F477718
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 363 | 726 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300001978|JGI24747J21853_1009353|JGI24747J21853_10093532 |
| Length | 150 |
| Sequence | MSLFLPVPPGPLSPATNRKGPQMIDHIYLPVTNIKRSLDFYSALLTPLGKADRWKFEAKAGYPDLWGFGEPQPGFWLKESNASFPALYVAFAALSEQAVNEAFDAALAHGGKDNGAPGLRPQFLPDYYAANVLDPDGYSLEICFKPWLYE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 199 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 227 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 228 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 229 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 230 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 233 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 234 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 235 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 236 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 237 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 240 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 241 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 242 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 243 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 244 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 245 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 246 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 247 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 250 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 251 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 252 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 326 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 336 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 339 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 353 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 355 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 358 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.6 |
| Nodule | 0 |
| Rhizoplane | 2.61 |
| Rhizosphere | 84.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3239005 | 2162886007 | Bacteria | 3268 |
| 2 | JGI24747J21853_1009353 | 3300001978 | Bacteria | 967 |
| 3 | JGI24739J22299_10064142 | 3300001989 | Bacteria | 1155 |
| 4 | JGI24748J21848_1012606 | 3300002074 | Bacteria | 998 |
| 5 | JGI24738J21930_10005840 | 3300002075 | Bacteria | 2924 |
| 6 | JGI24744J21845_10002652 | 3300002077 | Bacteria | 3651 |
| 7 | JGI25162J39368_1000010 | 3300002737 | Bacteria | 389629 |
| 8 | JGI25163J39215_1000005 | 3300002771 | Bacteria | 128851 |
| 9 | JGI25164J39214_1000003 | 3300002772 | Bacteria | 389390 |
| 10 | rootH2_10016961 | 3300003320 | Bacteria | 5664 |
| 11 | Ga0055538_1000009 | 3300003751 | Bacteria | 389629 |
| 12 | Ga0055539_1000013 | 3300003752 | Bacteria | 389629 |
| 13 | Ga0055533_1000017 | 3300003756 | Bacteria | 389629 |
| 14 | Ga0055525_1000019 | 3300003759 | Bacteria | 389629 |
| 15 | Ga0055541_1000010 | 3300003841 | Bacteria | 389629 |
| 16 | Ga0065704_10001203 | 3300005289 | Bacteria | 8956 |
| 17 | Ga0065704_10131855 | 3300005289 | Bacteria | 1619 |
| 18 | Ga0065704_10165426 | 3300005289 | Bacteria | 1325 |
| 19 | Ga0070676_10523544 | 3300005328 | Bacteria | 845 |
| 20 | Ga0070690_100038790 | 3300005330 | Bacteria | 3008 |
| 21 | Ga0068869_100010287 | 3300005334 | Bacteria | 6097 |
| 22 | Ga0070666_10197535 | 3300005335 | Bacteria | 1415 |
| 23 | Ga0070680_100240017 | 3300005336 | Bacteria | 1532 |
| 24 | Ga0070682_100044718 | 3300005337 | Bacteria | 2742 |
| 25 | Ga0068868_100004689 | 3300005338 | Bacteria | 9601 |
| 26 | Ga0070660_100029000 | 3300005339 | Bacteria | 4145 |
| 27 | Ga0070689_100019874 | 3300005340 | Bacteria | 4973 |
| 28 | Ga0070691_10006182 | 3300005341 | Bacteria | 5464 |
| 29 | Ga0070687_100011551 | 3300005343 | Bacteria | 3866 |
| 30 | Ga0070661_100022741 | 3300005344 | Bacteria | 4489 |
| 31 | Ga0070692_10358177 | 3300005345 | Bacteria | 909 |
| 32 | Ga0070668_100120512 | 3300005347 | Bacteria | 2096 |
| 33 | Ga0070669_100021971 | 3300005353 | Bacteria | 4562 |
| 34 | Ga0070675_101755630 | 3300005354 | Bacteria | 572 |
| 35 | Ga0070671_100085463 | 3300005355 | Bacteria | 2639 |
| 36 | Ga0070673_100242496 | 3300005364 | Bacteria | 1568 |
| 37 | Ga0070688_100063907 | 3300005365 | Bacteria | 2334 |
| 38 | Ga0070659_100030764 | 3300005366 | Bacteria | 4154 |
| 39 | Ga0070667_100000794 | 3300005367 | Bacteria | 29595 |
| 40 | Ga0070703_10033674 | 3300005406 | Bacteria | 1561 |
| 41 | Ga0070709_10005916 | 3300005434 | Bacteria | 6637 |
| 42 | Ga0070714_100403384 | 3300005435 | Bacteria | 1293 |
| 43 | Ga0070710_10100630 | 3300005437 | Bacteria | 1720 |
| 44 | Ga0070701_10004576 | 3300005438 | Bacteria | 5624 |
| 45 | Ga0070711_100192768 | 3300005439 | Bacteria | 1567 |
| 46 | Ga0070705_100037004 | 3300005440 | Bacteria | 2749 |
| 47 | Ga0070700_100002695 | 3300005441 | Bacteria | 9071 |
| 48 | Ga0070694_100003295 | 3300005444 | Bacteria | 9656 |
| 49 | Ga0070663_100176515 | 3300005455 | Bacteria | 1654 |
| 50 | Ga0070678_100008828 | 3300005456 | Bacteria | 6062 |
| 51 | Ga0070662_100239877 | 3300005457 | Bacteria | 1453 |
| 52 | Ga0068867_100047479 | 3300005459 | Bacteria | 3156 |
| 53 | Ga0070685_10156918 | 3300005466 | Bacteria | 1447 |
| 54 | Ga0070706_100215073 | 3300005467 | Bacteria | 1794 |
| 55 | Ga0070706_101306245 | 3300005467 | Bacteria | 665 |
| 56 | Ga0070707_100004763 | 3300005468 | Bacteria | 12697 |
| 57 | Ga0070698_100286381 | 3300005471 | Bacteria | 1579 |
| 58 | Ga0070698_100685396 | 3300005471 | Bacteria | 967 |
| 59 | Ga0070679_100386165 | 3300005530 | Bacteria | 1347 |
| 60 | Ga0070697_100060684 | 3300005536 | Bacteria | 3083 |
| 61 | Ga0070697_100069270 | 3300005536 | Bacteria | 2889 |
| 62 | Ga0068853_100080626 | 3300005539 | Bacteria | 2848 |
| 63 | Ga0070686_100038219 | 3300005544 | Bacteria | 2982 |
| 64 | Ga0070695_100001855 | 3300005545 | Bacteria | 11929 |
| 65 | Ga0070696_100075923 | 3300005546 | Bacteria | 2371 |
| 66 | Ga0070693_100042155 | 3300005547 | Bacteria | 2571 |
| 67 | Ga0070665_100037045 | 3300005548 | Bacteria | 4905 |
| 68 | Ga0070665_100087338 | 3300005548 | Bacteria | 3124 |
| 69 | Ga0070704_100023719 | 3300005549 | Bacteria | 4013 |
| 70 | Ga0068855_100007614 | 3300005563 | Bacteria | 13101 |
| 71 | Ga0068855_100333596 | 3300005563 | Bacteria | 1674 |
| 72 | Ga0068854_100184291 | 3300005578 | Bacteria | 1632 |
| 73 | Ga0068856_100198181 | 3300005614 | Bacteria | 2022 |
| 74 | Ga0070702_100002761 | 3300005615 | Bacteria | 7689 |
| 75 | Ga0068852_100111989 | 3300005616 | Bacteria | 2482 |
| 76 | Ga0068859_100002434 | 3300005617 | Bacteria | 18947 |
| 77 | Ga0068866_10001034 | 3300005718 | Bacteria | 12238 |
| 78 | Ga0068861_100174020 | 3300005719 | Bacteria | 1786 |
| 79 | Ga0068851_10459988 | 3300005834 | Bacteria | 757 |
| 80 | Ga0068858_100063666 | 3300005842 | Bacteria | 3412 |
| 81 | Ga0068860_100049201 | 3300005843 | Bacteria | 4016 |
| 82 | Ga0068862_100003107 | 3300005844 | Bacteria | 14482 |
| 83 | Ga0075364_10004291 | 3300006051 | Bacteria | 8186 |
| 84 | Ga0075364_10445885 | 3300006051 | Bacteria | 884 |
| 85 | Ga0070715_10044920 | 3300006163 | Bacteria | 1870 |
| 86 | Ga0070716_100018247 | 3300006173 | Bacteria | 3651 |
| 87 | Ga0070712_100068290 | 3300006175 | Bacteria | 2532 |
| 88 | Ga0075362_10000015 | 3300006177 | Bacteria | 84026 |
| 89 | Ga0075367_10119800 | 3300006178 | Bacteria | 1621 |
| 90 | Ga0075369_10000089 | 3300006186 | Bacteria | 24511 |
| 91 | Ga0075366_10000072 | 3300006195 | Bacteria | 39088 |
| 92 | Ga0097621_100258302 | 3300006237 | Bacteria | 1527 |
| 93 | Ga0075370_10063904 | 3300006353 | Bacteria | 2099 |
| 94 | Ga0068865_100048976 | 3300006881 | Bacteria | 2910 |
| 95 | Ga0075436_100377182 | 3300006914 | Bacteria | 1025 |
| 96 | Ga0097620_100002434 | 3300006931 | Bacteria | 18947 |
| 97 | Ga0099794_10697660 | 3300007265 | Bacteria | 540 |
| 98 | Ga0099795_10007162 | 3300007788 | Bacteria | 3094 |
| 99 | Ga0099795_10097734 | 3300007788 | Bacteria | 1147 |
| 100 | Ga0105251_10004367 | 3300009011 | Bacteria | 9652 |
| 101 | Ga0105244_10039053 | 3300009036 | Bacteria | 2473 |
| 102 | Ga0105250_10001159 | 3300009092 | Bacteria | 14825 |
| 103 | Ga0105250_10008431 | 3300009092 | Bacteria | 4380 |
| 104 | Ga0105240_11466340 | 3300009093 | Bacteria | 716 |
| 105 | Ga0105245_10002500 | 3300009098 | Bacteria | 16582 |
| 106 | Ga0105247_10016195 | 3300009101 | Bacteria | 4466 |
| 107 | Ga0105247_10094556 | 3300009101 | Bacteria | 1902 |
| 108 | Ga0105243_10130617 | 3300009148 | Bacteria | 2130 |
| 109 | Ga0105243_10186394 | 3300009148 | Bacteria | 1809 |
| 110 | Ga0105241_10175486 | 3300009174 | Bacteria | 1773 |
| 111 | Ga0105242_10009509 | 3300009176 | Bacteria | 7450 |
| 112 | Ga0105248_10146596 | 3300009177 | Bacteria | 2664 |
| 113 | Ga0105237_10022373 | 3300009545 | Bacteria | 6486 |
| 114 | Ga0105237_10051981 | 3300009545 | Bacteria | 4115 |
| 115 | Ga0105238_10631853 | 3300009551 | Bacteria | 1080 |
| 116 | Ga0105249_10014068 | 3300009553 | Bacteria | 7073 |
| 117 | Ga0099796_10380729 | 3300010159 | Bacteria | 615 |
| 118 | Ga0105239_10059356 | 3300010375 | Bacteria | 4198 |
| 119 | Ga0105246_10000102 | 3300011119 | Bacteria | 37463 |
| 120 | Ga0105246_10267507 | 3300011119 | Bacteria | 1365 |
| 121 | Ga0157373_10639381 | 3300013100 | Bacteria | 776 |
| 122 | Ga0157371_10013871 | 3300013102 | Bacteria | 6105 |
| 123 | Ga0157371_10168600 | 3300013102 | Bacteria | 1564 |
| 124 | Ga0157370_10118720 | 3300013104 | Bacteria | 2470 |
| 125 | Ga0157369_10002042 | 3300013105 | Bacteria | 24345 |
| 126 | Ga0157369_10217830 | 3300013105 | Bacteria | 1999 |
| 127 | Ga0157374_10253610 | 3300013296 | Bacteria | 1732 |
| 128 | Ga0157374_11315059 | 3300013296 | Bacteria | 745 |
| 129 | Ga0157378_10159532 | 3300013297 | Bacteria | 2108 |
| 130 | Ga0157378_11524596 | 3300013297 | Bacteria | 713 |
| 131 | Ga0163162_10087004 | 3300013306 | Bacteria | 3203 |
| 132 | Ga0163162_10288082 | 3300013306 | Bacteria | 1774 |
| 133 | Ga0163162_10378602 | 3300013306 | Bacteria | 1548 |
| 134 | Ga0157372_10003068 | 3300013307 | Bacteria | 17992 |
| 135 | Ga0157372_10073167 | 3300013307 | Bacteria | 3862 |
| 136 | Ga0157375_10000819 | 3300013308 | Bacteria | 27196 |
| 137 | Ga0157375_10001585 | 3300013308 | Bacteria | 19562 |
| 138 | Ga0157375_10949221 | 3300013308 | Bacteria | 1002 |
| 139 | Ga0163163_10115530 | 3300014325 | Bacteria | 2715 |
| 140 | Ga0157380_10007831 | 3300014326 | Bacteria | 7603 |
| 141 | Ga0182008_10020924 | 3300014497 | Bacteria | 3365 |
| 142 | Ga0182008_10024200 | 3300014497 | Bacteria | 3093 |
| 143 | Ga0182008_10026807 | 3300014497 | Bacteria | 2921 |
| 144 | Ga0182008_10384308 | 3300014497 | Bacteria | 751 |
| 145 | Ga0182008_10583282 | 3300014497 | Bacteria | 625 |
| 146 | Ga0157377_10025444 | 3300014745 | Bacteria | 3157 |
| 147 | Ga0157379_10001763 | 3300014968 | Bacteria | 17891 |
| 148 | Ga0157376_10043329 | 3300014969 | Bacteria | 3693 |
| 149 | Ga0182006_1000066 | 3300015261 | Bacteria | 151095 |
| 150 | Ga0182006_1005946 | 3300015261 | Bacteria | 5737 |
| 151 | Ga0182007_10034208 | 3300015262 | Bacteria | 1718 |
| 152 | Ga0182005_1001642 | 3300015265 | Bacteria | 8697 |
| 153 | Ga0182005_1002721 | 3300015265 | Bacteria | 6179 |
| 154 | Ga0182005_1108373 | 3300015265 | Bacteria | 783 |
