569 Ga0495595_0122066 3300053084 Bacteria 1269
570 Ga0495619_0000002 3300053085 Bacteria 530226
571 Ga0495619_0002154 3300053085 Bacteria 13053
572 Ga0500600_0006015 3300053149 Bacteria 7206
573 Ga0500616_0000001 3300053153 Bacteria 1986011
574 Ga0500616_0017264 3300053153 Bacteria 4098
575 Ga0501084_0002039 3300054114 Bacteria 16134
576 Ga0501082_0001669 3300060353 Bacteria 19564
577 Ga0501082_0077847 3300060353 Bacteria 2859
578 Ga0530510_0279492 3300061734 Bacteria 1247

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0689614 Ga0395898_0689614_201_947 198
2 3300050513 nmdc:mga0rr50_45633_c1 nmdc:mga0rr50_45633_c1_444_1274 204
3 3300048916 Ga0496113_0353569 Ga0496113_0353569_54_893 206
4 3300037466 Ga0395898_0098801 Ga0395898_0098801_1993_2769 208
5 3300049574 Ga0501038_0009352 Ga0501038_0009352_6592_7437 208
6 3300049823 Ga0501044_0607218 Ga0501044_0607218_107_952 208
7 3300005983 Ga0081540_1000040 Ga0081540_100004030 211
8 3300035114 Ga0373939_0065862 Ga0373939_0065862_98_901 213
9 3300031711 Ga0265314_10084052 Ga0265314_100840522 214
10 3300031712 Ga0265342_10130998 Ga0265342_101309982 214
11 3300028800 Ga0265338_10051978 Ga0265338_100519783 215
12 3300031242 Ga0265329_10004407 Ga0265329_100044076 215
13 3300031344 Ga0265316_10016415 Ga0265316_100164154 215
14 iso_pu_bacteria 2643221595 2643988704 217
15 3300006175 Ga0070712_100242412 Ga0070712_1002424122 218
16 3300039437 Ga0436365_0204082 Ga0436365_0204082_34_825 218
17 3300005841 Ga0068863_100566106 Ga0068863_1005661062 219
18 3300035398 Ga0316574_0159931 Ga0316574_0159931_416_1255 219
19 3300005334 Ga0068869_100034606 Ga0068869_1000346062 220
20 3300035116 Ga0373945_0123738 Ga0373945_0123738_159_956 220
21 3300046533 Ga0495640_0215047 Ga0495640_0215047_29_826 220
22 3300046557 Ga0495622_0164736 Ga0495622_0164736_191_988 220
23 3300046674 Ga0495588_0053247 Ga0495588_0053247_254_1051 220
24 3300049581 Ga0501047_0687704 Ga0501047_0687704_16_813 220
25 3300049743 Ga0501081_0383896 Ga0501081_0383896_224_1021 220
26 3300031730 Ga0307516_10000209 Ga0307516_1000020920 222
27 3300037418 Ga0395900_0029316 Ga0395900_0029316_4190_5029 223
28 3300037466 Ga0395898_0006080 Ga0395898_0006080_10117_10956 223
29 3300037466 Ga0395898_0050924 Ga0395898_0050924_1440_2279 223
30 3300038443 Ga0395901_0006367 Ga0395901_0006367_2216_3055 223
31 3300038443 Ga0395901_0868174 Ga0395901_0868174_37_876 223
32 3300005937 Ga0081455_10000058 Ga0081455_1000005871 224
33 3300049569 Ga0501032_0017557 Ga0501032_0017557_1848_2684 224
34 3300049570 Ga0501033_0006409 Ga0501033_0006409_8209_9045 224
35 3300049573 Ga0501037_0005851 Ga0501037_0005851_590_1426 224
36 3300049574 Ga0501038_0000878 Ga0501038_0000878_24150_24986 224
37 3300049575 Ga0501039_0023153 Ga0501039_0023153_3241_4077 224
38 3300049579 Ga0501043_0010496 Ga0501043_0010496_4668_5504 224
39 3300049580 Ga0501046_0001587 Ga0501046_0001587_7855_8691 224
40 3300049581 Ga0501047_0004529 Ga0501047_0004529_3066_3902 224
41 3300049582 Ga0501048_0015440 Ga0501048_0015440_3201_4037 224
42 3300049584 Ga0501068_0021181 Ga0501068_0021181_1247_2083 224
43 3300049585 Ga0501069_0001129 Ga0501069_0001129_194_1030 224
44 3300049586 Ga0501070_0005624 Ga0501070_0005624_9163_9999 224
45 3300049589 Ga0501073_0000996 Ga0501073_0000996_8687_9523 224
46 3300049590 Ga0501074_0001724 Ga0501074_0001724_11859_12695 224
47 3300049742 Ga0501080_0006117 Ga0501080_0006117_792_1628 224
48 3300049744 Ga0501083_0019158 Ga0501083_0019158_1795_2631 224
49 3300049822 Ga0501035_0000484 Ga0501035_0000484_7983_8819 224
50 3300049824 Ga0501045_0089567 Ga0501045_0089567_1360_2196 224
51 3300054114 Ga0501084_0002039 Ga0501084_0002039_6501_7337 224
52 3300060353 Ga0501082_0001669 Ga0501082_0001669_2357_3193 224
53 3300005546 Ga0070696_100000163 Ga0070696_10000016312 225
54 3300013105 Ga0157369_10027808 Ga0157369_100278084 226
55 3300005937 Ga0081455_10046358 Ga0081455_100463582 227
56 3300042876 Ga0451577_0664849 Ga0451577_0664849_81_929 227
57 3300045051 Ga0451576_0000247 Ga0451576_0000247_51964_52812 227
58 3300005340 Ga0070689_100484771 Ga0070689_1004847712 229
59 3300005347 Ga0070668_100073512 Ga0070668_1000735123 229
60 3300005347 Ga0070668_100160282 Ga0070668_1001602822 229
61 3300005354 Ga0070675_100253106 Ga0070675_1002531062 229
62 3300005356 Ga0070674_100041789 Ga0070674_1000417894 229
63 3300005367 Ga0070667_100056496 Ga0070667_1000564963 229
64 3300005543 Ga0070672_100210276 Ga0070672_1002102762 229
65 3300005545 Ga0070695_100249970 Ga0070695_1002499702 229
66 3300005615 Ga0070702_100106881 Ga0070702_1001068812 229
67 3300005617 Ga0068859_100240402 Ga0068859_1002404022 229
68 3300005718 Ga0068866_10226062 Ga0068866_102260622 229
69 3300005719 Ga0068861_100074120 Ga0068861_1000741202 229
70 3300005843 Ga0068860_100062955 Ga0068860_1000629552 229
71 3300005844 Ga0068862_100053868 Ga0068862_1000538683 229
72 3300006931 Ga0097620_100240392 Ga0097620_1002403922 229
73 3300017792 Ga0163161_10102547 Ga0163161_101025472 229
74 3300025916 Ga0207663_10220766 Ga0207663_102207662 229
75 3300025986 Ga0207658_10050537 Ga0207658_100505372 229
76 3300026118 Ga0207675_100016474 Ga0207675_1000164747 229
77 3300028380 Ga0268265_10036599 Ga0268265_100365993 229
78 3300048917 Ga0496114_0062257 Ga0496114_0062257_588_1451 229
79 iso_pu_bacteria 2818991461 2819686069 230
80 iso_pu_bacteria 8005658619 8005659083 230
81 iso_pu_bacteria 2523231067 2523466633 231