| 155 | Ga0182005_1108553 | 3300015265 | Bacteria | 783 |
| 156 | Ga0163161_10001211 | 3300017792 | Bacteria | 19428 |
| 157 | Ga0163161_10056133 | 3300017792 | Bacteria | 2860 |
| 158 | Ga0209760_100038 | 3300025207 | Bacteria | 126360 |
| 159 | Ga0209784_100012 | 3300025224 | Bacteria | 535823 |
| 160 | Ga0209566_100010 | 3300025225 | Bacteria | 535823 |
| 161 | Ga0209674_100023 | 3300025226 | Bacteria | 535823 |
| 162 | Ga0209563_100027 | 3300025230 | Bacteria | 535823 |
| 163 | Ga0207427_100017 | 3300025231 | Bacteria | 535823 |
| 164 | Ga0209437_100029 | 3300025233 | Bacteria | 535823 |
| 165 | Ga0209677_100014 | 3300025253 | Bacteria | 535823 |
| 166 | Ga0209233_1001957 | 3300025261 | Bacteria | 7838 |
| 167 | Ga0209675_1014477 | 3300025291 | Bacteria | 2401 |
| 168 | Ga0209025_1057859 | 3300025294 | Bacteria | 1477 |
| 169 | Ga0209051_1033397 | 3300025303 | Bacteria | 1947 |
| 170 | Ga0207696_1000788 | 3300025711 | Bacteria | 20764 |
| 171 | Ga0207696_1044933 | 3300025711 | Bacteria | 1279 |
| 172 | Ga0207655_1004784 | 3300025728 | Bacteria | 9440 |
| 173 | Ga0207655_1037207 | 3300025728 | Bacteria | 2145 |
| 174 | Ga0207713_1005257 | 3300025735 | Bacteria | 8159 |
| 175 | Ga0207653_10025305 | 3300025885 | Bacteria | 1898 |
| 176 | Ga0207692_10015153 | 3300025898 | Unclassified | 3386 |
| 177 | Ga0207710_10077637 | 3300025900 | Bacteria | 1534 |
| 178 | Ga0207710_10089879 | 3300025900 | Bacteria | 1436 |
| 179 | Ga0207688_10002669 | 3300025901 | Bacteria | 9661 |
| 180 | Ga0207680_10249618 | 3300025903 | Bacteria | 1225 |
| 181 | Ga0207647_10010922 | 3300025904 | Bacteria | 6389 |
| 182 | Ga0207685_10215763 | 3300025905 | Bacteria | 910 |
| 183 | Ga0207699_10067409 | 3300025906 | Bacteria | 2175 |
| 184 | Ga0207645_10416088 | 3300025907 | Bacteria | 905 |
| 185 | Ga0207684_10563400 | 3300025910 | Bacteria | 974 |
| 186 | Ga0207654_10093561 | 3300025911 | Bacteria | 1838 |
| 187 | Ga0207695_11427946 | 3300025913 | Bacteria | 572 |
| 188 | Ga0207671_10046544 | 3300025914 | Bacteria | 3209 |
| 189 | Ga0207693_10006185 | 3300025915 | Bacteria | 9931 |
| 190 | Ga0207663_10157710 | 3300025916 | Bacteria | 1598 |
| 191 | Ga0207662_10147914 | 3300025918 | Bacteria | 1492 |
| 192 | Ga0207657_10213700 | 3300025919 | Bacteria | 1547 |
| 193 | Ga0207657_10729149 | 3300025919 | Bacteria | 769 |
| 194 | Ga0207649_10027626 | 3300025920 | Bacteria | 3332 |
| 195 | Ga0207646_10052718 | 3300025922 | Bacteria | 3640 |
| 196 | Ga0207681_10242241 | 3300025923 | Bacteria | 1404 |
| 197 | Ga0207694_10504583 | 3300025924 | Bacteria | 1013 |
| 198 | Ga0207650_10000241 | 3300025925 | Bacteria | 60600 |
| 199 | Ga0207650_11144089 | 3300025925 | Bacteria | 662 |
| 200 | Ga0207659_11339754 | 3300025926 | Unclassified | 614 |
| 201 | Ga0207687_10011422 | 3300025927 | Bacteria | 5805 |
| 202 | Ga0207664_10306464 | 3300025929 | Bacteria | 1398 |
| 203 | Ga0207644_10026605 | 3300025931 | Bacteria | 3988 |
| 204 | Ga0207690_10200239 | 3300025932 | Bacteria | 1516 |
| 205 | Ga0207706_10003200 | 3300025933 | Bacteria | 15717 |
| 206 | Ga0207686_10027452 | 3300025934 | Unclassified | 3334 |
| 207 | Ga0207709_10224168 | 3300025935 | Bacteria | 1358 |
| 208 | Ga0207669_10253153 | 3300025937 | Bacteria | 1312 |
| 209 | Ga0207704_10001403 | 3300025938 | Bacteria | 10761 |
| 210 | Ga0207665_10001697 | 3300025939 | Bacteria | 14811 |
| 211 | Ga0207711_10035562 | 3300025941 | Bacteria | 4223 |
| 212 | Ga0207689_10016615 | 3300025942 | Bacteria | 6228 |
| 213 | Ga0207667_10022678 | 3300025949 | Bacteria | 6926 |
| 214 | Ga0207667_10833486 | 3300025949 | Bacteria | 917 |
| 215 | Ga0207712_10054178 | 3300025961 | Bacteria | 2816 |
| 216 | Ga0207640_10039103 | 3300025981 | Bacteria | 2999 |
| 217 | Ga0207658_10274952 | 3300025986 | Bacteria | 1441 |
| 218 | Ga0207677_10174098 | 3300026023 | Bacteria | 1686 |
| 219 | Ga0207703_10095813 | 3300026035 | Bacteria | 2504 |
| 220 | Ga0207639_10173499 | 3300026041 | Bacteria | 1828 |
| 221 | Ga0207678_10013359 | 3300026067 | Bacteria | 7206 |
| 222 | Ga0207678_10205900 | 3300026067 | Bacteria | 1683 |
| 223 | Ga0207708_10000709 | 3300026075 | Bacteria | 25151 |
| 224 | Ga0207702_10836971 | 3300026078 | Bacteria | 910 |
| 225 | Ga0207648_10003479 | 3300026089 | Bacteria | 16501 |
| 226 | Ga0207675_100002920 | 3300026118 | Bacteria | 16818 |
| 227 | Ga0207683_10016343 | 3300026121 | Bacteria | 6317 |
| 228 | Ga0268266_10490930 | 3300028379 | Bacteria | 1171 |
| 229 | Ga0268265_10270481 | 3300028380 | Bacteria | 1515 |
| 230 | Ga0268264_10098966 | 3300028381 | Bacteria | 2530 |
| 231 | Ga0265328_10006401 | 3300031239 | Bacteria | 4990 |
| 232 | Ga0265331_10118347 | 3300031250 | Unclassified | 1212 |
| 233 | Ga0265316_10451345 | 3300031344 | Unclassified | 922 |
| 234 | Ga0307513_10011047 | 3300031456 | Bacteria | 11261 |
| 235 | Ga0265313_10107084 | 3300031595 | Unclassified | 1233 |
| 236 | Ga0307508_10209678 | 3300031616 | Bacteria | 1549 |
| 237 | Ga0265342_10038998 | 3300031712 | Bacteria | 2889 |
| 238 | Ga0307405_10000197 | 3300031731 | Bacteria | 22213 |
| 239 | Ga0307413_11626549 | 3300031824 | Bacteria | 574 |
| 240 | Ga0307412_10057221 | 3300031911 | Bacteria | 2602 |
| 241 | Ga0307412_10209117 | 3300031911 | Bacteria | 1487 |
| 242 | Ga0307409_100099415 | 3300031995 | Bacteria | 2409 |
| 243 | Ga0307416_100024736 | 3300032002 | Bacteria | 4390 |
| 244 | Ga0307414_10116885 | 3300032004 | Bacteria | 2042 |
| 245 | Ga0307414_10140135 | 3300032004 | Bacteria | 1892 |
| 246 | Ga0373948_0044341 | 3300034817 | Bacteria | 940 |
| 247 | Ga0373950_0133409 | 3300034818 | Bacteria | 558 |
| 248 | Ga0373928_0018535 | 3300035084 | Bacteria | 1443 |
| 249 | Ga0373929_0054064 | 3300035085 | Bacteria | 924 |
| 250 | Ga0373951_0113344 | 3300035091 | Bacteria | 732 |
| 251 | Ga0373923_0426870 | 3300035111 | Bacteria | 641 |
| 252 | Ga0373932_0036069 | 3300035112 | Bacteria | 1402 |
| 253 | Ga0373939_0026098 | 3300035114 | Bacteria | 1644 |
| 254 | Ga0373941_0002351 | 3300035115 | Bacteria | 4150 |
| 255 | Ga0373945_0105604 | 3300035116 | Bacteria | 1107 |
| 256 | Ga0373960_0038531 | 3300035121 | Bacteria | 1370 |
| 257 | Ga0373943_0176050 | 3300035170 | Bacteria | 1173 |
| 258 | Ga0373946_0092203 | 3300035171 | Bacteria | 1344 |
| 259 | Ga0373942_0039573 | 3300035207 | Bacteria | 1283 |
| 260 | Ga0373961_0010227 | 3300035241 | Bacteria | 2308 |
| 261 | Ga0373962_0002951 | 3300035242 | Bacteria | 4081 |
| 262 | Ga0373931_0003666 | 3300035691 | Bacteria | 6944 |
| 263 | Ga0373935_0097113 | 3300035692 | Bacteria | 1937 |
| 264 | Ga0373927_0142429 | 3300035695 | Bacteria | 1568 |
| 265 | Ga0373947_0116463 | 3300035725 | Bacteria | 1694 |
| 266 | Ga0439438_000008 | 3300041405 | Bacteria | 178072 |
| 267 | Ga0439438_000186 | 3300041405 | Bacteria | 27822 |
| 268 | Ga0439438_000263 | 3300041405 | Bacteria | 23508 |
| 269 | Ga0439438_004688 | 3300041405 | Bacteria | 5189 |
| 270 | Ga0439447_000059 | 3300041407 | Bacteria | 38399 |
| 271 | Ga0439447_000518 | 3300041407 | Bacteria | 14295 |
| 272 | Ga0439447_001639 | 3300041407 | Bacteria | 8210 |
| 273 | Ga0439447_002371 | 3300041407 | Bacteria | 6885 |
| 274 | Ga0439447_004319 | 3300041407 | Bacteria | 4921 |
| 275 | Ga0439447_008309 | 3300041407 | Bacteria | 3223 |
| 276 | Ga0439447_014819 | 3300041407 | Bacteria | 2176 |
| 277 | Ga0439466_0000208 | 3300041411 | Bacteria | 23209 |
| 278 | Ga0439466_0000324 | 3300041411 | Bacteria | 18343 |
| 279 | Ga0439466_0001870 | 3300041411 | Bacteria | 8239 |
| 280 | Ga0439466_0002995 | 3300041411 | Bacteria | 6591 |
| 281 | Ga0439466_0010687 | 3300041411 | Bacteria | 3410 |
| 282 | Ga0439466_0052458 | 3300041411 | Bacteria | 1333 |
| 283 | Ga0439466_0108390 | 3300041411 | Bacteria | 862 |
| 284 | Ga0439466_0180631 | 3300041411 | Bacteria | 643 |
| 285 | Ga0439465_0210734 | 3300041413 | Bacteria | 710 |
| 286 | Ga0451791_1855958 | 3300041451 | Bacteria | 1068 |
| 287 | Ga0451795_0134650 | 3300041456 | Bacteria | 546 |
| 288 | Ga0451833_1493046 | 3300041491 | Bacteria | 730 |
| 289 | Ga0439431_0000006 | 3300041997 | Bacteria | 41057 |
| 290 | Ga0439445_0010886 | 3300042004 | Bacteria | 2160 |
| 291 | Ga0439432_000189 | 3300042006 | Bacteria | 21998 |
| 292 | Ga0439432_002172 | 3300042006 | Bacteria | 7400 |
| 293 | Ga0439432_004118 | 3300042006 | Bacteria | 5314 |
| 294 | Ga0439432_038751 | 3300042006 | Bacteria | 1517 |
| 295 | Ga0439451_001083 | 3300042009 | Bacteria | 5317 |
| 296 | Ga0439451_002714 | 3300042009 | Bacteria | 3593 |
| 297 | Ga0439452_000253 | 3300042010 | Bacteria | 36669 |
| 298 | Ga0439452_000674 | 3300042010 | Bacteria | 16810 |
| 299 | Ga0439452_001028 | 3300042010 | Bacteria | 12348 |
| 300 | Ga0439452_001344 | 3300042010 | Bacteria | 10253 |
| 301 | Ga0439456_000526 | 3300042013 | Bacteria | 8160 |
| 302 | Ga0439456_001325 | 3300042013 | Bacteria | 4942 |
| 303 | Ga0439456_001725 | 3300042013 | Bacteria | 4409 |
| 304 | Ga0439456_043549 | 3300042013 | Bacteria | 976 |
| 305 | Ga0439456_058855 | 3300042013 | Bacteria | 843 |
| 306 | Ga0439463_002428 | 3300042016 | Bacteria | 4749 |
| 307 | Ga0439463_024801 | 3300042016 | Bacteria | 1503 |
| 308 | Ga0450911_000009 | 3300042115 | Bacteria | 162968 |
| 309 | Ga0450911_003941 | 3300042115 | Bacteria | 2507 |
| 310 | Ga0450897_001266 | 3300042128 | Bacteria | 1683 |
| 311 | Ga0450894_001394 | 3300042131 | Bacteria | 3493 |
| 312 | Ga0450898_001209 | 3300042134 | Bacteria | 3336 |
| 313 | Ga0450902_027869 | 3300042137 | Bacteria | 947 |
| 314 | Ga0450904_000480 | 3300042139 | Bacteria | 7829 |
| 315 | Ga0450907_000003 | 3300042146 | Bacteria | 138102 |
| 316 | Ga0450907_000187 | 3300042146 | Bacteria | 22632 |
| 317 | Ga0450907_010268 | 3300042146 | Bacteria | 1554 |
| 318 | Ga0450910_000195 | 3300042147 | Bacteria | 6700 |
| 319 | Ga0439446_0000420 | 3300042156 | Bacteria | 8284 |
| 320 | Ga0439446_0013445 | 3300042156 | Bacteria | 2246 |
| 321 | Ga0450909_000681 | 3300042185 | Bacteria | 4537 |
| 322 | Ga0439434_0000019 | 3300042435 | Bacteria | 41172 |
| 323 | Ga0439434_0040467 | 3300042435 | Bacteria | 1431 |
| 324 | Ga0450901_002242 | 3300042533 | Bacteria | 2119 |
| 325 | Ga0439440_0003448 | 3300042993 | Bacteria | 3044 |
| 326 | Ga0495617_000024 | 3300046452 | Bacteria | 174402 |
| 327 | Ga0495617_002558 | 3300046452 | Bacteria | 7175 |
| 328 | Ga0495617_006193 | 3300046452 | Bacteria | 4209 |
| 329 | Ga0495617_064083 | 3300046452 | Bacteria | 1213 |
| 330 | Ga0495617_067476 | 3300046452 | Bacteria | 1178 |
| 331 | Ga0495617_075218 | 3300046452 | Bacteria | 1108 |
| 332 | Ga0495627_004795 | 3300046453 | Bacteria | 5588 |
| 333 | Ga0495627_020253 | 3300046453 | Bacteria | 2219 |
| 334 | Ga0495627_035217 | 3300046453 | Bacteria | 1561 |
| 335 | Ga0495603_0000535 | 3300046455 | Bacteria | 21117 |
| 336 | Ga0495603_0354944 | 3300046455 | Bacteria | 841 |
| 337 | Ga0495590_0003530 | 3300046457 | Bacteria | 6374 |
| 338 | Ga0495590_0077647 | 3300046457 | Bacteria | 1168 |
| 339 | Ga0495590_0104061 | 3300046457 | Bacteria | 1010 |
| 340 | Ga0495591_000054 | 3300046458 | Bacteria | 135364 |
| 341 | Ga0495591_000055 | 3300046458 | Bacteria | 135355 |
| 342 | Ga0495591_001528 | 3300046458 | Bacteria | 14219 |
| 343 | Ga0495591_001589 | 3300046458 | Bacteria | 13759 |
| 344 | Ga0495591_003342 | 3300046458 | Bacteria | 8335 |
| 345 | Ga0495591_003749 | 3300046458 | Bacteria | 7682 |
| 346 | Ga0495591_005366 | 3300046458 | Bacteria | 5954 |
| 347 | Ga0495591_007279 | 3300046458 | Bacteria | 4734 |
| 348 | Ga0495629_0290941 | 3300046459 | Bacteria | 1120 |
| 349 | Ga0495629_0672281 | 3300046459 | Bacteria | 689 |
| 350 | Ga0495638_0001316 | 3300046460 | Bacteria | 22896 |
| 351 | Ga0495638_0005377 | 3300046460 | Bacteria | 9547 |
| 352 | Ga0495638_0015276 | 3300046460 | Bacteria | 5158 |
| 353 | Ga0495638_0031710 | 3300046460 | Bacteria | 3394 |
| 354 | Ga0495653_0011626 | 3300046463 | Bacteria | 7186 |
| 355 | Ga0495653_0019616 | 3300046463 | Bacteria | 5483 |
| 356 | Ga0495650_0000052 | 3300046471 | Bacteria | 318176 |
| 357 | Ga0495650_0000632 | 3300046471 | Bacteria | 47322 |
| 358 | Ga0495650_0000775 | 3300046471 | Bacteria | 39396 |
| 359 | Ga0495650_0001762 | 3300046471 | Bacteria | 19648 |
| 360 | Ga0495650_0002438 | 3300046471 | Bacteria | 15060 |
| 361 | Ga0495650_0003367 | 3300046471 | Bacteria | 11722 |
| 362 | Ga0495650_0007323 | 3300046471 | Bacteria | 6654 |
| 363 | Ga0495650_0082378 | 3300046471 | Bacteria | 1238 |
| 364 | Ga0495605_0000002 | 3300046474 | Bacteria | 522417 |
| 365 | Ga0495605_0000006 | 3300046474 | Bacteria | 361304 |
| 366 | Ga0495605_0000257 | 3300046474 | Bacteria | 62503 |
| 367 | Ga0495605_0002034 | 3300046474 | Bacteria | 12759 |
| 368 | Ga0495605_0005581 | 3300046474 | Bacteria | 7316 |
| 369 | Ga0495605_0006241 | 3300046474 | Bacteria | 6871 |
| 370 | Ga0495605_0015217 | 3300046474 | Bacteria | 4191 |
| 371 | Ga0495605_0162357 | 3300046474 | Bacteria | 991 |
| 372 | Ga0495639_0296621 | 3300046475 | Bacteria | 805 |
| 373 | Ga0495584_0011786 | 3300046491 | Bacteria | 4470 |
| 374 | Ga0495584_0044274 | 3300046491 | Bacteria | 2246 |
| 375 | Ga0495584_0046508 | 3300046491 | Bacteria | 2189 |
| 376 | Ga0495584_0073708 | 3300046491 | Bacteria | 1715 |
| 377 | Ga0495584_0258040 | 3300046491 | Bacteria | 886 |
| 378 | Ga0495585_0000047 | 3300046492 | Bacteria | 120650 |
| 379 | Ga0495585_0001935 | 3300046492 | Bacteria | 15481 |
| 380 | Ga0495585_0011595 | 3300046492 | Bacteria | 5212 |
| 381 | Ga0495585_0020632 | 3300046492 | Bacteria | 3788 |
| 382 | Ga0495594_0003396 | 3300046499 | Bacteria | 8225 |
| 383 | Ga0495596_0017635 | 3300046500 | Bacteria | 2953 |
| 384 | Ga0495596_0021759 | 3300046500 | Bacteria | 2614 |
| 385 | Ga0495596_0067160 | 3300046500 | Bacteria | 1394 |
| 386 | Ga0495607_0001046 | 3300046501 | Bacteria | 25267 |
| 387 | Ga0495607_0001263 | 3300046501 | Bacteria | 22608 |
| 388 | Ga0495607_0004807 | 3300046501 | Bacteria | 9853 |
| 389 | Ga0495607_0009595 | 3300046501 | Bacteria | 6541 |
| 390 | Ga0495607_0013946 | 3300046501 | Bacteria | 5249 |
| 391 | Ga0495607_0030474 | 3300046501 | Bacteria | 3312 |
| 392 | Ga0495607_0037709 | 3300046501 | Bacteria | 2901 |
| 393 | Ga0495607_0078121 | 3300046501 | Bacteria | 1826 |
| 394 | Ga0495607_0095300 | 3300046501 | Bacteria | 1604 |
| 395 | Ga0495607_0116804 | 3300046501 | Bacteria | 1406 |
| 396 | Ga0495607_0188671 | 3300046501 | Bacteria | 1028 |
| 397 | Ga0495607_0258190 | 3300046501 | Bacteria | 835 |
| 398 | Ga0495607_0288418 | 3300046501 | Bacteria | 776 |
| 399 | Ga0495583_0000012 | 3300046506 | Bacteria | 324839 |
| 400 | Ga0495583_0006122 | 3300046506 | Bacteria | 7936 |
| 401 | Ga0495583_0177279 | 3300046506 | Bacteria | 873 |
| 402 | Ga0495583_0349408 | 3300046506 | Bacteria | 584 |
| 403 | Ga0495606_0000207 | 3300046507 | Bacteria | 103669 |
| 404 | Ga0495606_0000477 | 3300046507 | Bacteria | 65883 |
| 405 | Ga0495606_0000577 | 3300046507 | Bacteria | 58248 |
| 406 | Ga0495606_0009283 | 3300046507 | Bacteria | 8346 |
| 407 | Ga0495606_0011103 | 3300046507 | Bacteria | 7387 |
| 408 | Ga0495606_0011915 | 3300046507 | Bacteria | 7033 |
| 409 | Ga0495606_0014035 | 3300046507 | Bacteria | 6279 |
| 410 | Ga0495606_0047981 | 3300046507 | Bacteria | 2813 |
| 411 | Ga0495606_0051281 | 3300046507 | Bacteria | 2692 |
| 412 | Ga0495606_0086581 | 3300046507 | Bacteria | 1936 |
| 413 | Ga0495606_0245498 | 3300046507 | Bacteria | 996 |
| 414 | Ga0495610_0000209 | 3300046512 | Bacteria | 64342 |
| 415 | Ga0495610_0003616 | 3300046512 | Bacteria | 11929 |
| 416 | Ga0495610_0011838 | 3300046512 | Bacteria | 5300 |
| 417 | Ga0495610_0021129 | 3300046512 | Bacteria | 3586 |
| 418 | Ga0495610_0027234 | 3300046512 | Bacteria | 3040 |
| 419 | Ga0495610_0048608 | 3300046512 | Bacteria | 2081 |
| 420 | Ga0495610_0204110 | 3300046512 | Bacteria | 807 |
| 421 | Ga0495616_0000430 | 3300046513 | Bacteria | 32094 |
| 422 | Ga0495616_0000655 | 3300046513 | Bacteria | 25722 |
| 423 | Ga0495616_0021707 | 3300046513 | Bacteria | 3472 |
| 424 | Ga0495616_0048208 | 3300046513 | Bacteria | 2141 |
| 425 | Ga0495616_0106851 | 3300046513 | Bacteria | 1305 |
| 426 | Ga0495616_0143594 | 3300046513 | Bacteria | 1085 |
| 427 | Ga0495620_0000010 | 3300046515 | Bacteria | 173604 |
| 428 | Ga0495620_0000029 | 3300046515 | Bacteria | 122326 |
| 429 | Ga0495620_0000137 | 3300046515 | Bacteria | 59671 |
| 430 | Ga0495620_0000484 | 3300046515 | Bacteria | 25815 |
| 431 | Ga0495620_0000843 | 3300046515 | Bacteria | 18930 |
| 432 | Ga0495620_0001400 | 3300046515 | Bacteria | 14475 |
| 433 | Ga0495620_0006940 | 3300046515 | Bacteria | 6187 |
| 434 | Ga0495620_0026310 | 3300046515 | Bacteria | 2738 |
| 435 | Ga0495620_0073257 | 3300046515 | Bacteria | 1396 |
| 436 | Ga0495620_0266708 | 3300046515 | Bacteria | 652 |
| 437 | Ga0495630_0004914 | 3300046517 | Bacteria | 9395 |
| 438 | Ga0495631_0000239 | 3300046518 | Bacteria | 37813 |
| 439 | Ga0495631_0003091 | 3300046518 | Bacteria | 9175 |
| 440 | Ga0495631_0006776 | 3300046518 | Bacteria | 5881 |
| 441 | Ga0495631_0026174 | 3300046518 | Bacteria | 2682 |
| 442 | Ga0495631_0026452 | 3300046518 | Bacteria | 2664 |
| 443 | Ga0495631_0109452 | 3300046518 | Bacteria | 1188 |
| 444 | Ga0495631_0143185 | 3300046518 | Bacteria | 1026 |
| 445 | Ga0495632_0000755 | 3300046519 | Bacteria | 29084 |
| 446 | Ga0495632_0015196 | 3300046519 | Bacteria | 4327 |
| 447 | Ga0495632_0015916 | 3300046519 | Bacteria | 4199 |
| 448 | Ga0495632_0024893 | 3300046519 | Bacteria | 3173 |
| 449 | Ga0495632_0059685 | 3300046519 | Bacteria | 1855 |
| 450 | Ga0495632_0065486 | 3300046519 | Bacteria | 1755 |
| 451 | Ga0495632_0094516 | 3300046519 | Bacteria | 1414 |
| 452 | Ga0495632_0210056 | 3300046519 | Bacteria | 883 |
| 453 | Ga0495637_0000077 | 3300046520 | Bacteria | 78543 |
| 454 | Ga0495637_0000098 | 3300046520 | Bacteria | 66534 |
| 455 | Ga0495637_0005725 | 3300046520 | Bacteria | 6299 |
| 456 | Ga0495637_0006993 | 3300046520 | Bacteria | 5621 |
| 457 | Ga0495637_0038311 | 3300046520 | Bacteria | 2076 |
| 458 | Ga0495637_0059306 | 3300046520 | Bacteria | 1575 |
| 459 | Ga0495637_0249705 | 3300046520 | Bacteria | 639 |
| 460 | Ga0495643_0000345 | 3300046522 | Bacteria | 63090 |
| 461 | Ga0495643_0001038 | 3300046522 | Bacteria | 28173 |
| 462 | Ga0495643_0008035 | 3300046522 | Bacteria | 6727 |
| 463 | Ga0495643_0012951 | 3300046522 | Bacteria | 5012 |
| 464 | Ga0495643_0014006 | 3300046522 | Bacteria | 4781 |
| 465 | Ga0495643_0018458 | 3300046522 | Bacteria | 4053 |
| 466 | Ga0495643_0245524 | 3300046522 | Bacteria | 838 |
| 467 | Ga0495644_0196336 | 3300046523 | Bacteria | 777 |
| 468 | Ga0495644_0254488 | 3300046523 | Bacteria | 682 |
| 469 | Ga0495644_0278501 | 3300046523 | Bacteria | 652 |
| 470 | Ga0495644_0412284 | 3300046523 | Bacteria | 535 |
| 471 | Ga0495648_0001842 | 3300046524 | Bacteria | 20345 |
| 472 | Ga0495648_0002821 | 3300046524 | Bacteria | 15628 |
| 473 | Ga0495648_0004200 | 3300046524 | Bacteria | 12370 |
| 474 | Ga0495648_0005523 | 3300046524 | Bacteria | 10492 |
| 475 | Ga0495648_0012291 | 3300046524 | Bacteria | 6394 |
| 476 | Ga0495648_0030708 | 3300046524 | Bacteria | 3549 |
| 477 | Ga0495648_0076217 | 3300046524 | Bacteria | 1926 |
| 478 | Ga0495663_0144567 | 3300046525 | Bacteria | 809 |
| 479 | Ga0495666_0007013 | 3300046526 | Bacteria | 5659 |
| 480 | Ga0495666_0028597 | 3300046526 | Bacteria | 2743 |
| 481 | Ga0495666_0373932 | 3300046526 | Bacteria | 641 |
| 482 | Ga0495642_0001167 | 3300046528 | Bacteria | 12052 |
| 483 | Ga0495654_0000897 | 3300046530 | Bacteria | 22238 |
| 484 | Ga0495654_0001265 | 3300046530 | Bacteria | 17803 |
| 485 | Ga0495654_0001437 | 3300046530 | Bacteria | 16377 |
| 486 | Ga0495654_0005810 | 3300046530 | Bacteria | 7110 |
| 487 | Ga0495654_0010281 | 3300046530 | Bacteria | 5095 |
| 488 | Ga0495654_0017995 | 3300046530 | Bacteria | 3707 |
| 489 | Ga0495654_0018015 | 3300046530 | Bacteria | 3704 |
| 490 | Ga0495654_0018398 | 3300046530 | Bacteria | 3662 |
| 491 | Ga0495654_0023888 | 3300046530 | Bacteria | 3163 |
| 492 | Ga0495587_0000190 | 3300046536 | Bacteria | 45240 |
| 493 | Ga0495587_0068285 | 3300046536 | Bacteria | 2070 |
| 494 | Ga0495598_0180265 | 3300046537 | Bacteria | 753 |
| 495 | Ga0495609_0000008 | 3300046538 | Bacteria | 383025 |
| 496 | Ga0495609_0000014 | 3300046538 | Bacteria | 326023 |
| 497 | Ga0495609_0000188 | 3300046538 | Bacteria | 61830 |
| 498 | Ga0495609_0000534 | 3300046538 | Bacteria | 30280 |
| 499 | Ga0495609_0009645 | 3300046538 | Bacteria | 4662 |
| 500 | Ga0495609_0219709 | 3300046538 | Bacteria | 789 |
| 501 | Ga0495597_0000061 | 3300046542 | Bacteria | 92012 |
| 502 | Ga0495597_0000269 | 3300046542 | Bacteria | 47594 |
| 503 | Ga0495597_0030227 | 3300046542 | Bacteria | 2469 |
| 504 | Ga0495597_0099287 | 3300046542 | Bacteria | 1229 |
| 505 | Ga0495597_0268678 | 3300046542 | Bacteria | 666 |
| 506 | Ga0495622_0000003 | 3300046557 | Bacteria | 268681 |
| 507 | Ga0495622_0000367 | 3300046557 | Bacteria | 31492 |
| 508 | Ga0495622_0012670 | 3300046557 | Bacteria | 3908 |
| 509 | Ga0495622_0089635 | 3300046557 | Bacteria | 1413 |
| 510 | Ga0495622_0116695 | 3300046557 | Bacteria | 1220 |
| 511 | Ga0495633_0000009 | 3300046558 | Bacteria | 293183 |
| 512 | Ga0495633_0000278 | 3300046558 | Bacteria | 59112 |
| 513 | Ga0495633_0031492 | 3300046558 | Bacteria | 2570 |
| 514 | Ga0495656_0025230 | 3300046615 | Bacteria | 2355 |
| 515 | Ga0495668_0004899 | 3300046616 | Bacteria | 9292 |
| 516 | Ga0495668_0014521 | 3300046616 | Bacteria | 4614 |
| 517 | Ga0495668_0021456 | 3300046616 | Bacteria | 3703 |
| 518 | Ga0495668_0187839 | 3300046616 | Bacteria | 1131 |
| 519 | Ga0495668_0231348 | 3300046616 | Bacteria | 1012 |
| 520 | Ga0495634_0001714 | 3300046642 | Bacteria | 19026 |
| 521 | Ga0495611_0000862 | 3300046648 | Bacteria | 16628 |
| 522 | Ga0495611_0002339 | 3300046648 | Bacteria | 8740 |
| 523 | Ga0495611_0008181 | 3300046648 | Bacteria | 4436 |
| 524 | Ga0495611_0009279 | 3300046648 | Bacteria | 4153 |
| 525 | Ga0495611_0020467 | 3300046648 | Bacteria | 2848 |
| 526 | Ga0495611_0046899 | 3300046648 | Bacteria | 1938 |
| 527 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 528 | Ga0495625_0001992 | 3300046660 | Bacteria | 23058 |
| 529 | Ga0495625_0014183 | 3300046660 | Bacteria | 6372 |
| 530 | Ga0495625_0035565 | 3300046660 | Bacteria | 3670 |
| 531 | Ga0495625_0189495 | 3300046660 | Bacteria | 1363 |
| 532 | Ga0495625_0436228 | 3300046660 | Bacteria | 812 |
| 533 | Ga0495625_0753640 | 3300046660 | Bacteria | 570 |
| 534 | Ga0495635_0000350 | 3300046663 | Bacteria | 29321 |
| 535 | Ga0495659_0319614 | 3300046664 | Bacteria | 659 |