82 iso_pu_bacteria 2738541317 2738947656 231
83 iso_pu_bacteria 2738543031 2739348489 231
84 iso_pu_bacteria 2837678835 2837683315 231
85 iso_pu_bacteria 2913308742 2913311691 231
86 3300005530 Ga0070679_100342111 Ga0070679_1003421112 232
87 3300005549 Ga0070704_100010271 Ga0070704_1000102714 232
88 3300013104 Ga0157370_10052855 Ga0157370_100528552 232
89 3300025921 Ga0207652_10287797 Ga0207652_102877972 232
90 3300046474 Ga0495605_0011168 Ga0495605_0011168_3825_4658 232
91 iso_pu_bacteria 2643221551 2643777093 232
92 iso_pu_bacteria 2643221555 2643795541 232
93 3300005435 Ga0070714_100177943 Ga0070714_1001779431 233
94 3300025929 Ga0207664_10459886 Ga0207664_104598862 233
95 3300031507 Ga0307509_10170214 Ga0307509_101702142 233
96 3300049571 Ga0501034_0002129 Ga0501034_0002129_16616_17452 233
97 3300049581 Ga0501047_0030359 Ga0501047_0030359_3668_4504 233
98 3300053077 Ga0495601_0046672 Ga0495601_0046672_245_1081 233
99 3300005546 Ga0070696_100016860 Ga0070696_1000168602 234
100 3300005563 Ga0068855_100058338 Ga0068855_1000583385 234
101 3300006237 Ga0097621_100004339 Ga0097621_1000043396 234
102 3300006914 Ga0075436_100042432 Ga0075436_1000424323 234
103 3300007265 Ga0099794_10002565 Ga0099794_100025654 234
104 3300009148 Ga0105243_10087044 Ga0105243_100870443 234
105 3300009553 Ga0105249_10004666 Ga0105249_100046665 234
106 3300010159 Ga0099796_10009527 Ga0099796_100095273 234
107 3300013307 Ga0157372_10401283 Ga0157372_104012832 234
108 3300025906 Ga0207699_10036268 Ga0207699_100362682 234
109 3300025915 Ga0207693_10294937 Ga0207693_102949371 234
110 3300025929 Ga0207664_10333367 Ga0207664_103333672 234
111 3300025935 Ga0207709_10088812 Ga0207709_100888122 234
112 3300025949 Ga0207667_10129733 Ga0207667_101297333 234
113 3300025961 Ga0207712_10026229 Ga0207712_100262295 234
114 3300027671 Ga0209588_1022691 Ga0209588_10226912 234
115 3300028017 Ga0265356_1000342 Ga0265356_10003424 234
116 3300028800 Ga0265338_10012346 Ga0265338_100123468 234
117 3300031249 Ga0265339_10007030 Ga0265339_100070308 234
118 3300031595 Ga0265313_10074718 Ga0265313_100747182 234
119 3300031712 Ga0265342_10017724 Ga0265342_100177245 234
120 3300035695 Ga0373927_0068912 Ga0373927_0068912_1184_2023 234
121 3300036401 Ga0373937_0452430 Ga0373937_0452430_16_855 234
122 3300037068 Ga0373925_0065367 Ga0373925_0065367_106_945 234
123 3300037418 Ga0395900_0001933 Ga0395900_0001933_15184_16023 234
124 3300037853 Ga0436364_0106318 Ga0436364_0106318_2031_2870 234
125 3300038443 Ga0395901_0019526 Ga0395901_0019526_458_1297 234
126 3300044694 Ga0466963_0005297 Ga0466963_0005297_3645_4484 234
127 3300045976 Ga0466967_0002811 Ga0466967_0002811_10012_10851 234
128 3300046690 Ga0495624_0055473 Ga0495624_0055473_833_1672 234
129 3300048907 Ga0496104_0020522 Ga0496104_0020522_4298_5137 234
130 3300053149 Ga0500600_0006015 Ga0500600_0006015_4219_5058 234
131 iso_pu_bacteria 2508501123 2509113465 234
132 iso_pu_bacteria 2509276022 2509394378 234
133 iso_pu_bacteria 2512875016 2512933148 234
134 iso_pu_bacteria 2512875024 2512961210 234
135 iso_pu_bacteria 2513237090 2513610227 234
136 iso_pu_bacteria 2513237164 2514035250 234
137 iso_pu_bacteria 2588253730 2588519208 234
138 iso_pu_bacteria 2599185301 2599941020 234
139 iso_pu_bacteria 2643221621 2644120775 234
140 iso_pu_bacteria 2643221627 2644155204 234
141 iso_pu_bacteria 2671180139 2671691945 234
142 iso_pu_bacteria 2693429783 2694634144 234
143 iso_pu_bacteria 2756170246 2756674142 234
144 iso_pu_bacteria 2791355123 2792750558 234
145 iso_pu_bacteria 2844002411 2844009337 234
146 iso_pu_bacteria 2847670302 2847674520 234
147 iso_pu_bacteria 2847686936 2847690626 234
148 iso_pu_bacteria 2856314179 2856317594 234
149 iso_pu_bacteria 2856320880 2856321561 234
150 iso_pu_bacteria 2856364286 2856366607 234
151 iso_pu_bacteria 2857349434 2857356714 234
152 iso_pu_bacteria 2857537821 2857541609 234
153 iso_pu_bacteria 2869162929 2869163681 234
154 iso_pu_bacteria 2869278585 2869285490 234
155 iso_pu_bacteria 2869285874 2869287982 234
156 iso_pu_bacteria 2871429161 2871429870 234
157 iso_pu_bacteria 2871444079 2871448010 234
158 iso_pu_bacteria 2871466892 2871467568 234
159 iso_pu_bacteria 2871495908 2871497909 234
160 iso_pu_bacteria 2874102143 2874108043 234
161 iso_pu_bacteria 2874139085 2874146266 234
162 iso_pu_bacteria 2874146452 2874151615 234
163 iso_pu_bacteria 2874155637 2874159247 234
164 iso_pu_bacteria 2876363079 2876364604 234
165 iso_pu_bacteria 2876369609 2876373493 234
166 iso_pu_bacteria 2876377896 2876379009 234
167 iso_pu_bacteria 2876392853 2876396368 234
168 iso_pu_bacteria 2876413966 2876417666 234
169 iso_pu_bacteria 2878035449 2878038652 234
170 iso_pu_bacteria 2878738818 2878741309 234
171 iso_pu_bacteria 2878745973 2878749493 234
172 iso_pu_bacteria 2878760144 2878762131 234
173 iso_pu_bacteria 2878767105 2878769098 234
174 iso_pu_bacteria 2881147464 2881149278 234
175 iso_pu_bacteria 2881161766 2881166101 234
176 iso_pu_bacteria 2885305155 2885307591 234
177 iso_pu_bacteria 2885326080 2885327413 234
178 iso_pu_bacteria 2888337043 2888337809 234
179 iso_pu_bacteria 2888350351 2888354353 234
180 iso_pu_bacteria 2889010040 2889016044 234
181 iso_pu_bacteria 2889016732 2889018915 234
182 iso_pu_bacteria 2903448605 2903454870 234
183 iso_pu_bacteria 2903492973 2903493723 234
184 iso_pu_bacteria 2903521522 2903522660 234