| 536 | Ga0495661_0000029 | 3300046665 | Bacteria | 173899 |
| 537 | Ga0495661_0001443 | 3300046665 | Bacteria | 19884 |
| 538 | Ga0495661_0003921 | 3300046665 | Bacteria | 10865 |
| 539 | Ga0495661_0007584 | 3300046665 | Bacteria | 7562 |
| 540 | Ga0495661_0015812 | 3300046665 | Bacteria | 5025 |
| 541 | Ga0495661_0043197 | 3300046665 | Bacteria | 2772 |
| 542 | Ga0495661_0054378 | 3300046665 | Bacteria | 2403 |
| 543 | Ga0495661_0072228 | 3300046665 | Bacteria | 2013 |
| 544 | Ga0495588_0075663 | 3300046674 | Bacteria | 1754 |
| 545 | Ga0495588_0220681 | 3300046674 | Bacteria | 1001 |
| 546 | Ga0495646_0000790 | 3300046680 | Bacteria | 17703 |
| 547 | Ga0495669_0000708 | 3300046684 | Bacteria | 14522 |
| 548 | Ga0495669_0543667 | 3300046684 | Bacteria | 565 |
| 549 | Ga0495669_0606626 | 3300046684 | Bacteria | 532 |
| 550 | Ga0495624_0038386 | 3300046690 | Bacteria | 3077 |
| 551 | Ga0495670_0015653 | 3300046691 | Bacteria | 3727 |
| 552 | Ga0495670_0017504 | 3300046691 | Bacteria | 3526 |
| 553 | Ga0495670_0025997 | 3300046691 | Bacteria | 2898 |
| 554 | Ga0495670_0071423 | 3300046691 | Bacteria | 1757 |
| 555 | Ga0495670_0116656 | 3300046691 | Bacteria | 1385 |
| 556 | Ga0495670_0195726 | 3300046691 | Bacteria | 1069 |
| 557 | Ga0495671_0000397 | 3300046692 | Bacteria | 35515 |
| 558 | Ga0495671_0001790 | 3300046692 | Bacteria | 13904 |
| 559 | Ga0495671_0003980 | 3300046692 | Bacteria | 8936 |
| 560 | Ga0495671_0011517 | 3300046692 | Bacteria | 4859 |
| 561 | Ga0495671_0013827 | 3300046692 | Bacteria | 4356 |
| 562 | Ga0495671_0030327 | 3300046692 | Bacteria | 2770 |
| 563 | Ga0495671_0053127 | 3300046692 | Bacteria | 2012 |
| 564 | Ga0495671_0181488 | 3300046692 | Bacteria | 1022 |
| 565 | Ga0495649_0000081 | 3300046694 | Bacteria | 82700 |
| 566 | Ga0495649_0006509 | 3300046694 | Bacteria | 7267 |
| 567 | Ga0495649_0041448 | 3300046694 | Bacteria | 2518 |
| 568 | Ga0495649_0058857 | 3300046694 | Bacteria | 2069 |
| 569 | Ga0495589_0000251 | 3300046794 | Bacteria | 43879 |
| 570 | Ga0495589_0006350 | 3300046794 | Bacteria | 6242 |
| 571 | Ga0495589_0047098 | 3300046794 | Bacteria | 2137 |
| 572 | Ga0495589_0098173 | 3300046794 | Bacteria | 1419 |
| 573 | Ga0495660_0000006 | 3300046810 | Bacteria | 571713 |
| 574 | Ga0495660_0000052 | 3300046810 | Bacteria | 137821 |
| 575 | Ga0495660_0000148 | 3300046810 | Bacteria | 76297 |
| 576 | Ga0495660_0001102 | 3300046810 | Bacteria | 19296 |
| 577 | Ga0495660_0001450 | 3300046810 | Bacteria | 16216 |
| 578 | Ga0495660_0002640 | 3300046810 | Bacteria | 11375 |
| 579 | Ga0495660_0002969 | 3300046810 | Bacteria | 10603 |
| 580 | Ga0495660_0003761 | 3300046810 | Bacteria | 9309 |
| 581 | Ga0495660_0004153 | 3300046810 | Bacteria | 8812 |
| 582 | Ga0495660_0028324 | 3300046810 | Bacteria | 3166 |
| 583 | Ga0495660_0070439 | 3300046810 | Bacteria | 1856 |
| 584 | Ga0495660_0159048 | 3300046810 | Bacteria | 1109 |
| 585 | Ga0495604_0041768 | 3300047317 | Bacteria | 3596 |
| 586 | Ga0495672_0000407 | 3300047320 | Bacteria | 52187 |
| 587 | Ga0495672_0003314 | 3300047320 | Bacteria | 13917 |
| 588 | Ga0495672_0010278 | 3300047320 | Bacteria | 6686 |
| 589 | Ga0495672_0065591 | 3300047320 | Bacteria | 2075 |
| 590 | Ga0495680_0079938 | 3300047322 | Bacteria | 2471 |
| 591 | Ga0495683_0000033 | 3300047323 | Bacteria | 149031 |
| 592 | Ga0495683_0000042 | 3300047323 | Bacteria | 137528 |
| 593 | Ga0495683_0003014 | 3300047323 | Bacteria | 9925 |
| 594 | Ga0495683_0037337 | 3300047323 | Bacteria | 2463 |
| 595 | Ga0495683_0150885 | 3300047323 | Bacteria | 1082 |
| 596 | Ga0495683_0161786 | 3300047323 | Bacteria | 1035 |
| 597 | Ga0495683_0475347 | 3300047323 | Bacteria | 510 |
| 598 | Ga0495675_0008889 | 3300047444 | Bacteria | 6240 |
| 599 | Ga0495677_0071032 | 3300047445 | Bacteria | 1297 |
| 600 | Ga0495677_0329765 | 3300047445 | Bacteria | 601 |
| 601 | Ga0495679_000015 | 3300047446 | Bacteria | 287256 |
| 602 | Ga0495679_000060 | 3300047446 | Bacteria | 109240 |
| 603 | Ga0495679_001075 | 3300047446 | Bacteria | 16546 |
| 604 | Ga0495679_002354 | 3300047446 | Bacteria | 9691 |
| 605 | Ga0495679_004740 | 3300047446 | Bacteria | 6172 |
| 606 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 607 | Ga0495673_0000300 | 3300047469 | Bacteria | 66221 |
| 608 | Ga0495673_0000525 | 3300047469 | Bacteria | 40095 |
| 609 | Ga0495673_0002620 | 3300047469 | Bacteria | 12469 |
| 610 | Ga0495673_0002993 | 3300047469 | Bacteria | 11385 |
| 611 | Ga0495673_0003465 | 3300047469 | Bacteria | 10383 |
| 612 | Ga0495673_0007028 | 3300047469 | Bacteria | 6534 |
| 613 | Ga0495673_0009795 | 3300047469 | Bacteria | 5267 |
| 614 | Ga0495673_0018360 | 3300047469 | Bacteria | 3528 |
| 615 | Ga0495673_0023211 | 3300047469 | Bacteria | 3023 |
| 616 | Ga0495673_0039676 | 3300047469 | Bacteria | 2134 |
| 617 | Ga0495673_0051764 | 3300047469 | Bacteria | 1797 |
| 618 | Ga0495673_0056862 | 3300047469 | Bacteria | 1690 |
| 619 | Ga0495673_0060999 | 3300047469 | Bacteria | 1616 |
| 620 | Ga0495673_0122618 | 3300047469 | Bacteria | 1028 |
| 621 | Ga0495681_0000768 | 3300047470 | Bacteria | 24709 |
| 622 | Ga0495681_0001769 | 3300047470 | Bacteria | 15908 |
| 623 | Ga0495681_0041668 | 3300047470 | Bacteria | 2228 |
| 624 | Ga0495681_0226062 | 3300047470 | Bacteria | 748 |
| 625 | Ga0495681_0253499 | 3300047470 | Bacteria | 694 |
| 626 | Ga0495684_0038169 | 3300047471 | Bacteria | 3683 |
| 627 | Ga0495686_0000708 | 3300047472 | Bacteria | 44947 |
| 628 | Ga0495686_0004371 | 3300047472 | Bacteria | 11662 |
| 629 | Ga0495686_0046828 | 3300047472 | Bacteria | 2732 |
| 630 | Ga0495686_0587285 | 3300047472 | Bacteria | 578 |
| 631 | Ga0495593_0009302 | 3300047673 | Bacteria | 5702 |
| 632 | Ga0495615_0169726 | 3300048090 | Bacteria | 659 |
| 633 | Ga0495626_0000012 | 3300048091 | Bacteria | 258483 |
| 634 | Ga0495626_0001745 | 3300048091 | Bacteria | 16582 |
| 635 | Ga0495626_0174777 | 3300048091 | Bacteria | 893 |
| 636 | Ga0495626_0220184 | 3300048091 | Bacteria | 771 |
| 637 | Ga0496100_0033443 | 3300048903 | Unclassified | 3217 |
| 638 | Ga0496101_0005620 | 3300048904 | Bacteria | 7995 |
| 639 | Ga0496102_0000821 | 3300048905 | Bacteria | 30135 |
| 640 | Ga0496102_0002660 | 3300048905 | Bacteria | 15200 |
| 641 | Ga0496102_0740281 | 3300048905 | Bacteria | 906 |
| 642 | Ga0496102_1513441 | 3300048905 | Bacteria | 590 |
| 643 | Ga0496103_0002064 | 3300048906 | Bacteria | 12847 |
| 644 | Ga0496103_0003108 | 3300048906 | Bacteria | 10204 |
| 645 | Ga0496104_0011249 | 3300048907 | Bacteria | 8008 |
| 646 | Ga0496106_0001032 | 3300048909 | Bacteria | 20508 |
| 647 | Ga0496106_0006041 | 3300048909 | Bacteria | 8964 |
| 648 | Ga0496107_0171409 | 3300048910 | Bacteria | 1610 |
| 649 | Ga0496110_1060037 | 3300048913 | Bacteria | 718 |
| 650 | Ga0496114_0038162 | 3300048917 | Bacteria | 3974 |
| 651 | Ga0496114_0344161 | 3300048917 | Bacteria | 1318 |
| 652 | Ga0496115_0210434 | 3300048918 | Bacteria | 1606 |
| 653 | Ga0496115_0735125 | 3300048918 | Bacteria | 773 |
| 654 | Ga0496116_0000020 | 3300048919 | Bacteria | 501307 |
| 655 | Ga0496116_0011895 | 3300048919 | Bacteria | 7159 |
| 656 | Ga0496116_0150413 | 3300048919 | Bacteria | 1294 |
| 657 | Ga0496117_0000246 | 3300048920 | Bacteria | 102783 |
| 658 | Ga0496117_0001151 | 3300048920 | Bacteria | 39820 |
| 659 | Ga0496117_0008832 | 3300048920 | Bacteria | 9507 |
| 660 | Ga0496117_0265579 | 3300048920 | Bacteria | 927 |
| 661 | Ga0496118_0003083 | 3300048921 | Bacteria | 21369 |
| 662 | Ga0496118_0041846 | 3300048921 | Bacteria | 3621 |
| 663 | Ga0496118_0348059 | 3300048921 | Bacteria | 791 |
| 664 | Ga0496119_0015131 | 3300048922 | Bacteria | 5971 |
| 665 | Ga0496119_0019254 | 3300048922 | Bacteria | 5037 |
| 666 | Ga0496120_0001430 | 3300048923 | Bacteria | 28786 |
| 667 | Ga0496120_0007714 | 3300048923 | Bacteria | 7965 |
| 668 | Ga0496121_0000782 | 3300048924 | Bacteria | 58365 |
| 669 | Ga0496121_0024059 | 3300048924 | Bacteria | 5836 |
| 670 | Ga0496121_0037696 | 3300048924 | Bacteria | 4290 |
| 671 | Ga0496121_0042734 | 3300048924 | Bacteria | 3937 |
| 672 | Ga0496121_0047827 | 3300048924 | Bacteria | 3645 |
| 673 | Ga0496121_0112158 | 3300048924 | Bacteria | 2078 |
| 674 | Ga0496121_0192598 | 3300048924 | Bacteria | 1460 |
| 675 | Ga0496121_0238564 | 3300048924 | Bacteria | 1269 |
| 676 | Ga0496122_0000010 | 3300048925 | Bacteria | 547417 |
| 677 | Ga0496122_0016615 | 3300048925 | Bacteria | 6945 |
| 678 | Ga0496123_0000025 | 3300048926 | Bacteria | 323956 |
| 679 | Ga0496123_0006592 | 3300048926 | Bacteria | 11212 |
| 680 | Ga0496124_0000084 | 3300048927 | Bacteria | 204993 |
| 681 | Ga0496124_0001319 | 3300048927 | Bacteria | 37386 |
| 682 | Ga0496124_0024406 | 3300048927 | Bacteria | 5497 |
| 683 | Ga0496124_0034155 | 3300048927 | Bacteria | 4467 |
| 684 | Ga0496124_0069717 | 3300048927 | Bacteria | 2918 |
| 685 | Ga0496124_0076475 | 3300048927 | Bacteria | 2763 |
| 686 | Ga0496125_0000071 | 3300048928 | Bacteria | 243580 |
| 687 | Ga0496125_0001337 | 3300048928 | Bacteria | 36347 |
| 688 | Ga0496125_0083021 | 3300048928 | Bacteria | 2439 |
| 689 | Ga0496125_0403803 | 3300048928 | Bacteria | 797 |
| 690 | Ga0496125_0468744 | 3300048928 | Bacteria | 717 |
| 691 | Ga0496126_0042934 | 3300048929 | Bacteria | 4174 |
| 692 | Ga0496126_0049632 | 3300048929 | Bacteria | 3829 |
| 693 | Ga0496126_0305398 | 3300048929 | Bacteria | 1311 |
| 694 | Ga0496126_0480541 | 3300048929 | Bacteria | 995 |
| 695 | Ga0495678_000011 | 3300049459 | Bacteria | 335512 |
| 696 | Ga0495678_000052 | 3300049459 | Bacteria | 157731 |
| 697 | Ga0495678_003094 | 3300049459 | Bacteria | 10546 |
| 698 | Ga0495678_003321 | 3300049459 | Bacteria | 10029 |
| 699 | Ga0495678_003781 | 3300049459 | Bacteria | 9134 |
| 700 | Ga0495678_013815 | 3300049459 | Bacteria | 3779 |
| 701 | Ga0495678_182866 | 3300049459 | Bacteria | 656 |
| 702 | Ga0495682_0000073 | 3300049460 | Bacteria | 92060 |
| 703 | Ga0495682_0000542 | 3300049460 | Bacteria | 26108 |
| 704 | Ga0495682_0008714 | 3300049460 | Bacteria | 3992 |
| 705 | Ga0495682_0035451 | 3300049460 | Bacteria | 1838 |
| 706 | nmdc:mga03683_3_c1 | 3300050489 | Bacteria | 285872 |
| 707 | nmdc:mga03n38_250728_c1 | 3300050490 | Bacteria | 935 |
| 708 | nmdc:mga00v17_741837_c1 | 3300050491 | Bacteria | 628 |
| 709 | nmdc:mga0yw44_100328_c1 | 3300050492 | Bacteria | 1843 |
| 710 | nmdc:mga0k408_2_c1 | 3300050493 | Bacteria | 395671 |
| 711 | nmdc:mga0sz30_162_c1 | 3300050516 | Bacteria | 24511 |
| 712 | Ga0500643_003161 | 3300053087 | Bacteria | 8051 |
| 713 | Ga0500647_0086977 | 3300053091 | Bacteria | 1498 |
| 714 | Ga0500572_154950 | 3300053111 | Bacteria | 749 |
| 715 | Ga0500607_008676 | 3300053121 | Bacteria | 6160 |
| 716 | Ga0500618_000087 | 3300053125 | Bacteria | 75294 |
| 717 | Ga0500618_000095 | 3300053125 | Bacteria | 72432 |
| 718 | Ga0500573_0329255 | 3300053140 | Bacteria | 751 |
| 719 | Ga0500586_229215 | 3300053145 | Bacteria | 594 |
| 720 | Ga0500589_091940 | 3300053147 | Bacteria | 1334 |
| 721 | Ga0500616_0411022 | 3300053153 | Bacteria | 539 |
| 722 | Ga0500627_0126076 | 3300053158 | Bacteria | 1156 |
| 723 | Ga0500625_026844 | 3300053729 | Bacteria | 2729 |
| 724 | Ga0500645_025607 | 3300053730 | Bacteria | 1799 |
| 725 | Ga0500596_016113 | 3300053735 | Bacteria | 1123 |
| 726 | Ga0500596_031575 | 3300053735 | Bacteria | 823 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300001989 | JGI24739J22299_10064142 | JGI24739J22299_100641422 | 128 |
| 2 | 3300002075 | JGI24738J21930_10005840 | JGI24738J21930_100058402 | 128 |
| 3 | 3300002077 | JGI24744J21845_10002652 | JGI24744J21845_100026522 | 128 |
| 4 | 3300005330 | Ga0070690_100038790 | Ga0070690_1000387902 | 128 |
| 5 | 3300005334 | Ga0068869_100010287 | Ga0068869_1000102874 | 128 |
| 6 | 3300005335 | Ga0070666_10197535 | Ga0070666_101975352 | 128 |
| 7 | 3300005336 | Ga0070680_100240017 | Ga0070680_1002400172 | 128 |
| 8 | 3300005337 | Ga0070682_100044718 | Ga0070682_1000447183 | 128 |
| 9 | 3300005338 | Ga0068868_100004689 | Ga0068868_1000046892 | 128 |
| 10 | 3300005339 | Ga0070660_100029000 | Ga0070660_1000290005 | 128 |
| 11 | 3300005340 | Ga0070689_100019874 | Ga0070689_1000198747 | 128 |
| 12 | 3300005341 | Ga0070691_10006182 | Ga0070691_100061822 | 128 |
| 13 | 3300005343 | Ga0070687_100011551 | Ga0070687_1000115512 | 128 |
| 14 | 3300005345 | Ga0070692_10358177 | Ga0070692_103581772 | 128 |
| 15 | 3300005347 | Ga0070668_100120512 | Ga0070668_1001205123 | 128 |
| 16 | 3300005353 | Ga0070669_100021971 | Ga0070669_1000219716 | 128 |
| 17 | 3300005354 | Ga0070675_101755630 | Ga0070675_1017556301 | 128 |
| 18 | 3300005355 | Ga0070671_100085463 | Ga0070671_1000854632 | 128 |
| 19 | 3300005364 | Ga0070673_100242496 | Ga0070673_1002424963 | 128 |
| 20 | 3300005365 | Ga0070688_100063907 | Ga0070688_1000639073 | 128 |
| 21 | 3300005366 | Ga0070659_100030764 | Ga0070659_1000307643 | 128 |
| 22 | 3300005367 | Ga0070667_100000794 | Ga0070667_10000079419 | 128 |
| 23 | 3300005434 | Ga0070709_10005916 | Ga0070709_100059166 | 128 |
| 24 | 3300005435 | Ga0070714_100403384 | Ga0070714_1004033841 | 128 |
| 25 | 3300005437 | Ga0070710_10100630 | Ga0070710_101006303 | 128 |
| 26 | 3300005438 | Ga0070701_10004576 | Ga0070701_100045766 | 128 |
| 27 | 3300005439 | Ga0070711_100192768 | Ga0070711_1001927683 | 128 |
| 28 | 3300005440 | Ga0070705_100037004 | Ga0070705_1000370043 | 128 |
| 29 | 3300005441 | Ga0070700_100002695 | Ga0070700_1000026954 | 128 |
| 30 | 3300005444 | Ga0070694_100003295 | Ga0070694_1000032952 | 128 |
| 31 | 3300005455 | Ga0070663_100176515 | Ga0070663_1001765153 | 128 |
| 32 | 3300005456 | Ga0070678_100008828 | Ga0070678_1000088282 | 128 |
| 33 | 3300005457 | Ga0070662_100239877 | Ga0070662_1002398772 | 128 |
| 34 | 3300005459 | Ga0068867_100047479 | Ga0068867_1000474794 | 128 |
| 35 | 3300005466 | Ga0070685_10156918 | Ga0070685_101569183 | 128 |
| 36 | 3300005467 | Ga0070706_101306245 | Ga0070706_1013062451 | 128 |
| 37 | 3300005530 | Ga0070679_100386165 | Ga0070679_1003861652 | 128 |
| 38 | 3300005536 | Ga0070697_100060684 | Ga0070697_1000606842 | 128 |
| 39 | 3300005539 | Ga0068853_100080626 | Ga0068853_1000806264 | 128 |
| 40 | 3300005544 | Ga0070686_100038219 | Ga0070686_1000382194 | 128 |
| 41 | 3300005545 | Ga0070695_100001855 | Ga0070695_10000185511 | 128 |
| 42 | 3300005546 | Ga0070696_100075923 | Ga0070696_1000759232 | 128 |
| 43 | 3300005547 | Ga0070693_100042155 | Ga0070693_1000421552 | 128 |
| 44 | 3300005548 | Ga0070665_100037045 | Ga0070665_1000370457 | 128 |
| 45 | 3300005549 | Ga0070704_100023719 | Ga0070704_1000237193 | 128 |
| 46 | 3300005563 | Ga0068855_100333596 | Ga0068855_1003335962 | 128 |
| 47 | 3300005614 | Ga0068856_100198181 | Ga0068856_1001981813 | 128 |
| 48 | 3300005615 | Ga0070702_100002761 | Ga0070702_1000027614 | 128 |
| 49 | 3300005616 | Ga0068852_100111989 | Ga0068852_1001119895 | 128 |
| 50 | 3300005834 | Ga0068851_10459988 | Ga0068851_104599881 | 128 |
| 51 | 3300005842 | Ga0068858_100063666 | Ga0068858_1000636663 | 128 |
| 52 | 3300005843 | Ga0068860_100049201 | Ga0068860_1000492013 | 128 |
| 53 | 3300005844 | Ga0068862_100003107 | Ga0068862_1000031072 | 128 |
| 54 | 3300006163 | Ga0070715_10044920 | Ga0070715_100449203 | 128 |
| 55 | 3300006173 | Ga0070716_100018247 | Ga0070716_1000182472 | 128 |
| 56 | 3300006175 | Ga0070712_100068290 | Ga0070712_1000682903 | 128 |
| 57 | 3300006237 | Ga0097621_100258302 | Ga0097621_1002583023 | 128 |
| 58 | 3300006881 | Ga0068865_100048976 | Ga0068865_1000489763 | 128 |
| 59 | 3300009092 | Ga0105250_10008431 | Ga0105250_100084312 | 128 |
| 60 | 3300009093 | Ga0105240_11466340 | Ga0105240_114663401 | 128 |
| 61 | 3300009098 | Ga0105245_10002500 | Ga0105245_1000250015 | 128 |
| 62 | 3300009101 | Ga0105247_10016195 | Ga0105247_100161955 | 128 |
| 63 | 3300009148 | Ga0105243_10130617 | Ga0105243_101306173 | 128 |
| 64 | 3300009174 | Ga0105241_10175486 | Ga0105241_101754862 | 128 |
| 65 | 3300009176 | Ga0105242_10009509 | Ga0105242_100095092 | 128 |
| 66 | 3300009177 | Ga0105248_10146596 | Ga0105248_101465964 | 128 |
| 67 | 3300009545 | Ga0105237_10022373 | Ga0105237_100223732 | 128 |
| 68 | 3300009551 | Ga0105238_10631853 | Ga0105238_106318532 | 128 |
| 69 | 3300009553 | Ga0105249_10014068 | Ga0105249_100140682 | 128 |
| 70 | 3300010375 | Ga0105239_10059356 | Ga0105239_100593563 | 128 |
| 71 | 3300011119 | Ga0105246_10267507 | Ga0105246_102675073 | 128 |
| 72 | 3300013100 | Ga0157373_10639381 | Ga0157373_106393812 | 128 |
| 73 | 3300013105 | Ga0157369_10217830 | Ga0157369_102178301 | 128 |
| 74 | 3300013296 | Ga0157374_10253610 | Ga0157374_102536102 | 128 |
| 75 | 3300013297 | Ga0157378_10159532 | Ga0157378_101595323 | 128 |
| 76 | 3300013306 | Ga0163162_10378602 | Ga0163162_103786022 | 128 |
| 77 | 3300013307 | Ga0157372_10003068 | Ga0157372_1000306818 | 128 |
| 78 | 3300013308 | Ga0157375_10001585 | Ga0157375_1000158519 | 128 |
| 79 | 3300014326 | Ga0157380_10007831 | Ga0157380_100078313 | 128 |
| 80 | 3300014745 | Ga0157377_10025444 | Ga0157377_100254444 | 128 |
| 81 | 3300014968 | Ga0157379_10001763 | Ga0157379_1000176317 | 128 |
| 82 | 3300014969 | Ga0157376_10043329 | Ga0157376_100433293 | 128 |
| 83 | 3300017792 | Ga0163161_10001211 | Ga0163161_1000121119 | 128 |
| 84 | 3300025711 | Ga0207696_1044933 | Ga0207696_10449332 | 128 |
| 85 | 3300025885 | Ga0207653_10025305 | Ga0207653_100253052 | 128 |
| 86 | 3300025898 | Ga0207692_10015153 | Ga0207692_100151531 | 128 |
| 87 | 3300025900 | Ga0207710_10089879 | Ga0207710_100898793 | 128 |
| 88 | 3300025901 | Ga0207688_10002669 | Ga0207688_100026692 | 128 |
| 89 | 3300025903 | Ga0207680_10249618 | Ga0207680_102496182 | 128 |
| 90 | 3300025904 | Ga0207647_10010922 | Ga0207647_100109223 | 128 |
| 91 | 3300025906 | Ga0207699_10067409 | Ga0207699_100674092 | 128 |
| 92 | 3300025907 | Ga0207645_10416088 | Ga0207645_104160882 | 128 |
| 93 | 3300025911 | Ga0207654_10093561 | Ga0207654_100935612 | 128 |
| 94 | 3300025913 | Ga0207695_11427946 | Ga0207695_114279461 | 128 |
| 95 | 3300025915 | Ga0207693_10006185 | Ga0207693_100061853 | 128 |
| 96 | 3300025916 | Ga0207663_10157710 | Ga0207663_101577102 | 128 |
| 97 | 3300025919 | Ga0207657_10213700 | Ga0207657_102137003 | 128 |
| 98 | 3300025926 | Ga0207659_11339754 | Ga0207659_113397541 | 128 |
| 99 | 3300025927 | Ga0207687_10011422 | Ga0207687_100114228 | 128 |
| 100 | 3300025931 | Ga0207644_10026605 | Ga0207644_100266055 | 128 |
| 101 | 3300025932 | Ga0207690_10200239 | Ga0207690_102002392 | 128 |
| 102 | 3300025933 | Ga0207706_10003200 | Ga0207706_100032007 | 128 |
| 103 | 3300025934 | Ga0207686_10027452 | Ga0207686_100274521 | 128 |
| 104 | 3300025937 | Ga0207669_10253153 | Ga0207669_102531532 | 128 |
| 105 | 3300025938 | Ga0207704_10001403 | Ga0207704_1000140310 | 128 |
| 106 | 3300025942 | Ga0207689_10016615 | Ga0207689_100166156 | 128 |
| 107 | 3300025949 | Ga0207667_10833486 | Ga0207667_108334861 | 128 |
| 108 | 3300025961 | Ga0207712_10054178 | Ga0207712_100541783 | 128 |
| 109 | 3300025986 | Ga0207658_10274952 | Ga0207658_102749522 | 128 |
| 110 | 3300026023 | Ga0207677_10174098 | Ga0207677_101740983 | 128 |
| 111 | 3300026035 | Ga0207703_10095813 | Ga0207703_100958131 | 128 |
| 112 | 3300026041 | Ga0207639_10173499 | Ga0207639_101734993 | 128 |
| 113 | 3300026067 | Ga0207678_10013359 | Ga0207678_100133597 | 128 |
| 114 | 3300026075 | Ga0207708_10000709 | Ga0207708_1000070916 | 128 |
| 115 | 3300026089 | Ga0207648_10003479 | Ga0207648_100034796 | 128 |
| 116 | 3300026118 | Ga0207675_100002920 | Ga0207675_10000292016 | 128 |
| 117 | 3300026121 | Ga0207683_10016343 | Ga0207683_100163433 | 128 |
| 118 | 3300028379 | Ga0268266_10490930 | Ga0268266_104909302 | 128 |
| 119 | 3300028380 | Ga0268265_10270481 | Ga0268265_102704812 | 128 |
| 120 | 3300028381 | Ga0268264_10098966 | Ga0268264_100989663 | 128 |
| 121 | 3300034817 | Ga0373948_0044341 | Ga0373948_0044341_491_877 | 128 |
| 122 | 3300034818 | Ga0373950_0133409 | Ga0373950_0133409_97_483 | 128 |
| 123 | 3300035084 | Ga0373928_0018535 | Ga0373928_0018535_95_481 | 128 |
| 124 | 3300035085 | Ga0373929_0054064 | Ga0373929_0054064_370_756 | 128 |
| 125 | 3300035091 | Ga0373951_0113344 | Ga0373951_0113344_130_516 | 128 |
| 126 | 3300035112 | Ga0373932_0036069 | Ga0373932_0036069_915_1301 | 128 |
| 127 | 3300035114 | Ga0373939_0026098 | Ga0373939_0026098_304_690 | 128 |
| 128 | 3300035115 | Ga0373941_0002351 | Ga0373941_0002351_531_917 | 128 |
| 129 | 3300035121 | Ga0373960_0038531 | Ga0373960_0038531_549_935 | 128 |
| 130 | 3300035207 | Ga0373942_0039573 | Ga0373942_0039573_621_1007 | 128 |
| 131 | 3300035241 | Ga0373961_0010227 | Ga0373961_0010227_1540_1926 | 128 |
| 132 | 3300035242 | Ga0373962_0002951 | Ga0373962_0002951_493_879 | 128 |
| 133 | 3300035691 | Ga0373931_0003666 | Ga0373931_0003666_3928_4314 | 128 |
| 134 | 3300048903 | Ga0496100_0033443 | Ga0496100_0033443_202_588 | 128 |
| 135 | 3300048904 | Ga0496101_0005620 | Ga0496101_0005620_7228_7614 | 128 |
| 136 | 3300048905 | Ga0496102_0002660 | Ga0496102_0002660_1523_1909 | 128 |
| 137 | 3300048906 | Ga0496103_0003108 | Ga0496103_0003108_622_1008 | 128 |
| 138 | 3300048909 | Ga0496106_0006041 | Ga0496106_0006041_5102_5488 | 128 |
| 139 | 3300048910 | Ga0496107_0171409 | Ga0496107_0171409_214_600 | 128 |
| 140 | 3300048917 | Ga0496114_0344161 | Ga0496114_0344161_860_1246 | 128 |
| 141 | 3300048918 | Ga0496115_0210434 | Ga0496115_0210434_707_1093 | 128 |
| 142 | iso_pu_bacteria | 2738543012 | 2739246529 | 130 |
| 143 | 3300006178 | Ga0075367_10119800 | Ga0075367_101198002 | 131 |
| 144 | 3300006353 | Ga0075370_10063904 | Ga0075370_100639042 | 131 |
| 145 | 3300013102 | Ga0157371_10168600 | Ga0157371_101686002 | 131 |
| 146 | 3300013297 | Ga0157378_11524596 | Ga0157378_115245962 | 131 |
| 147 | 3300001978 | JGI24747J21853_1009353 | JGI24747J21853_10093532 | 132 |
| 148 | 3300002074 | JGI24748J21848_1012606 | JGI24748J21848_10126062 | 132 |
| 149 | 3300003320 | rootH2_10016961 | rootH2_100169612 | 132 |
| 150 | 3300005328 | Ga0070676_10523544 | Ga0070676_105235442 | 132 |
| 151 | 3300005406 | Ga0070703_10033674 | Ga0070703_100336743 | 132 |
| 152 | 3300005548 | Ga0070665_100087338 | Ga0070665_1000873384 | 132 |
| 153 | 3300005578 | Ga0068854_100184291 | Ga0068854_1001842911 | 132 |
| 154 | 3300005617 | Ga0068859_100002434 | Ga0068859_1000024343 | 132 |
| 155 | 3300005718 | Ga0068866_10001034 | Ga0068866_100010343 | 132 |
| 156 | 3300005719 | Ga0068861_100174020 | Ga0068861_1001740203 | 132 |
| 157 | 3300006931 | Ga0097620_100002434 | Ga0097620_1000024343 | 132 |
| 158 | 3300007788 | Ga0099795_10007162 | Ga0099795_100071624 | 132 |