185 iso_pu_bacteria 2903528002 2903529039 234
186 iso_pu_bacteria 2903540706 2903542707 234
187 iso_pu_bacteria 2904659560 2904663144 234
188 iso_pu_bacteria 2906308376 2906310531 234
189 iso_pu_bacteria 2906321335 2906324596 234
190 iso_pu_bacteria 2906328253 2906333392 234
191 iso_pu_bacteria 2906354277 2906356960 234
192 iso_pu_bacteria 2906378014 2906381193 234
193 iso_pu_bacteria 2906414383 2906417659 234
194 iso_pu_bacteria 2922158528 2922163720 234
195 iso_pu_bacteria 2922185730 2922193652 234
196 iso_pu_bacteria 2924718760 2924723092 234
197 iso_pu_bacteria 2924726620 2924732451 234
198 iso_pu_bacteria 2924776078 2924778991 234
199 iso_pu_bacteria 2937813078 2937817360 234
200 iso_pu_bacteria 2937848649 2937853498 234
201 iso_pu_bacteria 2937877337 2937883348 234
202 iso_pu_bacteria 2937891427 2937898323 234
203 iso_pu_bacteria 2937972304 2937979031 234
204 iso_pu_bacteria 2937994558 2937996559 234
205 iso_pu_bacteria 2938014810 2938015339 234
206 iso_pu_bacteria 2941479691 2941480595 234
207 iso_pu_bacteria 2958034702 2958041195 234
208 iso_pu_bacteria 2958041894 2958049228 234
209 iso_pu_bacteria 2958041894 2958057689 234
210 iso_pu_bacteria 2958064165 2958069930 234
211 iso_pu_bacteria 2958084443 2958090515 234
212 iso_pu_bacteria 2958092219 2958092607 234
213 iso_pu_bacteria 2958115193 2958116041 234
214 iso_pu_bacteria 2958130278 2958132386 234
215 iso_pu_bacteria 2958144490 2958151983 234
216 iso_pu_bacteria 2958165035 2958167030 234
217 iso_pu_bacteria 2958172287 2958176132 234
218 iso_pu_bacteria 2958179912 2958182200 234
219 iso_pu_bacteria 2961077736 2961080044 234
220 iso_pu_bacteria 2961114664 2961118171 234
221 iso_pu_bacteria 2961163497 2961165499 234
222 iso_pu_bacteria 2963644680 2963646060 234
223 iso_pu_bacteria 2965018300 2965020322 234
224 iso_pu_bacteria 2965119406 2965122114 234
225 iso_pu_bacteria 2968016561 2968022795 234
226 iso_pu_bacteria 2968083720 2968089572 234
227 iso_pu_bacteria 2968091066 2968091543 234
228 iso_pu_bacteria 2968097103 2968097472 234
229 iso_pu_bacteria 2968110612 2968114232 234
230 iso_pu_bacteria 2968117919 2968123355 234
231 iso_pu_bacteria 2968128360 2968133487 234
232 iso_pu_bacteria 2968171901 2968173901 234
233 iso_pu_bacteria 2970469710 2970475380 234
234 iso_pu_bacteria 2970554993 2970556987 234
235 iso_pu_bacteria 2970593180 2970600106 234
236 iso_pu_bacteria 2977843712 2977847647 234
237 iso_pu_bacteria 2977858184 2977860410 234
238 iso_pu_bacteria 2977864932 2977871124 234
239 iso_pu_bacteria 2977922695 2977928710 234
240 iso_pu_bacteria 2977942078 2977942960 234
241 iso_pu_bacteria 2977971508 2977980175 234
242 iso_pu_bacteria 2977986579 2977992748 234
243 iso_pu_bacteria 2979710463 2979712803 234
244 iso_pu_bacteria 2979742915 2979745135 234
245 iso_pu_bacteria 2979779861 2979785434 234
246 iso_pu_bacteria 2987636660 2987643995 234
247 iso_pu_bacteria 2987652177 2987657773 234
248 iso_pu_bacteria 2987659509 2987661507 234
249 iso_pu_bacteria 2996341866 2996342575 234
250 iso_pu_bacteria 2996348954 2996353196 234
251 iso_pu_bacteria 3004188549 3004190556 234
252 iso_pu_bacteria 3004203850 3004208144 234
253 iso_pu_bacteria 3004211236 3004211352 234
254 iso_pu_bacteria 3004218560 3004225099 234
255 iso_pu_bacteria 3004275668 3004279878 234
256 iso_pu_bacteria 3004289098 3004295582 234
257 iso_pu_bacteria 3004334049 3004336362 234
258 iso_pu_bacteria 637000159 637076230 234
259 iso_pu_bacteria 8004387939 8004389770 234
260 iso_pu_bacteria 8004445564 8004450899 234
261 iso_pu_bacteria 8004640170 8004645625 234
262 iso_pu_bacteria 8004703790 8004704406 234
263 iso_pu_bacteria 8004714634 8004718167 234
264 iso_pu_bacteria 8018150411 8018153511 234
265 3300003354 JGI25160J50197_1010041 JGI25160J50197_10100413 235
266 3300003659 JGI25404J52841_10003799 JGI25404J52841_100037993 235
267 3300005328 Ga0070676_10026538 Ga0070676_100265383 235
268 3300005330 Ga0070690_100005765 Ga0070690_1000057653 235
269 3300005340 Ga0070689_100049104 Ga0070689_1000491042 235
270 3300005343 Ga0070687_100072675 Ga0070687_1000726752 235
271 3300005343 Ga0070687_100108054 Ga0070687_1001080541 235
272 3300005344 Ga0070661_100172735 Ga0070661_1001727352 235
273 3300005344 Ga0070661_100238990 Ga0070661_1002389902 235
274 3300005354 Ga0070675_100130395 Ga0070675_1001303952 235
275 3300005356 Ga0070674_100004876 Ga0070674_1000048768 235
276 3300005356 Ga0070674_100088270 Ga0070674_1000882702 235
277 3300005365 Ga0070688_100007302 Ga0070688_1000073022 235
278 3300005539 Ga0068853_100457985 Ga0068853_1004579852 235
279 3300005543 Ga0070672_100195097 Ga0070672_1001950972 235
280 3300005549 Ga0070704_100347049 Ga0070704_1003470492 235
281 3300005564 Ga0070664_100114627 Ga0070664_1001146273 235
282 3300005616 Ga0068852_100329719 Ga0068852_1003297192 235
283 3300005617 Ga0068859_100113389 Ga0068859_1001133892 235
284 3300005718 Ga0068866_10227188 Ga0068866_102271881 235
285 3300005719 Ga0068861_100152384 Ga0068861_1001523842 235
286 3300005840 Ga0068870_10201145 Ga0068870_102011452 235
287 3300005983 Ga0081540_1001972 Ga0081540_10019727 235
288 3300006871 Ga0075434_100017752 Ga0075434_1000177522 235
289 3300006931 Ga0097620_100113388 Ga0097620_1001133882 235
290 3300009148 Ga0105243_10386443 Ga0105243_103864431 235
291 3300010375 Ga0105239_10481063 Ga0105239_104810632 235
292 3300013306 Ga0163162_10310051 Ga0163162_103100512 235
293 3300013307 Ga0157372_10168578 Ga0157372_101685782 235