| 159 | 3300014497 | Ga0182008_10020924 | Ga0182008_100209243 | 132 |
| 160 | 3300014497 | Ga0182008_10384308 | Ga0182008_103843081 | 132 |
| 161 | 3300025905 | Ga0207685_10215763 | Ga0207685_102157632 | 132 |
| 162 | 3300025918 | Ga0207662_10147914 | Ga0207662_101479144 | 132 |
| 163 | 3300025923 | Ga0207681_10242241 | Ga0207681_102422413 | 132 |
| 164 | 3300025924 | Ga0207694_10504583 | Ga0207694_105045832 | 132 |
| 165 | 3300025929 | Ga0207664_10306464 | Ga0207664_103064641 | 132 |
| 166 | 3300025935 | Ga0207709_10224168 | Ga0207709_102241683 | 132 |
| 167 | 3300025939 | Ga0207665_10001697 | Ga0207665_100016973 | 132 |
| 168 | 3300025941 | Ga0207711_10035562 | Ga0207711_100355625 | 132 |
| 169 | 3300025981 | Ga0207640_10039103 | Ga0207640_100391033 | 132 |
| 170 | 3300026078 | Ga0207702_10836971 | Ga0207702_108369711 | 132 |
| 171 | 3300031250 | Ga0265331_10118347 | Ga0265331_101183471 | 132 |
| 172 | 3300031344 | Ga0265316_10451345 | Ga0265316_104513451 | 132 |
| 173 | 3300031595 | Ga0265313_10107084 | Ga0265313_101070841 | 132 |
| 174 | 3300031712 | Ga0265342_10038998 | Ga0265342_100389983 | 132 |
| 175 | 3300032002 | Ga0307416_100024736 | Ga0307416_1000247366 | 132 |
| 176 | 3300032004 | Ga0307414_10140135 | Ga0307414_101401352 | 132 |
| 177 | 3300035111 | Ga0373923_0426870 | Ga0373923_0426870_222_620 | 132 |
| 178 | 3300035116 | Ga0373945_0105604 | Ga0373945_0105604_148_546 | 132 |
| 179 | 3300035170 | Ga0373943_0176050 | Ga0373943_0176050_348_746 | 132 |
| 180 | 3300035171 | Ga0373946_0092203 | Ga0373946_0092203_856_1254 | 132 |
| 181 | 3300035692 | Ga0373935_0097113 | Ga0373935_0097113_1497_1895 | 132 |
| 182 | 3300035695 | Ga0373927_0142429 | Ga0373927_0142429_154_552 | 132 |
| 183 | 3300035725 | Ga0373947_0116463 | Ga0373947_0116463_148_546 | 132 |
| 184 | 3300041451 | Ga0451791_1855958 | Ga0451791_1855958_239_643 | 132 |
| 185 | 3300042139 | Ga0450904_000480 | Ga0450904_000480_5189_5587 | 132 |
| 186 | 3300046474 | Ga0495605_0000006 | Ga0495605_0000006_30357_30755 | 132 |
| 187 | 3300046474 | Ga0495605_0006241 | Ga0495605_0006241_2079_2483 | 132 |
| 188 | 3300046492 | Ga0495585_0001935 | Ga0495585_0001935_13694_14098 | 132 |
| 189 | 3300046500 | Ga0495596_0017635 | Ga0495596_0017635_1318_1722 | 132 |
| 190 | 3300046501 | Ga0495607_0095300 | Ga0495607_0095300_323_721 | 132 |
| 191 | 3300046501 | Ga0495607_0288418 | Ga0495607_0288418_62_460 | 132 |
| 192 | 3300046506 | Ga0495583_0006122 | Ga0495583_0006122_2094_2492 | 132 |
| 193 | 3300046512 | Ga0495610_0204110 | Ga0495610_0204110_73_477 | 132 |
| 194 | 3300046513 | Ga0495616_0106851 | Ga0495616_0106851_440_844 | 132 |
| 195 | 3300046518 | Ga0495631_0026452 | Ga0495631_0026452_524_928 | 132 |
| 196 | 3300046519 | Ga0495632_0000755 | Ga0495632_0000755_6330_6734 | 132 |
| 197 | 3300046520 | Ga0495637_0059306 | Ga0495637_0059306_569_973 | 132 |
| 198 | 3300046522 | Ga0495643_0018458 | Ga0495643_0018458_1763_2161 | 132 |
| 199 | 3300046524 | Ga0495648_0030708 | Ga0495648_0030708_1654_2058 | 132 |
| 200 | 3300046528 | Ga0495642_0001167 | Ga0495642_0001167_5395_5799 | 132 |
| 201 | 3300046536 | Ga0495587_0068285 | Ga0495587_0068285_1234_1638 | 132 |
| 202 | 3300046616 | Ga0495668_0231348 | Ga0495668_0231348_80_484 | 132 |
| 203 | 3300046665 | Ga0495661_0001443 | Ga0495661_0001443_16399_16803 | 132 |
| 204 | 3300046674 | Ga0495588_0075663 | Ga0495588_0075663_762_1166 | 132 |
| 205 | 3300046684 | Ga0495669_0000708 | Ga0495669_0000708_3873_4277 | 132 |
| 206 | 3300046691 | Ga0495670_0071423 | Ga0495670_0071423_414_818 | 132 |
| 207 | 3300046794 | Ga0495589_0047098 | Ga0495589_0047098_1329_1733 | 132 |
| 208 | 3300047323 | Ga0495683_0037337 | Ga0495683_0037337_235_639 | 132 |
| 209 | 3300047445 | Ga0495677_0329765 | Ga0495677_0329765_125_529 | 132 |
| 210 | 3300053091 | Ga0500647_0086977 | Ga0500647_0086977_495_893 | 132 |
| 211 | 3300053121 | Ga0500607_008676 | Ga0500607_008676_3959_4357 | 132 |
| 212 | 3300053729 | Ga0500625_026844 | Ga0500625_026844_1134_1532 | 132 |
| 213 | 3300053735 | Ga0500596_016113 | Ga0500596_016113_684_1082 | 132 |
| 214 | 3300005289 | Ga0065704_10131855 | Ga0065704_101318552 | 133 |
| 215 | 3300005289 | Ga0065704_10165426 | Ga0065704_101654262 | 133 |
| 216 | 3300005344 | Ga0070661_100022741 | Ga0070661_1000227412 | 133 |
| 217 | 3300005468 | Ga0070707_100004763 | Ga0070707_1000047635 | 133 |
| 218 | 3300005471 | Ga0070698_100286381 | Ga0070698_1002863813 | 133 |
| 219 | 3300005471 | Ga0070698_100685396 | Ga0070698_1006853962 | 133 |
| 220 | 3300005536 | Ga0070697_100069270 | Ga0070697_1000692702 | 133 |
| 221 | 3300006051 | Ga0075364_10004291 | Ga0075364_100042915 | 133 |
| 222 | 3300006051 | Ga0075364_10445885 | Ga0075364_104458851 | 133 |
| 223 | 3300006177 | Ga0075362_10000015 | Ga0075362_1000001543 | 133 |
| 224 | 3300006186 | Ga0075369_10000089 | Ga0075369_1000008915 | 133 |
| 225 | 3300006195 | Ga0075366_10000072 | Ga0075366_1000007220 | 133 |
| 226 | 3300006914 | Ga0075436_100377182 | Ga0075436_1003771822 | 133 |
| 227 | 3300007265 | Ga0099794_10697660 | Ga0099794_106976601 | 133 |
| 228 | 3300007788 | Ga0099795_10097734 | Ga0099795_100977343 | 133 |
| 229 | 3300009036 | Ga0105244_10039053 | Ga0105244_100390532 | 133 |
| 230 | 3300009101 | Ga0105247_10094556 | Ga0105247_100945562 | 133 |
| 231 | 3300009148 | Ga0105243_10186394 | Ga0105243_101863943 | 133 |
| 232 | 3300010159 | Ga0099796_10380729 | Ga0099796_103807292 | 133 |
| 233 | 3300011119 | Ga0105246_10000102 | Ga0105246_1000010220 | 133 |
| 234 | 3300013102 | Ga0157371_10013871 | Ga0157371_100138715 | 133 |
| 235 | 3300013104 | Ga0157370_10118720 | Ga0157370_101187202 | 133 |
| 236 | 3300013105 | Ga0157369_10002042 | Ga0157369_1000204224 | 133 |
| 237 | 3300013296 | Ga0157374_11315059 | Ga0157374_113150592 | 133 |
| 238 | 3300013306 | Ga0163162_10288082 | Ga0163162_102880822 | 133 |
| 239 | 3300013307 | Ga0157372_10073167 | Ga0157372_100731674 | 133 |
| 240 | 3300013308 | Ga0157375_10000819 | Ga0157375_1000081925 | 133 |
| 241 | 3300013308 | Ga0157375_10949221 | Ga0157375_109492212 | 133 |
| 242 | 3300014497 | Ga0182008_10024200 | Ga0182008_100242003 | 133 |
| 243 | 3300014497 | Ga0182008_10026807 | Ga0182008_100268073 | 133 |
| 244 | 3300014497 | Ga0182008_10583282 | Ga0182008_105832821 | 133 |
| 245 | 3300015261 | Ga0182006_1000066 | Ga0182006_100006656 | 133 |
| 246 | 3300015261 | Ga0182006_1005946 | Ga0182006_10059465 | 133 |
| 247 | 3300015262 | Ga0182007_10034208 | Ga0182007_100342082 | 133 |
| 248 | 3300015265 | Ga0182005_1001642 | Ga0182005_100164210 | 133 |
| 249 | 3300015265 | Ga0182005_1002721 | Ga0182005_10027217 | 133 |
| 250 | 3300015265 | Ga0182005_1108373 | Ga0182005_11083732 | 133 |
| 251 | 3300015265 | Ga0182005_1108553 | Ga0182005_11085532 | 133 |
| 252 | 3300017792 | Ga0163161_10056133 | Ga0163161_100561332 | 133 |
| 253 | 3300025291 | Ga0209675_1014477 | Ga0209675_10144772 | 133 |
| 254 | 3300025294 | Ga0209025_1057859 | Ga0209025_10578592 | 133 |
| 255 | 3300025728 | Ga0207655_1037207 | Ga0207655_10372072 | 133 |
| 256 | 3300025900 | Ga0207710_10077637 | Ga0207710_100776372 | 133 |
| 257 | 3300025910 | Ga0207684_10563400 | Ga0207684_105634001 | 133 |
| 258 | 3300025919 | Ga0207657_10729149 | Ga0207657_107291491 | 133 |
| 259 | 3300025920 | Ga0207649_10027626 | Ga0207649_100276263 | 133 |
| 260 | 3300025922 | Ga0207646_10052718 | Ga0207646_100527185 | 133 |
| 261 | 3300025925 | Ga0207650_10000241 | Ga0207650_1000024124 | 133 |
| 262 | 3300026067 | Ga0207678_10205900 | Ga0207678_102059002 | 133 |
| 263 | 3300031239 | Ga0265328_10006401 | Ga0265328_100064014 | 133 |
| 264 | 3300031616 | Ga0307508_10209678 | Ga0307508_102096782 | 133 |
| 265 | 3300031731 | Ga0307405_10000197 | Ga0307405_1000019720 | 133 |
| 266 | 3300031824 | Ga0307413_11626549 | Ga0307413_116265492 | 133 |
| 267 | 3300031911 | Ga0307412_10057221 | Ga0307412_100572212 | 133 |
| 268 | 3300031911 | Ga0307412_10209117 | Ga0307412_102091173 | 133 |
| 269 | 3300031995 | Ga0307409_100099415 | Ga0307409_1000994152 | 133 |
| 270 | 3300032004 | Ga0307414_10116885 | Ga0307414_101168852 | 133 |
| 271 | 3300041405 | Ga0439438_000008 | Ga0439438_000008_170536_170937 | 133 |
| 272 | 3300041405 | Ga0439438_000186 | Ga0439438_000186_19899_20300 | 133 |
| 273 | 3300041405 | Ga0439438_000263 | Ga0439438_000263_21056_21457 | 133 |
| 274 | 3300041405 | Ga0439438_004688 | Ga0439438_004688_1726_2127 | 133 |
| 275 | 3300041407 | Ga0439447_000059 | Ga0439447_000059_22218_22619 | 133 |
| 276 | 3300041407 | Ga0439447_000518 | Ga0439447_000518_11705_12106 | 133 |
| 277 | 3300041407 | Ga0439447_001639 | Ga0439447_001639_5605_6006 | 133 |
| 278 | 3300041407 | Ga0439447_002371 | Ga0439447_002371_2021_2422 | 133 |
| 279 | 3300041407 | Ga0439447_004319 | Ga0439447_004319_2299_2700 | 133 |
| 280 | 3300041407 | Ga0439447_008309 | Ga0439447_008309_2569_2970 | 133 |
| 281 | 3300041407 | Ga0439447_014819 | Ga0439447_014819_512_913 | 133 |
| 282 | 3300041411 | Ga0439466_0000208 | Ga0439466_0000208_17605_18006 | 133 |
| 283 | 3300041411 | Ga0439466_0000324 | Ga0439466_0000324_16145_16546 | 133 |
| 284 | 3300041411 | Ga0439466_0001870 | Ga0439466_0001870_1143_1544 | 133 |
| 285 | 3300041411 | Ga0439466_0002995 | Ga0439466_0002995_2935_3336 | 133 |
| 286 | 3300041411 | Ga0439466_0010687 | Ga0439466_0010687_2047_2448 | 133 |
| 287 | 3300041411 | Ga0439466_0052458 | Ga0439466_0052458_383_784 | 133 |
| 288 | 3300041411 | Ga0439466_0108390 | Ga0439466_0108390_240_641 | 133 |
| 289 | 3300041411 | Ga0439466_0180631 | Ga0439466_0180631_192_593 | 133 |
| 290 | 3300041413 | Ga0439465_0210734 | Ga0439465_0210734_78_479 | 133 |
| 291 | 3300041456 | Ga0451795_0134650 | Ga0451795_0134650_28_429 | 133 |
| 292 | 3300041491 | Ga0451833_1493046 | Ga0451833_1493046_60_461 | 133 |
| 293 | 3300041997 | Ga0439431_0000006 | Ga0439431_0000006_15102_15503 | 133 |
| 294 | 3300042004 | Ga0439445_0010886 | Ga0439445_0010886_757_1158 | 133 |
| 295 | 3300042006 | Ga0439432_000189 | Ga0439432_000189_13238_13639 | 133 |
| 296 | 3300042006 | Ga0439432_002172 | Ga0439432_002172_3049_3450 | 133 |
| 297 | 3300042006 | Ga0439432_004118 | Ga0439432_004118_2052_2453 | 133 |
| 298 | 3300042006 | Ga0439432_038751 | Ga0439432_038751_538_939 | 133 |
| 299 | 3300042009 | Ga0439451_001083 | Ga0439451_001083_3173_3574 | 133 |
| 300 | 3300042009 | Ga0439451_002714 | Ga0439451_002714_1116_1517 | 133 |
| 301 | 3300042010 | Ga0439452_000253 | Ga0439452_000253_17640_18041 | 133 |
| 302 | 3300042010 | Ga0439452_000674 | Ga0439452_000674_10059_10460 | 133 |
| 303 | 3300042010 | Ga0439452_001028 | Ga0439452_001028_7990_8391 | 133 |
| 304 | 3300042010 | Ga0439452_001344 | Ga0439452_001344_2287_2688 | 133 |
| 305 | 3300042013 | Ga0439456_000526 | Ga0439456_000526_2371_2772 | 133 |
| 306 | 3300042013 | Ga0439456_001325 | Ga0439456_001325_1380_1781 | 133 |
| 307 | 3300042013 | Ga0439456_001725 | Ga0439456_001725_1951_2352 | 133 |
| 308 | 3300042013 | Ga0439456_043549 | Ga0439456_043549_326_727 | 133 |
| 309 | 3300042013 | Ga0439456_058855 | Ga0439456_058855_25_426 | 133 |
| 310 | 3300042016 | Ga0439463_002428 | Ga0439463_002428_1380_1781 | 133 |
| 311 | 3300042016 | Ga0439463_024801 | Ga0439463_024801_521_922 | 133 |
| 312 | 3300042115 | Ga0450911_000009 | Ga0450911_000009_60797_61198 | 133 |
| 313 | 3300042115 | Ga0450911_003941 | Ga0450911_003941_1148_1549 | 133 |
| 314 | 3300042128 | Ga0450897_001266 | Ga0450897_001266_725_1126 | 133 |
| 315 | 3300042131 | Ga0450894_001394 | Ga0450894_001394_1031_1432 | 133 |
| 316 | 3300042134 | Ga0450898_001209 | Ga0450898_001209_458_859 | 133 |
| 317 | 3300042137 | Ga0450902_027869 | Ga0450902_027869_148_549 | 133 |
| 318 | 3300042146 | Ga0450907_000003 | Ga0450907_000003_15995_16396 | 133 |
| 319 | 3300042146 | Ga0450907_010268 | Ga0450907_010268_663_1064 | 133 |
| 320 | 3300042147 | Ga0450910_000195 | Ga0450910_000195_2212_2613 | 133 |
| 321 | 3300042156 | Ga0439446_0000420 | Ga0439446_0000420_2659_3060 | 133 |
| 322 | 3300042156 | Ga0439446_0013445 | Ga0439446_0013445_1592_1993 | 133 |
| 323 | 3300042185 | Ga0450909_000681 | Ga0450909_000681_1423_1824 | 133 |
| 324 | 3300042435 | Ga0439434_0000019 | Ga0439434_0000019_25041_25442 | 133 |
| 325 | 3300042435 | Ga0439434_0040467 | Ga0439434_0040467_39_440 | 133 |
| 326 | 3300042533 | Ga0450901_002242 | Ga0450901_002242_1321_1722 | 133 |
| 327 | 3300042993 | Ga0439440_0003448 | Ga0439440_0003448_1910_2311 | 133 |
| 328 | 3300046452 | Ga0495617_000024 | Ga0495617_000024_141732_142133 | 133 |
| 329 | 3300046452 | Ga0495617_002558 | Ga0495617_002558_6333_6734 | 133 |
| 330 | 3300046452 | Ga0495617_006193 | Ga0495617_006193_2778_3179 | 133 |
| 331 | 3300046452 | Ga0495617_064083 | Ga0495617_064083_440_841 | 133 |
| 332 | 3300046452 | Ga0495617_067476 | Ga0495617_067476_756_1157 | 133 |
| 333 | 3300046452 | Ga0495617_075218 | Ga0495617_075218_314_718 | 133 |
| 334 | 3300046453 | Ga0495627_020253 | Ga0495627_020253_743_1144 | 133 |
| 335 | 3300046453 | Ga0495627_035217 | Ga0495627_035217_756_1157 | 133 |
| 336 | 3300046455 | Ga0495603_0000535 | Ga0495603_0000535_2515_2916 | 133 |
| 337 | 3300046457 | Ga0495590_0077647 | Ga0495590_0077647_291_692 | 133 |
| 338 | 3300046457 | Ga0495590_0104061 | Ga0495590_0104061_465_869 | 133 |
| 339 | 3300046458 | Ga0495591_000054 | Ga0495591_000054_33331_33732 | 133 |
| 340 | 3300046458 | Ga0495591_000055 | Ga0495591_000055_10096_10497 | 133 |
| 341 | 3300046458 | Ga0495591_001528 | Ga0495591_001528_10372_10773 | 133 |
| 342 | 3300046458 | Ga0495591_001589 | Ga0495591_001589_11216_11617 | 133 |
| 343 | 3300046458 | Ga0495591_003749 | Ga0495591_003749_2777_3178 | 133 |
| 344 | 3300046458 | Ga0495591_005366 | Ga0495591_005366_3528_3929 | 133 |
| 345 | 3300046458 | Ga0495591_007279 | Ga0495591_007279_706_1107 | 133 |
| 346 | 3300046459 | Ga0495629_0290941 | Ga0495629_0290941_75_476 | 133 |
| 347 | 3300046459 | Ga0495629_0672281 | Ga0495629_0672281_42_479 | 133 |
| 348 | 3300046460 | Ga0495638_0001316 | Ga0495638_0001316_5702_6103 | 133 |
| 349 | 3300046460 | Ga0495638_0005377 | Ga0495638_0005377_810_1214 | 133 |
| 350 | 3300046460 | Ga0495638_0015276 | Ga0495638_0015276_1280_1681 | 133 |
| 351 | 3300046460 | Ga0495638_0031710 | Ga0495638_0031710_1045_1446 | 133 |
| 352 | 3300046463 | Ga0495653_0011626 | Ga0495653_0011626_5185_5586 | 133 |
| 353 | 3300046463 | Ga0495653_0019616 | Ga0495653_0019616_1986_2426 | 133 |
| 354 | 3300046471 | Ga0495650_0000632 | Ga0495650_0000632_35526_35927 | 133 |
| 355 | 3300046471 | Ga0495650_0000775 | Ga0495650_0000775_9049_9450 | 133 |
| 356 | 3300046471 | Ga0495650_0002438 | Ga0495650_0002438_6510_6911 | 133 |
| 357 | 3300046471 | Ga0495650_0003367 | Ga0495650_0003367_3581_3982 | 133 |
| 358 | 3300046471 | Ga0495650_0007323 | Ga0495650_0007323_4084_4485 | 133 |
| 359 | 3300046471 | Ga0495650_0082378 | Ga0495650_0082378_626_1027 | 133 |
| 360 | 3300046474 | Ga0495605_0000257 | Ga0495605_0000257_50885_51286 | 133 |
| 361 | 3300046474 | Ga0495605_0005581 | Ga0495605_0005581_3771_4172 | 133 |
| 362 | 3300046474 | Ga0495605_0015217 | Ga0495605_0015217_32_433 | 133 |
| 363 | 3300046474 | Ga0495605_0162357 | Ga0495605_0162357_537_941 | 133 |
| 364 | 3300046491 | Ga0495584_0011786 | Ga0495584_0011786_1902_2303 | 133 |
| 365 | 3300046491 | Ga0495584_0044274 | Ga0495584_0044274_1723_2124 | 133 |
| 366 | 3300046491 | Ga0495584_0046508 | Ga0495584_0046508_1120_1521 | 133 |
| 367 | 3300046491 | Ga0495584_0073708 | Ga0495584_0073708_642_1043 | 133 |
| 368 | 3300046491 | Ga0495584_0258040 | Ga0495584_0258040_324_725 | 133 |
| 369 | 3300046492 | Ga0495585_0000047 | Ga0495585_0000047_48817_49218 | 133 |
| 370 | 3300046492 | Ga0495585_0011595 | Ga0495585_0011595_1223_1624 | 133 |
| 371 | 3300046492 | Ga0495585_0020632 | Ga0495585_0020632_1480_1884 | 133 |
| 372 | 3300046500 | Ga0495596_0021759 | Ga0495596_0021759_1144_1545 | 133 |
| 373 | 3300046501 | Ga0495607_0001046 | Ga0495607_0001046_22718_23119 | 133 |
| 374 | 3300046501 | Ga0495607_0001263 | Ga0495607_0001263_9564_9965 | 133 |
| 375 | 3300046501 | Ga0495607_0004807 | Ga0495607_0004807_8216_8617 | 133 |
| 376 | 3300046501 | Ga0495607_0009595 | Ga0495607_0009595_3816_4217 | 133 |
| 377 | 3300046501 | Ga0495607_0030474 | Ga0495607_0030474_2427_2828 | 133 |
| 378 | 3300046501 | Ga0495607_0037709 | Ga0495607_0037709_2165_2566 | 133 |
| 379 | 3300046501 | Ga0495607_0078121 | Ga0495607_0078121_341_742 | 133 |
| 380 | 3300046501 | Ga0495607_0188671 | Ga0495607_0188671_163_564 | 133 |
| 381 | 3300046501 | Ga0495607_0258190 | Ga0495607_0258190_325_726 | 133 |
| 382 | 3300046506 | Ga0495583_0177279 | Ga0495583_0177279_152_553 | 133 |
| 383 | 3300046506 | Ga0495583_0349408 | Ga0495583_0349408_138_560 | 133 |
| 384 | 3300046507 | Ga0495606_0000207 | Ga0495606_0000207_9137_9538 | 133 |
| 385 | 3300046507 | Ga0495606_0000477 | Ga0495606_0000477_34018_34419 | 133 |
| 386 | 3300046507 | Ga0495606_0000577 | Ga0495606_0000577_47359_47760 | 133 |
| 387 | 3300046507 | Ga0495606_0009283 | Ga0495606_0009283_2604_3005 | 133 |
| 388 | 3300046507 | Ga0495606_0011915 | Ga0495606_0011915_2307_2708 | 133 |
| 389 | 3300046507 | Ga0495606_0014035 | Ga0495606_0014035_4443_4844 | 133 |
| 390 | 3300046507 | Ga0495606_0047981 | Ga0495606_0047981_1110_1511 | 133 |
| 391 | 3300046507 | Ga0495606_0051281 | Ga0495606_0051281_1454_1855 | 133 |
| 392 | 3300046507 | Ga0495606_0086581 | Ga0495606_0086581_747_1148 | 133 |
| 393 | 3300046507 | Ga0495606_0245498 | Ga0495606_0245498_30_431 | 133 |
| 394 | 3300046512 | Ga0495610_0000209 | Ga0495610_0000209_50160_50561 | 133 |
| 395 | 3300046512 | Ga0495610_0003616 | Ga0495610_0003616_7433_7834 | 133 |
| 396 | 3300046512 | Ga0495610_0011838 | Ga0495610_0011838_2894_3295 | 133 |
| 397 | 3300046512 | Ga0495610_0021129 | Ga0495610_0021129_2765_3166 | 133 |
| 398 | 3300046512 | Ga0495610_0027234 | Ga0495610_0027234_640_1041 | 133 |
| 399 | 3300046512 | Ga0495610_0048608 | Ga0495610_0048608_1260_1661 | 133 |
| 400 | 3300046513 | Ga0495616_0000430 | Ga0495616_0000430_20458_20859 | 133 |
| 401 | 3300046513 | Ga0495616_0000655 | Ga0495616_0000655_3468_3869 | 133 |
| 402 | 3300046513 | Ga0495616_0021707 | Ga0495616_0021707_418_819 | 133 |
| 403 | 3300046513 | Ga0495616_0048208 | Ga0495616_0048208_415_816 | 133 |
| 404 | 3300046513 | Ga0495616_0143594 | Ga0495616_0143594_534_938 | 133 |
| 405 | 3300046515 | Ga0495620_0000010 | Ga0495620_0000010_31665_32066 | 133 |
| 406 | 3300046515 | Ga0495620_0000029 | Ga0495620_0000029_110104_110505 | 133 |
| 407 | 3300046515 | Ga0495620_0000137 | Ga0495620_0000137_17657_18058 | 133 |
| 408 | 3300046515 | Ga0495620_0000484 | Ga0495620_0000484_9101_9502 | 133 |
| 409 | 3300046515 | Ga0495620_0000843 | Ga0495620_0000843_2975_3376 | 133 |
| 410 | 3300046515 | Ga0495620_0001400 | Ga0495620_0001400_639_1040 | 133 |
| 411 | 3300046515 | Ga0495620_0026310 | Ga0495620_0026310_390_791 | 133 |
| 412 | 3300046515 | Ga0495620_0073257 | Ga0495620_0073257_24_425 | 133 |
| 413 | 3300046515 | Ga0495620_0266708 | Ga0495620_0266708_134_535 | 133 |
| 414 | 3300046517 | Ga0495630_0004914 | Ga0495630_0004914_4241_4642 | 133 |
| 415 | 3300046518 | Ga0495631_0000239 | Ga0495631_0000239_14729_15130 | 133 |
| 416 | 3300046518 | Ga0495631_0006776 | Ga0495631_0006776_2014_2415 | 133 |
| 417 | 3300046518 | Ga0495631_0026174 | Ga0495631_0026174_1208_1609 | 133 |
| 418 | 3300046518 | Ga0495631_0109452 | Ga0495631_0109452_609_1013 | 133 |
| 419 | 3300046518 | Ga0495631_0143185 | Ga0495631_0143185_32_433 | 133 |
| 420 | 3300046519 | Ga0495632_0015196 | Ga0495632_0015196_1621_2022 | 133 |
| 421 | 3300046519 | Ga0495632_0015916 | Ga0495632_0015916_2334_2735 | 133 |
| 422 | 3300046519 | Ga0495632_0024893 | Ga0495632_0024893_2071_2472 | 133 |
| 423 | 3300046519 | Ga0495632_0059685 | Ga0495632_0059685_175_576 | 133 |
| 424 | 3300046519 | Ga0495632_0065486 | Ga0495632_0065486_393_794 | 133 |
| 425 | 3300046519 | Ga0495632_0094516 | Ga0495632_0094516_989_1390 | 133 |
| 426 | 3300046519 | Ga0495632_0210056 | Ga0495632_0210056_58_480 | 133 |
| 427 | 3300046520 | Ga0495637_0000077 | Ga0495637_0000077_73113_73514 | 133 |
| 428 | 3300046520 | Ga0495637_0000098 | Ga0495637_0000098_24310_24711 | 133 |
| 429 | 3300046520 | Ga0495637_0005725 | Ga0495637_0005725_4910_5311 | 133 |
| 430 | 3300046520 | Ga0495637_0006993 | Ga0495637_0006993_4592_4993 | 133 |
| 431 | 3300046520 | Ga0495637_0038311 | Ga0495637_0038311_1489_1890 | 133 |
| 432 | 3300046522 | Ga0495643_0000345 | Ga0495643_0000345_26203_26604 | 133 |
| 433 | 3300046522 | Ga0495643_0001038 | Ga0495643_0001038_19542_19943 | 133 |
| 434 | 3300046522 | Ga0495643_0008035 | Ga0495643_0008035_1824_2225 | 133 |
| 435 | 3300046522 | Ga0495643_0012951 | Ga0495643_0012951_3340_3741 | 133 |
| 436 | 3300046522 | Ga0495643_0014006 | Ga0495643_0014006_1700_2101 | 133 |
| 437 | 3300046522 | Ga0495643_0245524 | Ga0495643_0245524_391_792 | 133 |
| 438 | 3300046523 | Ga0495644_0196336 | Ga0495644_0196336_21_422 | 133 |
| 439 | 3300046523 | Ga0495644_0254488 | Ga0495644_0254488_249_650 | 133 |
| 440 | 3300046523 | Ga0495644_0278501 | Ga0495644_0278501_150_572 | 133 |
| 441 | 3300046523 | Ga0495644_0412284 | Ga0495644_0412284_90_491 | 133 |
| 442 | 3300046524 | Ga0495648_0001842 | Ga0495648_0001842_7973_8374 | 133 |
| 443 | 3300046524 | Ga0495648_0002821 | Ga0495648_0002821_2895_3296 | 133 |
| 444 | 3300046524 | Ga0495648_0004200 | Ga0495648_0004200_7331_7732 | 133 |
| 445 | 3300046524 | Ga0495648_0012291 | Ga0495648_0012291_1240_1641 | 133 |
| 446 | 3300046524 | Ga0495648_0076217 | Ga0495648_0076217_888_1289 | 133 |
| 447 | 3300046526 | Ga0495666_0007013 | Ga0495666_0007013_2108_2548 | 133 |
| 448 | 3300046526 | Ga0495666_0028597 | Ga0495666_0028597_747_1148 | 133 |
| 449 | 3300046526 | Ga0495666_0373932 | Ga0495666_0373932_78_479 | 133 |
| 450 | 3300046530 | Ga0495654_0000897 | Ga0495654_0000897_16299_16700 | 133 |
| 451 | 3300046530 | Ga0495654_0001437 | Ga0495654_0001437_13968_14369 | 133 |
| 452 | 3300046530 | Ga0495654_0005810 | Ga0495654_0005810_2148_2549 | 133 |
| 453 | 3300046530 | Ga0495654_0017995 | Ga0495654_0017995_27_428 | 133 |
| 454 | 3300046530 | Ga0495654_0018015 | Ga0495654_0018015_825_1226 | 133 |
| 455 | 3300046530 | Ga0495654_0018398 | Ga0495654_0018398_1819_2220 | 133 |
| 456 | 3300046530 | Ga0495654_0023888 | Ga0495654_0023888_1275_1676 | 133 |
| 457 | 3300046536 | Ga0495587_0000190 | Ga0495587_0000190_12365_12805 | 133 |
| 458 | 3300046537 | Ga0495598_0180265 | Ga0495598_0180265_249_653 | 133 |
| 459 | 3300046538 | Ga0495609_0000014 | Ga0495609_0000014_62084_62485 | 133 |
| 460 | 3300046538 | Ga0495609_0000188 | Ga0495609_0000188_2009_2410 | 133 |