294 3300014325 Ga0163163_10132831 Ga0163163_101328312 235
295 3300025302 Ga0207426_1001988 Ga0207426_10019883 235
296 3300025918 Ga0207662_10130480 Ga0207662_101304802 235
297 3300025923 Ga0207681_10027141 Ga0207681_100271413 235
298 3300025933 Ga0207706_10056312 Ga0207706_100563122 235
299 3300025936 Ga0207670_10003994 Ga0207670_100039943 235
300 3300025937 Ga0207669_10005810 Ga0207669_100058102 235
301 3300025937 Ga0207669_10087242 Ga0207669_100872422 235
302 3300025940 Ga0207691_10187670 Ga0207691_101876702 235
303 3300025945 Ga0207679_10121096 Ga0207679_101210962 235
304 3300026089 Ga0207648_10110694 Ga0207648_101106942 235
305 3300026118 Ga0207675_100193673 Ga0207675_1001936732 235
306 3300026121 Ga0207683_10050477 Ga0207683_100504773 235
307 3300028380 Ga0268265_10394579 Ga0268265_103945792 235
308 3300031238 Ga0265332_10000302 Ga0265332_1000030216 235
309 3300031247 Ga0265340_10010544 Ga0265340_100105442 235
310 3300031249 Ga0265339_10003035 Ga0265339_100030354 235
311 3300031250 Ga0265331_10000008 Ga0265331_10000008180 235
312 3300031250 Ga0265331_10093620 Ga0265331_100936202 235
313 3300031251 Ga0265327_10000036 Ga0265327_1000003660 235
314 3300031711 Ga0265314_10235500 Ga0265314_102355002 235
315 3300031712 Ga0265342_10000238 Ga0265342_1000023852 235
316 3300031838 Ga0307518_10165693 Ga0307518_101656932 235
317 3300035111 Ga0373923_0012857 Ga0373923_0012857_240_1082 235
318 3300035113 Ga0373936_0000312 Ga0373936_0000312_1453_2295 235
319 3300035117 Ga0373953_0013356 Ga0373953_0013356_787_1629 235
320 3300035172 Ga0373955_0000333 Ga0373955_0000333_12434_13276 235
321 3300035241 Ga0373961_0005859 Ga0373961_0005859_84_926 235
322 3300035241 Ga0373961_0046193 Ga0373961_0046193_186_1028 235
323 3300035410 Ga0373924_0002927 Ga0373924_0002927_3053_3895 235
324 3300035691 Ga0373931_0011811 Ga0373931_0011811_3058_3900 235
325 3300035692 Ga0373935_0000097 Ga0373935_0000097_1891_2733 235
326 3300035695 Ga0373927_0010654 Ga0373927_0010654_606_1448 235
327 3300035724 Ga0373933_0006916 Ga0373933_0006916_708_1550 235
328 3300035725 Ga0373947_0000353 Ga0373947_0000353_4672_5514 235
329 3300036401 Ga0373937_0000006 Ga0373937_0000006_31979_32821 235
330 3300037068 Ga0373925_0000002 Ga0373925_0000002_163555_164397 235
331 3300045976 Ga0466967_0134632 Ga0466967_0134632_922_1767 235
332 3300046454 Ga0495592_0000039 Ga0495592_0000039_36801_37643 235
333 3300046455 Ga0495603_0177500 Ga0495603_0177500_228_1073 235
334 3300046462 Ga0495651_0000376 Ga0495651_0000376_27038_27880 235
335 3300046463 Ga0495653_0000006 Ga0495653_0000006_163703_164545 235
336 3300046474 Ga0495605_0079102 Ga0495605_0079102_367_1212 235
337 3300046476 Ga0495662_0002816 Ga0495662_0002816_4821_5663 235
338 3300046477 Ga0495664_0000002 Ga0495664_0000002_199337_200179 235
339 3300046506 Ga0495583_0103628 Ga0495583_0103628_283_1128 235
340 3300046507 Ga0495606_0008491 Ga0495606_0008491_621_1466 235
341 3300046511 Ga0495608_0000006 Ga0495608_0000006_14367_15209 235
342 3300046514 Ga0495618_0000027 Ga0495618_0000027_22429_23271 235
343 3300046514 Ga0495618_0135135 Ga0495618_0135135_65_907 235
344 3300046516 Ga0495628_0000002 Ga0495628_0000002_163722_164564 235
345 3300046517 Ga0495630_0000950 Ga0495630_0000950_11418_12260 235
346 3300046524 Ga0495648_0032023 Ga0495648_0032023_2031_2876 235
347 3300046529 Ga0495652_0000004 Ga0495652_0000004_424319_425161 235
348 3300046531 Ga0495665_0037244 Ga0495665_0037244_1423_2265 235
349 3300046533 Ga0495640_0000005 Ga0495640_0000005_280271_281113 235
350 3300046533 Ga0495640_0141888 Ga0495640_0141888_123_965 235
351 3300046536 Ga0495587_0000007 Ga0495587_0000007_37129_37971 235
352 3300046536 Ga0495587_0084851 Ga0495587_0084851_639_1481 235
353 3300046543 Ga0495645_0000003 Ga0495645_0000003_144973_145815 235
354 3300046543 Ga0495645_0095777 Ga0495645_0095777_40_882 235
355 3300046559 Ga0495667_0000002 Ga0495667_0000002_273159_274001 235
356 3300046642 Ga0495634_0000022 Ga0495634_0000022_117475_118317 235
357 3300046660 Ga0495625_0179835 Ga0495625_0179835_505_1350 235
358 3300046663 Ga0495635_0000022 Ga0495635_0000022_134005_134847 235
359 3300046675 Ga0495657_0000072 Ga0495657_0000072_15518_16360 235
360 3300046678 Ga0495599_0000001 Ga0495599_0000001_302400_303242 235
361 3300046679 Ga0495623_0000001 Ga0495623_0000001_71345_72187 235
362 3300046680 Ga0495646_0000014 Ga0495646_0000014_65749_66591 235
363 3300046689 Ga0495613_0007082 Ga0495613_0007082_1369_2211 235
364 3300046694 Ga0495649_0003847 Ga0495649_0003847_5624_6469 235
365 3300046809 Ga0495600_0000006 Ga0495600_0000006_32880_33722 235
366 3300047317 Ga0495604_0000005 Ga0495604_0000005_189366_190208 235
367 3300047319 Ga0495674_0000003 Ga0495674_0000003_397562_398404 235
368 3300047322 Ga0495680_0002479 Ga0495680_0002479_15487_16329 235
369 3300047323 Ga0495683_0151633 Ga0495683_0151633_167_1012 235
370 3300047444 Ga0495675_0000010 Ga0495675_0000010_152423_153265 235
371 3300047447 Ga0495685_054157 Ga0495685_054157_172_1029 235
372 3300047471 Ga0495684_0000028 Ga0495684_0000028_85714_86556 235
373 3300047673 Ga0495593_0001828 Ga0495593_0001828_2795_3637 235
374 3300048088 Ga0495602_0000054 Ga0495602_0000054_2566_3408 235
375 3300048906 Ga0496103_0173437 Ga0496103_0173437_388_1230 235
376 3300048909 Ga0496106_0317803 Ga0496106_0317803_289_1131 235
377 3300048912 Ga0496109_0625009 Ga0496109_0625009_137_979 235
378 3300048915 Ga0496112_0439065 Ga0496112_0439065_27_869 235
379 3300048917 Ga0496114_0228852 Ga0496114_0228852_481_1323 235
380 3300048917 Ga0496114_0391407 Ga0496114_0391407_197_1042 235
381 3300048917 Ga0496114_0531729 Ga0496114_0531729_17_862 235
382 3300048924 Ga0496121_0084892 Ga0496121_0084892_1434_2279 235
383 3300048928 Ga0496125_0230035 Ga0496125_0230035_309_1154 235
384 3300049585 Ga0501069_0193553 Ga0501069_0193553_297_1142 235
385 3300049586 Ga0501070_0046333 Ga0501070_0046333_503_1348 235
386 3300049590 Ga0501074_0244139 Ga0501074_0244139_258_1103 235
387 3300049593 Ga0501077_0123740 Ga0501077_0123740_625_1467 235
388 3300049744 Ga0501083_0031714 Ga0501083_0031714_1687_2529 235
389 3300050514 nmdc:mga08x19_134673_c1 nmdc:mga08x19_134673_c1_714_1556 235
390 3300053077 Ga0495601_0000008 Ga0495601_0000008_158178_159020 235
391 3300053077 Ga0495601_0277664 Ga0495601_0277664_98_940 235
392 3300053078 Ga0495612_0000002 Ga0495612_0000002_75318_76160 235
393 3300053084 Ga0495595_0000008 Ga0495595_0000008_158306_159148 235
394 3300053084 Ga0495595_0122066 Ga0495595_0122066_117_959 235
395 3300053085 Ga0495619_0000002 Ga0495619_0000002_163725_164567 235
396 3300053153 Ga0500616_0017264 Ga0500616_0017264_55_897 235
397 3300060353 Ga0501082_0077847 Ga0501082_0077847_1585_2430 235
398 iso_pu_bacteria 2881927736 2881929582 235
399 iso_pu_bacteria 2895511927 2895517180 235
400 3300005338 Ga0068868_100230861 Ga0068868_1002308612 236
401 3300005355 Ga0070671_100123364 Ga0070671_1001233642 236
402 3300005435 Ga0070714_100374512 Ga0070714_1003745122 236
403 3300005437 Ga0070710_10084507 Ga0070710_100845072 236
404 3300005439 Ga0070711_100040960 Ga0070711_1000409604 236
405 3300005440 Ga0070705_100322455 Ga0070705_1003224552 236
406 3300005456 Ga0070678_100039306 Ga0070678_1000393063 236
407 3300005545 Ga0070695_100493746 Ga0070695_1004937461 236
408 3300005547 Ga0070693_100107983 Ga0070693_1001079832 236
409 3300005548 Ga0070665_100266959 Ga0070665_1002669592 236
410 3300005564 Ga0070664_100098438 Ga0070664_1000984382 236
411 3300006358 Ga0068871_100021625 Ga0068871_1000216256 236
412 3300009098 Ga0105245_10004478 Ga0105245_100044789 236
413 3300009177 Ga0105248_10080229 Ga0105248_100802292 236
414 3300009545 Ga0105237_10366546 Ga0105237_103665462 236
415 3300009553 Ga0105249_10151280 Ga0105249_101512803 236
416 3300010375 Ga0105239_10176046 Ga0105239_101760462 236
417 3300011119 Ga0105246_10049107 Ga0105246_100491072 236
418 3300013296 Ga0157374_10074714 Ga0157374_100747142 236
419 3300013308 Ga0157375_10056545 Ga0157375_100565452 236
420 3300014968 Ga0157379_10079841 Ga0157379_100798413 236
421 3300017792 Ga0163161_10128666 Ga0163161_101286662 236
422 3300025898 Ga0207692_10027566 Ga0207692_100275661 236
423 3300025903 Ga0207680_10126448 Ga0207680_101264482 236
424 3300025916 Ga0207663_10010118 Ga0207663_100101187 236
425 3300025919 Ga0207657_10026202 Ga0207657_100262024 236
426 3300025927 Ga0207687_10102604 Ga0207687_101026042 236
427 3300025929 Ga0207664_10371216 Ga0207664_103712162 236
428 3300025933 Ga0207706_10044539 Ga0207706_100445393 236
429 3300025937 Ga0207669_10128558 Ga0207669_101285582 236
430 3300025986 Ga0207658_10319098 Ga0207658_103190982 236
431 3300026035 Ga0207703_10056580 Ga0207703_100565803 236
432 3300026078 Ga0207702_10239932 Ga0207702_102399322 236
433 3300026121 Ga0207683_10047329 Ga0207683_100473294 236
434 3300028379 Ga0268266_10284316 Ga0268266_102843162 236
435 3300028381 Ga0268264_10451050 Ga0268264_104510502 236
436 3300031595 Ga0265313_10015432 Ga0265313_100154324 236
437 3300035119 Ga0373956_0005026 Ga0373956_0005026_3013_3858 236
438 3300035172 Ga0373955_0002441 Ga0373955_0002441_524_1369 236
439 3300035692 Ga0373935_0346383 Ga0373935_0346383_144_989 236
440 3300035724 Ga0373933_0002203 Ga0373933_0002203_802_1647 236
441 3300036401 Ga0373937_0004370 Ga0373937_0004370_8233_9078 236
442 3300039438 Ga0436360_0293200 Ga0436360_0293200_477_1322 236
443 3300046454 Ga0495592_0001529 Ga0495592_0001529_8482_9327 236
444 3300046462 Ga0495651_0006087 Ga0495651_0006087_8010_8855 236
445 3300046463 Ga0495653_0004466 Ga0495653_0004466_6702_7547 236
446 3300046477 Ga0495664_0023178 Ga0495664_0023178_725_1570 236
447 3300046511 Ga0495608_0000910 Ga0495608_0000910_6037_6882 236
448 3300046514 Ga0495618_0007318 Ga0495618_0007318_1506_2351 236
449 3300046516 Ga0495628_0005038 Ga0495628_0005038_8233_9078 236
450 3300046529 Ga0495652_0007044 Ga0495652_0007044_6776_7621 236
451 3300046533 Ga0495640_0019009 Ga0495640_0019009_2227_3072 236
452 3300046536 Ga0495587_0005121 Ga0495587_0005121_3825_4670 236
453 3300046559 Ga0495667_0010461 Ga0495667_0010461_2770_3615 236
454 3300046663 Ga0495635_0001031 Ga0495635_0001031_5930_6775 236
455 3300046679 Ga0495623_0004889 Ga0495623_0004889_310_1155 236
456 3300046680 Ga0495646_0001814 Ga0495646_0001814_8482_9327 236
457 3300046689 Ga0495613_0059897 Ga0495613_0059897_306_1151 236
458 3300046809 Ga0495600_0003474 Ga0495600_0003474_1701_2546 236
459 3300047317 Ga0495604_0002346 Ga0495604_0002346_6226_7071 236
460 3300047322 Ga0495680_0004228 Ga0495680_0004228_4711_5556 236
461 3300047444 Ga0495675_0001356 Ga0495675_0001356_6737_7582 236
462 3300047471 Ga0495684_0026180 Ga0495684_0026180_3236_4081 236
463 3300047673 Ga0495593_0038416 Ga0495593_0038416_1549_2394 236
464 3300048088 Ga0495602_0106413 Ga0495602_0106413_1249_2094 236
465 3300048904 Ga0496101_0014887 Ga0496101_0014887_1258_2103 236
466 3300048905 Ga0496102_0367253 Ga0496102_0367253_147_992 236
467 3300048907 Ga0496104_0011140 Ga0496104_0011140_2383_3228 236
468 3300048908 Ga0496105_0009320 Ga0496105_0009320_1276_2121 236
469 3300048909 Ga0496106_0167436 Ga0496106_0167436_683_1528 236
470 3300048910 Ga0496107_0196162 Ga0496107_0196162_363_1208 236
471 3300048911 Ga0496108_0613553 Ga0496108_0613553_88_933 236
472 3300048912 Ga0496109_0016699 Ga0496109_0016699_3505_4350 236
473 3300048915 Ga0496112_0012548 Ga0496112_0012548_5071_5916 236
474 3300048918 Ga0496115_0183050 Ga0496115_0183050_662_1507 236
475 3300049593 Ga0501077_0206841 Ga0501077_0206841_202_1047 236
476 3300053077 Ga0495601_0008398 Ga0495601_0008398_2534_3379 236
477 3300053078 Ga0495612_0004077 Ga0495612_0004077_2534_3379 236
478 3300053084 Ga0495595_0005255 Ga0495595_0005255_1372_2217 236
479 3300053085 Ga0495619_0002154 Ga0495619_0002154_8721_9566 236
480 3300061734 Ga0530510_0279492 Ga0530510_0279492_27_872 236
481 3300005340 Ga0070689_100470882 Ga0070689_1004708821 237
482 iso_pu_bacteria 2958122699 2958124939 237
483 iso_pu_bacteria 2977872689 2977876218 237
484 3300009147 Ga0114129_10345101 Ga0114129_103451012 238
485 3300025912 Ga0207707_10300669 Ga0207707_103006692 238
486 3300025916 Ga0207663_10097006 Ga0207663_100970062 238
487 3300028577 Ga0265318_10008960 Ga0265318_100089604 238
488 3300031240 Ga0265320_10009572 Ga0265320_100095723 238
489 3300031241 Ga0265325_10025211 Ga0265325_100252112 238
490 3300031242 Ga0265329_10004247 Ga0265329_100042476 238
491 3300031247 Ga0265340_10027558 Ga0265340_100275583 238
492 3300031250 Ga0265331_10048154 Ga0265331_100481542 238
493 3300031344 Ga0265316_10078651 Ga0265316_100786513 238
494 3300031595 Ga0265313_10017884 Ga0265313_100178842 238
495 3300031665 Ga0316575_10004946 Ga0316575_100049464 238
496 3300031711 Ga0265314_10047002 Ga0265314_100470023 238
497 3300031712 Ga0265342_10012970 Ga0265342_100129701 238
498 3300037418 Ga0395900_0068502 Ga0395900_0068502_2278_3129 238
499 3300037466 Ga0395898_0190897 Ga0395898_0190897_882_1733 238
500 3300049573 Ga0501037_0200460 Ga0501037_0200460_243_1094 238
501 3300049589 Ga0501073_0065041 Ga0501073_0065041_675_1526 238
502 3300049589 Ga0501073_0131458 Ga0501073_0131458_91_942 238
503 3300049822 Ga0501035_0002346 Ga0501035_0002346_5082_5933 238
504 3300001977 JGI24746J21847_1000674 JGI24746J21847_10006743 239
505 3300001989 JGI24739J22299_10004845 JGI24739J22299_100048456 239
506 3300001990 JGI24737J22298_10005956 JGI24737J22298_100059564 239
507 3300002070 JGI24750J21931_1002279 JGI24750J21931_10022793 239
508 3300002074 JGI24748J21848_1001179 JGI24748J21848_10011793 239
509 3300002075 JGI24738J21930_10001968 JGI24738J21930_100019686 239
510 3300002076 JGI24749J21850_1000794 JGI24749J21850_10007942 239
511 3300002077 JGI24744J21845_10001222 JGI24744J21845_100012223 239
512 3300002126 JGI24035J26624_1000436 JGI24035J26624_10004363 239
513 3300002155 JGI24033J26618_1002235 JGI24033J26618_10022352 239
514 3300002239 JGI24034J26672_10000405 JGI24034J26672_100004053 239
515 3300002244 JGI24742J22300_10000245 JGI24742J22300_100002455 239
516 3300002459 JGI24751J29686_10006394 JGI24751J29686_100063942 239
517 3300005290 Ga0065712_10001131 Ga0065712_100011315 239
518 3300005290 Ga0065712_10241510 Ga0065712_102415101 239
519 3300005293 Ga0065715_10000443 Ga0065715_100004432 239
520 3300005328 Ga0070676_10000464 Ga0070676_1000046413 239
521 3300005329 Ga0070683_100000585 Ga0070683_1000005858 239
522 3300005330 Ga0070690_100004127 Ga0070690_1000041275 239
523 3300005331 Ga0070670_100010943 Ga0070670_1000109438 239
524 3300005333 Ga0070677_10000046 Ga0070677_1000004627 239
525 3300005334 Ga0068869_100028330 Ga0068869_1000283305 239
526 3300005335 Ga0070666_10012206 Ga0070666_100122065 239
527 3300005336 Ga0070680_100043888 Ga0070680_1000438883 239
528 3300005337 Ga0070682_100001270 Ga0070682_10000127013 239
529 3300005337 Ga0070682_100040756 Ga0070682_1000407564 239
530 3300005338 Ga0068868_100002324 Ga0068868_10000232410 239
531 3300005339 Ga0070660_100001207 Ga0070660_10000120714 239
532 3300005340 Ga0070689_100005142 Ga0070689_1000051426 239
533 3300005341 Ga0070691_10003924 Ga0070691_100039243 239
534 3300005343 Ga0070687_100149722 Ga0070687_1001497221 239
535 3300005344 Ga0070661_100086226 Ga0070661_1000862262 239
536 3300005345 Ga0070692_10000212 Ga0070692_1000021213 239
537 3300005347 Ga0070668_100033083 Ga0070668_1000330832 239
538 3300005353 Ga0070669_100222875 Ga0070669_1002228752 239
539 3300005354 Ga0070675_100120641 Ga0070675_1001206413 239
540 3300005355 Ga0070671_100008864 Ga0070671_1000088645 239
541 3300005356 Ga0070674_100009575 Ga0070674_1000095753 239
542 3300005364 Ga0070673_100000632 Ga0070673_10000063215 239
543 3300005365 Ga0070688_100004634 Ga0070688_1000046346 239
544 3300005366 Ga0070659_100002503 Ga0070659_10000250312 239
545 3300005367 Ga0070667_100007002 Ga0070667_1000070023 239
546 3300005438 Ga0070701_10000116 Ga0070701_1000011621 239
547 3300005440 Ga0070705_100006545 Ga0070705_1000065451 239
548 3300005441 Ga0070700_100004259 Ga0070700_1000042594 239
549 3300005444 Ga0070694_100003022 Ga0070694_1000030227 239
550 3300005445 Ga0070708_100163082 Ga0070708_1001630822 239
551 3300005456 Ga0070678_100001304 Ga0070678_1000013043 239
552 3300005458 Ga0070681_10004628 Ga0070681_100046283 239
553 3300005459 Ga0068867_100000619 Ga0068867_1000006195 239
554 3300005466 Ga0070685_10000856 Ga0070685_1000085616 239
555 3300005518 Ga0070699_100544628 Ga0070699_1005446281 239
556 3300005530 Ga0070679_100035049 Ga0070679_1000350495 239
557 3300005535 Ga0070684_100006410 Ga0070684_1000064106 239
558 3300005539 Ga0068853_100001956 Ga0068853_10000195612 239
559 3300005544 Ga0070686_100001494 Ga0070686_1000014943 239
560 3300005544 Ga0070686_100153304 Ga0070686_1001533042 239
561 3300005545 Ga0070695_100007956 Ga0070695_1000079565 239
562 3300005547 Ga0070693_100001925 Ga0070693_1000019259 239
563 3300005549 Ga0070704_100000828 Ga0070704_10000082813 239
564 3300005563 Ga0068855_100004638 Ga0068855_1000046384 239
565 3300005564 Ga0070664_100003244 Ga0070664_1000032443 239
566 3300005577 Ga0068857_100004358 Ga0068857_1000043583 239
567 3300005578 Ga0068854_100007930 Ga0068854_1000079303 239
568 3300005614 Ga0068856_100023463 Ga0068856_1000234637 239
569 3300005616 Ga0068852_100005642 Ga0068852_1000056425 239
570 3300005617 Ga0068859_100011499 Ga0068859_1000114996 239
571 3300005618 Ga0068864_100000501 Ga0068864_10000050136 239
572 3300005719 Ga0068861_100001978 Ga0068861_1000019783 239
573 3300005834 Ga0068851_10112984 Ga0068851_101129841 239
574 3300005840 Ga0068870_10000104 Ga0068870_100001044 239
575 3300005841 Ga0068863_100060167 Ga0068863_1000601673 239
576 3300005843 Ga0068860_100007083 Ga0068860_10000708313 239
577 3300005844 Ga0068862_100002741 Ga0068862_1000027413 239
578 3300006237 Ga0097621_100000435 Ga0097621_10000043521 239
579 3300006353 Ga0075370_10047312 Ga0075370_100473122 239
580 3300006358 Ga0068871_100000485 Ga0068871_1000004858 239
581 3300006852 Ga0075433_10009783 Ga0075433_100097837 239
582 3300006871 Ga0075434_100015803 Ga0075434_1000158034 239
583 3300006881 Ga0068865_100020005 Ga0068865_1000200053 239
584 3300006914 Ga0075436_100135142 Ga0075436_1001351422 239
585 3300006931 Ga0097620_100011499 Ga0097620_1000114996 239
586 3300007076 Ga0075435_100075146 Ga0075435_1000751462 239
587 3300009011 Ga0105251_10063525 Ga0105251_100635252 239
588 3300009036 Ga0105244_10086357 Ga0105244_100863572 239
589 3300009093 Ga0105240_10118326 Ga0105240_101183264 239
590 3300009094 Ga0111539_10002680 Ga0111539_100026804 239
591 3300009101 Ga0105247_10038596 Ga0105247_100385962 239
592 3300009148 Ga0105243_10007567 Ga0105243_100075672 239
593 3300009174 Ga0105241_10000805 Ga0105241_100008056 239
594 3300009176 Ga0105242_10006128 Ga0105242_100061285 239
595 3300009177 Ga0105248_10002578 Ga0105248_1000257814 239
596 3300009177 Ga0105248_10031967 Ga0105248_100319674 239
597 3300009545 Ga0105237_10164683 Ga0105237_101646833 239
598 3300009553 Ga0105249_10017076 Ga0105249_100170762 239
599 3300010375 Ga0105239_10031376 Ga0105239_100313762 239
600 3300011119 Ga0105246_10001159 Ga0105246_1000115913 239
601 3300013100 Ga0157373_10054823 Ga0157373_100548232 239
602 3300013102 Ga0157371_10011034 Ga0157371_100110346 239
603 3300013296 Ga0157374_10025598 Ga0157374_100255983 239
604 3300013297 Ga0157378_10077255 Ga0157378_100772552 239
605 3300013306 Ga0163162_10022100 Ga0163162_100221002 239
606 3300013307 Ga0157372_10032836 Ga0157372_100328363 239
607 3300013308 Ga0157375_10008574 Ga0157375_100085742 239
608 3300014325 Ga0163163_10009906 Ga0163163_100099069 239
609 3300014326 Ga0157380_10001249 Ga0157380_1000124913 239
610 3300014745 Ga0157377_10017604 Ga0157377_100176043 239
611 3300014968 Ga0157379_10051388 Ga0157379_100513883 239
612 3300014969 Ga0157376_10000696 Ga0157376_100006968 239
613 3300017792 Ga0163161_10005280 Ga0163161_100052802 239
614 3300025271 Ga0207666_1000085 Ga0207666_10000855 239
615 3300025315 Ga0207697_10002998 Ga0207697_100029985 239
616 3300025893 Ga0207682_10003689 Ga0207682_100036893 239
617 3300025899 Ga0207642_10021746 Ga0207642_100217463 239
618 3300025900 Ga0207710_10002518 Ga0207710_100025186 239
619 3300025901 Ga0207688_10000088 Ga0207688_1000008813 239
620 3300025903 Ga0207680_10152854 Ga0207680_101528541 239
621 3300025904 Ga0207647_10011501 Ga0207647_100115012 239
622 3300025907 Ga0207645_10000668 Ga0207645_100006688 239
623 3300025908 Ga0207643_10000085 Ga0207643_1000008535 239
624 3300025911 Ga0207654_10000373 Ga0207654_1000037320 239
625 3300025913 Ga0207695_10198206 Ga0207695_101982062 239
626 3300025917 Ga0207660_10000370 Ga0207660_1000037027 239
627 3300025918 Ga0207662_10003085 Ga0207662_100030855 239
628 3300025919 Ga0207657_10011290 Ga0207657_100112905 239
629 3300025923 Ga0207681_10023297 Ga0207681_100232973 239
630 3300025925 Ga0207650_10004412 Ga0207650_100044129 239
631 3300025926 Ga0207659_10000200 Ga0207659_1000020014 239
632 3300025927 Ga0207687_10012599 Ga0207687_100125992 239
633 3300025932 Ga0207690_10007237 Ga0207690_100072374 239
634 3300025933 Ga0207706_10010392 Ga0207706_100103925 239
635 3300025934 Ga0207686_10000682 Ga0207686_1000068220 239
636 3300025935 Ga0207709_10124416 Ga0207709_101244162 239
637 3300025936 Ga0207670_10061073 Ga0207670_100610732 239
638 3300025936 Ga0207670_10143676 Ga0207670_101436762 239
639 3300025937 Ga0207669_10000129 Ga0207669_1000012918 239
640 3300025938 Ga0207704_10000366 Ga0207704_100003663 239
641 3300025940 Ga0207691_10006943 Ga0207691_100069438 239
642 3300025941 Ga0207711_10002466 Ga0207711_1000246615 239
643 3300025942 Ga0207689_10000547 Ga0207689_1000054730 239
644 3300025944 Ga0207661_10000373 Ga0207661_1000037322 239
645 3300025945 Ga0207679_10000558 Ga0207679_100005586 239
646 3300025945 Ga0207679_10090067 Ga0207679_100900673 239
647 3300025949 Ga0207667_10064488 Ga0207667_100644882 239
648 3300025960 Ga0207651_10000709 Ga0207651_100007094 239
649 3300025972 Ga0207668_10008583 Ga0207668_100085836 239
650 3300025981 Ga0207640_10011452 Ga0207640_100114526 239
651 3300025986 Ga0207658_10021810 Ga0207658_100218102 239
652 3300026023 Ga0207677_10004798 Ga0207677_100047986 239
653 3300026041 Ga0207639_10016724 Ga0207639_100167243 239
654 3300026067 Ga0207678_10005937 Ga0207678_100059375 239
655 3300026075 Ga0207708_10008554 Ga0207708_100085545 239
656 3300026078 Ga0207702_10174283 Ga0207702_101742832 239
657 3300026088 Ga0207641_10019914 Ga0207641_100199145 239
658 3300026088 Ga0207641_10187632 Ga0207641_101876321 239
659 3300026089 Ga0207648_10006768 Ga0207648_100067689 239
660 3300026095 Ga0207676_10017594 Ga0207676_100175942 239
661 3300026116 Ga0207674_10005267 Ga0207674_100052675 239
662 3300026118 Ga0207675_100011076 Ga0207675_1000110765 239
663 3300026121 Ga0207683_10001220 Ga0207683_100012205 239
664 3300026142 Ga0207698_10218209 Ga0207698_102182092 239
665 3300027682 Ga0209971_1014606 Ga0209971_10146062 239
666 3300027876 Ga0209974_10003102 Ga0209974_100031024 239
667 3300027907 Ga0207428_10000896 Ga0207428_100008965 239
668 3300028381 Ga0268264_10001202 Ga0268264_100012025 239
669 3300034817 Ga0373948_0000864 Ga0373948_0000864_3160_4017 239
670 3300034957 Ga0373938_0000788 Ga0373938_0000788_3310_4167 239
671 3300035084 Ga0373928_0002179 Ga0373928_0002179_696_1553 239
672 3300035085 Ga0373929_0008281 Ga0373929_0008281_291_1148 239
673 3300035090 Ga0373949_0002890 Ga0373949_0002890_485_1342 239
674 3300035091 Ga0373951_0004633 Ga0373951_0004633_544_1401 239
675 3300035092 Ga0373952_0002634 Ga0373952_0002634_1790_2647 239
676 3300035112 Ga0373932_0000963 Ga0373932_0000963_3814_4671 239
677 3300035114 Ga0373939_0000862 Ga0373939_0000862_6179_7036 239
678 3300035115 Ga0373941_0011994 Ga0373941_0011994_1341_2198 239
679 3300035121 Ga0373960_0027787 Ga0373960_0027787_291_1148 239
680 3300035241 Ga0373961_0005311 Ga0373961_0005311_493_1350 239
681 3300035242 Ga0373962_0007887 Ga0373962_0007887_1345_2202 239
682 3300035691 Ga0373931_0013241 Ga0373931_0013241_539_1396 239
683 3300035691 Ga0373931_0279804 Ga0373931_0279804_68_925 239
684 3300039447 Ga0436361_0570470 Ga0436361_0570470_809_1663 239
685 3300046491 Ga0495584_0022014 Ga0495584_0022014_91_948 239
686 3300046684 Ga0495669_0078650 Ga0495669_0078650_427_1284 239
687 3300048903 Ga0496100_0019839 Ga0496100_0019839_1853_2710 239
688 3300048904 Ga0496101_0012308 Ga0496101_0012308_260_1117 239
689 3300048907 Ga0496104_0143355 Ga0496104_0143355_1049_1906 239
690 3300048909 Ga0496106_0009382 Ga0496106_0009382_1451_2308 239
691 3300048910 Ga0496107_0007600 Ga0496107_0007600_3012_3869 239
692 3300048910 Ga0496107_0198403 Ga0496107_0198403_606_1463 239
693 3300048911 Ga0496108_0001956 Ga0496108_0001956_7630_8487 239
694 3300048911 Ga0496108_0033980 Ga0496108_0033980_896_1753 239
695 3300048912 Ga0496109_0003867 Ga0496109_0003867_7896_8753 239
696 3300048912 Ga0496109_0065297 Ga0496109_0065297_229_1086 239
697 3300048913 Ga0496110_0020613 Ga0496110_0020613_4595_5452 239
698 3300048915 Ga0496112_0011458 Ga0496112_0011458_3419_4276 239
699 3300048916 Ga0496113_0000507 Ga0496113_0000507_10302_11159 239
700 3300048916 Ga0496113_0098034 Ga0496113_0098034_468_1325 239
701 3300048918 Ga0496115_0022877 Ga0496115_0022877_688_1545 239
702 3300050511 nmdc:mga08y16_81856_c1 nmdc:mga08y16_81856_c1_1853_2710 239
703 3300050512 nmdc:mga0n895_26501_c1 nmdc:mga0n895_26501_c1_3738_4595 239
704 3300050513 nmdc:mga0rr50_114052_c1 nmdc:mga0rr50_114052_c1_1270_2127 239
705 3300000652 ARCol0yngRDRAFT_1000324 ARCol0yngRDRAFT_10003244 240
706 3300001989 JGI24739J22299_10074482 JGI24739J22299_100744821 240
707 3300005344 Ga0070661_100265548 Ga0070661_1002655482 240
708 3300005564 Ga0070664_100153061 Ga0070664_1001530612 240
709 3300006871 Ga0075434_100127719 Ga0075434_1001277192 240
710 3300009148 Ga0105243_10077915 Ga0105243_100779152 240
711 3300009553 Ga0105249_10742639 Ga0105249_107426392 240
712 3300014968 Ga0157379_10284326 Ga0157379_102843262 240
713 3300025935 Ga0207709_10089042 Ga0207709_100890422 240
714 3300027617 Ga0210002_1001426 Ga0210002_10014262 240
715 3300027717 Ga0209998_10005638 Ga0209998_100056382 240
716 3300031241 Ga0265325_10070566 Ga0265325_100705662 240
717 3300032133 Ga0316583_10000114 Ga0316583_100001149 240
718 3300035114 Ga0373939_0001546 Ga0373939_0001546_4039_4902 240
719 3300035692 Ga0373935_0051714 Ga0373935_0051714_1471_2328 240
720 3300046526 Ga0495666_0102814 Ga0495666_0102814_414_1271 240
721 3300046681 Ga0495647_0145225 Ga0495647_0145225_27_884 240
722 3300046683 Ga0495658_0261294 Ga0495658_0261294_202_1059 240
723 3300048914 Ga0496111_0009164 Ga0496111_0009164_4029_4889 240
724 3300048915 Ga0496112_0088275 Ga0496112_0088275_1590_2447 240
725 3300050512 nmdc:mga0n895_176560_c1 nmdc:mga0n895_176560_c1_660_1559 240
726 3300053153 Ga0500616_0000001 Ga0500616_0000001_527088_527975 240
727 iso_pu_bacteria 8054002106 8054007663 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

67

237

0.85

Feature Viewer

pLDDT pTM Quality
61.85 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map