| 461 | 3300046538 | Ga0495609_0000534 | Ga0495609_0000534_16665_17066 | 133 |
| 462 | 3300046538 | Ga0495609_0009645 | Ga0495609_0009645_3289_3693 | 133 |
| 463 | 3300046542 | Ga0495597_0000061 | Ga0495597_0000061_6806_7207 | 133 |
| 464 | 3300046542 | Ga0495597_0000269 | Ga0495597_0000269_14739_15140 | 133 |
| 465 | 3300046542 | Ga0495597_0030227 | Ga0495597_0030227_409_810 | 133 |
| 466 | 3300046542 | Ga0495597_0099287 | Ga0495597_0099287_485_886 | 133 |
| 467 | 3300046542 | Ga0495597_0268678 | Ga0495597_0268678_40_441 | 133 |
| 468 | 3300046557 | Ga0495622_0012670 | Ga0495622_0012670_1011_1412 | 133 |
| 469 | 3300046557 | Ga0495622_0089635 | Ga0495622_0089635_230_631 | 133 |
| 470 | 3300046557 | Ga0495622_0116695 | Ga0495622_0116695_160_561 | 133 |
| 471 | 3300046558 | Ga0495633_0000009 | Ga0495633_0000009_109388_109789 | 133 |
| 472 | 3300046558 | Ga0495633_0000278 | Ga0495633_0000278_41650_42051 | 133 |
| 473 | 3300046558 | Ga0495633_0031492 | Ga0495633_0031492_808_1209 | 133 |
| 474 | 3300046615 | Ga0495656_0025230 | Ga0495656_0025230_409_813 | 133 |
| 475 | 3300046616 | Ga0495668_0004899 | Ga0495668_0004899_1060_1461 | 133 |
| 476 | 3300046616 | Ga0495668_0014521 | Ga0495668_0014521_700_1101 | 133 |
| 477 | 3300046616 | Ga0495668_0021456 | Ga0495668_0021456_2242_2646 | 133 |
| 478 | 3300046616 | Ga0495668_0187839 | Ga0495668_0187839_13_414 | 133 |
| 479 | 3300046642 | Ga0495634_0001714 | Ga0495634_0001714_6970_7371 | 133 |
| 480 | 3300046648 | Ga0495611_0000862 | Ga0495611_0000862_6251_6652 | 133 |
| 481 | 3300046648 | Ga0495611_0002339 | Ga0495611_0002339_6696_7097 | 133 |
| 482 | 3300046648 | Ga0495611_0008181 | Ga0495611_0008181_2542_2943 | 133 |
| 483 | 3300046648 | Ga0495611_0020467 | Ga0495611_0020467_2388_2792 | 133 |
| 484 | 3300046648 | Ga0495611_0046899 | Ga0495611_0046899_530_931 | 133 |
| 485 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_485879_486280 | 133 |
| 486 | 3300046660 | Ga0495625_0001992 | Ga0495625_0001992_5918_6319 | 133 |
| 487 | 3300046660 | Ga0495625_0014183 | Ga0495625_0014183_3584_3988 | 133 |
| 488 | 3300046660 | Ga0495625_0035565 | Ga0495625_0035565_2333_2734 | 133 |
| 489 | 3300046660 | Ga0495625_0189495 | Ga0495625_0189495_457_858 | 133 |
| 490 | 3300046660 | Ga0495625_0436228 | Ga0495625_0436228_47_448 | 133 |
| 491 | 3300046660 | Ga0495625_0753640 | Ga0495625_0753640_148_549 | 133 |
| 492 | 3300046663 | Ga0495635_0000350 | Ga0495635_0000350_17415_17855 | 133 |
| 493 | 3300046665 | Ga0495661_0000029 | Ga0495661_0000029_171016_171417 | 133 |
| 494 | 3300046665 | Ga0495661_0003921 | Ga0495661_0003921_2318_2719 | 133 |
| 495 | 3300046665 | Ga0495661_0007584 | Ga0495661_0007584_6004_6405 | 133 |
| 496 | 3300046665 | Ga0495661_0015812 | Ga0495661_0015812_4103_4504 | 133 |
| 497 | 3300046665 | Ga0495661_0043197 | Ga0495661_0043197_1797_2198 | 133 |
| 498 | 3300046665 | Ga0495661_0054378 | Ga0495661_0054378_1840_2241 | 133 |
| 499 | 3300046680 | Ga0495646_0000790 | Ga0495646_0000790_7012_7413 | 133 |
| 500 | 3300046684 | Ga0495669_0543667 | Ga0495669_0543667_63_464 | 133 |
| 501 | 3300046684 | Ga0495669_0606626 | Ga0495669_0606626_87_491 | 133 |
| 502 | 3300046691 | Ga0495670_0017504 | Ga0495670_0017504_1936_2337 | 133 |
| 503 | 3300046691 | Ga0495670_0025997 | Ga0495670_0025997_435_836 | 133 |
| 504 | 3300046691 | Ga0495670_0116656 | Ga0495670_0116656_374_775 | 133 |
| 505 | 3300046692 | Ga0495671_0000397 | Ga0495671_0000397_1994_2395 | 133 |
| 506 | 3300046692 | Ga0495671_0001790 | Ga0495671_0001790_3676_4077 | 133 |
| 507 | 3300046692 | Ga0495671_0003980 | Ga0495671_0003980_1989_2390 | 133 |
| 508 | 3300046692 | Ga0495671_0011517 | Ga0495671_0011517_1280_1681 | 133 |
| 509 | 3300046692 | Ga0495671_0013827 | Ga0495671_0013827_1842_2243 | 133 |
| 510 | 3300046692 | Ga0495671_0030327 | Ga0495671_0030327_297_698 | 133 |
| 511 | 3300046694 | Ga0495649_0000081 | Ga0495649_0000081_79689_80090 | 133 |
| 512 | 3300046694 | Ga0495649_0006509 | Ga0495649_0006509_4680_5081 | 133 |
| 513 | 3300046694 | Ga0495649_0041448 | Ga0495649_0041448_1054_1455 | 133 |
| 514 | 3300046694 | Ga0495649_0058857 | Ga0495649_0058857_647_1048 | 133 |
| 515 | 3300046794 | Ga0495589_0000251 | Ga0495589_0000251_17793_18194 | 133 |
| 516 | 3300046794 | Ga0495589_0098173 | Ga0495589_0098173_384_788 | 133 |
| 517 | 3300046810 | Ga0495660_0000052 | Ga0495660_0000052_74562_74963 | 133 |
| 518 | 3300046810 | Ga0495660_0000148 | Ga0495660_0000148_54741_55142 | 133 |
| 519 | 3300046810 | Ga0495660_0001102 | Ga0495660_0001102_12391_12792 | 133 |
| 520 | 3300046810 | Ga0495660_0001450 | Ga0495660_0001450_2796_3197 | 133 |
| 521 | 3300046810 | Ga0495660_0002640 | Ga0495660_0002640_5946_6347 | 133 |
| 522 | 3300046810 | Ga0495660_0002969 | Ga0495660_0002969_3741_4142 | 133 |
| 523 | 3300046810 | Ga0495660_0003761 | Ga0495660_0003761_2933_3334 | 133 |
| 524 | 3300046810 | Ga0495660_0028324 | Ga0495660_0028324_1532_1933 | 133 |
| 525 | 3300046810 | Ga0495660_0070439 | Ga0495660_0070439_59_460 | 133 |
| 526 | 3300046810 | Ga0495660_0159048 | Ga0495660_0159048_22_423 | 133 |
| 527 | 3300047317 | Ga0495604_0041768 | Ga0495604_0041768_1994_2395 | 133 |
| 528 | 3300047320 | Ga0495672_0000407 | Ga0495672_0000407_43919_44320 | 133 |
| 529 | 3300047320 | Ga0495672_0003314 | Ga0495672_0003314_8721_9122 | 133 |
| 530 | 3300047320 | Ga0495672_0010278 | Ga0495672_0010278_3274_3675 | 133 |
| 531 | 3300047320 | Ga0495672_0065591 | Ga0495672_0065591_1536_1937 | 133 |
| 532 | 3300047323 | Ga0495683_0000033 | Ga0495683_0000033_88929_89330 | 133 |
| 533 | 3300047323 | Ga0495683_0003014 | Ga0495683_0003014_4453_4854 | 133 |
| 534 | 3300047323 | Ga0495683_0150885 | Ga0495683_0150885_510_911 | 133 |
| 535 | 3300047323 | Ga0495683_0161786 | Ga0495683_0161786_481_885 | 133 |
| 536 | 3300047323 | Ga0495683_0475347 | Ga0495683_0475347_79_480 | 133 |
| 537 | 3300047444 | Ga0495675_0008889 | Ga0495675_0008889_2924_3325 | 133 |
| 538 | 3300047445 | Ga0495677_0071032 | Ga0495677_0071032_40_444 | 133 |
| 539 | 3300047446 | Ga0495679_000015 | Ga0495679_000015_110522_110923 | 133 |
| 540 | 3300047446 | Ga0495679_001075 | Ga0495679_001075_14053_14454 | 133 |
| 541 | 3300047446 | Ga0495679_002354 | Ga0495679_002354_5979_6380 | 133 |
| 542 | 3300047469 | Ga0495673_0000036 | Ga0495673_0000036_115062_115463 | 133 |
| 543 | 3300047469 | Ga0495673_0000300 | Ga0495673_0000300_64748_65149 | 133 |
| 544 | 3300047469 | Ga0495673_0000525 | Ga0495673_0000525_35475_35876 | 133 |
| 545 | 3300047469 | Ga0495673_0002993 | Ga0495673_0002993_8879_9280 | 133 |
| 546 | 3300047469 | Ga0495673_0003465 | Ga0495673_0003465_7487_7888 | 133 |
| 547 | 3300047469 | Ga0495673_0007028 | Ga0495673_0007028_2825_3226 | 133 |
| 548 | 3300047469 | Ga0495673_0009795 | Ga0495673_0009795_3794_4195 | 133 |
| 549 | 3300047469 | Ga0495673_0018360 | Ga0495673_0018360_27_428 | 133 |
| 550 | 3300047469 | Ga0495673_0023211 | Ga0495673_0023211_2487_2888 | 133 |
| 551 | 3300047469 | Ga0495673_0039676 | Ga0495673_0039676_1032_1433 | 133 |
| 552 | 3300047469 | Ga0495673_0051764 | Ga0495673_0051764_485_886 | 133 |
| 553 | 3300047469 | Ga0495673_0122618 | Ga0495673_0122618_30_431 | 133 |
| 554 | 3300047470 | Ga0495681_0000768 | Ga0495681_0000768_1280_1681 | 133 |
| 555 | 3300047470 | Ga0495681_0041668 | Ga0495681_0041668_677_1078 | 133 |
| 556 | 3300047470 | Ga0495681_0226062 | Ga0495681_0226062_36_437 | 133 |
| 557 | 3300047470 | Ga0495681_0253499 | Ga0495681_0253499_235_636 | 133 |
| 558 | 3300047471 | Ga0495684_0038169 | Ga0495684_0038169_2036_2437 | 133 |
| 559 | 3300047472 | Ga0495686_0000708 | Ga0495686_0000708_32614_33015 | 133 |
| 560 | 3300047472 | Ga0495686_0004371 | Ga0495686_0004371_10132_10533 | 133 |
| 561 | 3300047472 | Ga0495686_0046828 | Ga0495686_0046828_916_1317 | 133 |
| 562 | 3300047472 | Ga0495686_0587285 | Ga0495686_0587285_133_534 | 133 |
| 563 | 3300047673 | Ga0495593_0009302 | Ga0495593_0009302_3261_3701 | 133 |
| 564 | 3300048090 | Ga0495615_0169726 | Ga0495615_0169726_32_433 | 133 |
| 565 | 3300048091 | Ga0495626_0000012 | Ga0495626_0000012_249541_249942 | 133 |
| 566 | 3300048091 | Ga0495626_0001745 | Ga0495626_0001745_12463_12864 | 133 |
| 567 | 3300048091 | Ga0495626_0174777 | Ga0495626_0174777_78_479 | 133 |
| 568 | 3300048091 | Ga0495626_0220184 | Ga0495626_0220184_78_479 | 133 |
| 569 | 3300048905 | Ga0496102_0000821 | Ga0496102_0000821_17460_17900 | 133 |
| 570 | 3300048905 | Ga0496102_0740281 | Ga0496102_0740281_271_672 | 133 |
| 571 | 3300048906 | Ga0496103_0002064 | Ga0496103_0002064_691_1131 | 133 |
| 572 | 3300048909 | Ga0496106_0001032 | Ga0496106_0001032_8535_8936 | 133 |
| 573 | 3300048913 | Ga0496110_1060037 | Ga0496110_1060037_153_554 | 133 |
| 574 | 3300048917 | Ga0496114_0038162 | Ga0496114_0038162_540_953 | 133 |
| 575 | 3300048919 | Ga0496116_0011895 | Ga0496116_0011895_5243_5683 | 133 |
| 576 | 3300048920 | Ga0496117_0008832 | Ga0496117_0008832_1554_1994 | 133 |
| 577 | 3300048920 | Ga0496117_0265579 | Ga0496117_0265579_71_472 | 133 |
| 578 | 3300048921 | Ga0496118_0003083 | Ga0496118_0003083_12077_12517 | 133 |
| 579 | 3300048922 | Ga0496119_0015131 | Ga0496119_0015131_2299_2700 | 133 |
| 580 | 3300048923 | Ga0496120_0001430 | Ga0496120_0001430_3297_3698 | 133 |
| 581 | 3300048924 | Ga0496121_0000782 | Ga0496121_0000782_42010_42411 | 133 |
| 582 | 3300048924 | Ga0496121_0024059 | Ga0496121_0024059_3305_3706 | 133 |
| 583 | 3300048924 | Ga0496121_0037696 | Ga0496121_0037696_1694_2095 | 133 |
| 584 | 3300048924 | Ga0496121_0042734 | Ga0496121_0042734_3464_3904 | 133 |
| 585 | 3300048924 | Ga0496121_0047827 | Ga0496121_0047827_312_713 | 133 |
| 586 | 3300048924 | Ga0496121_0192598 | Ga0496121_0192598_559_960 | 133 |
| 587 | 3300048927 | Ga0496124_0001319 | Ga0496124_0001319_33442_33843 | 133 |
| 588 | 3300048927 | Ga0496124_0024406 | Ga0496124_0024406_2947_3348 | 133 |
| 589 | 3300048927 | Ga0496124_0034155 | Ga0496124_0034155_2185_2586 | 133 |
| 590 | 3300048927 | Ga0496124_0069717 | Ga0496124_0069717_2292_2693 | 133 |
| 591 | 3300048927 | Ga0496124_0076475 | Ga0496124_0076475_2255_2656 | 133 |
| 592 | 3300048928 | Ga0496125_0001337 | Ga0496125_0001337_3315_3716 | 133 |
| 593 | 3300048928 | Ga0496125_0083021 | Ga0496125_0083021_854_1255 | 133 |
| 594 | 3300048928 | Ga0496125_0403803 | Ga0496125_0403803_71_472 | 133 |
| 595 | 3300048929 | Ga0496126_0042934 | Ga0496126_0042934_2681_3082 | 133 |
| 596 | 3300048929 | Ga0496126_0305398 | Ga0496126_0305398_876_1289 | 133 |
| 597 | 3300048929 | Ga0496126_0480541 | Ga0496126_0480541_437_877 | 133 |
| 598 | 3300049459 | Ga0495678_000011 | Ga0495678_000011_97628_98029 | 133 |
| 599 | 3300049459 | Ga0495678_000052 | Ga0495678_000052_110870_111271 | 133 |
| 600 | 3300049459 | Ga0495678_003094 | Ga0495678_003094_583_984 | 133 |
| 601 | 3300049459 | Ga0495678_003321 | Ga0495678_003321_8604_9005 | 133 |
| 602 | 3300049459 | Ga0495678_003781 | Ga0495678_003781_3215_3616 | 133 |
| 603 | 3300049459 | Ga0495678_013815 | Ga0495678_013815_2155_2556 | 133 |
| 604 | 3300049459 | Ga0495678_182866 | Ga0495678_182866_136_537 | 133 |
| 605 | 3300049460 | Ga0495682_0000073 | Ga0495682_0000073_9279_9680 | 133 |
| 606 | 3300049460 | Ga0495682_0000542 | Ga0495682_0000542_10632_11033 | 133 |
| 607 | 3300049460 | Ga0495682_0008714 | Ga0495682_0008714_1561_1962 | 133 |
| 608 | 3300049460 | Ga0495682_0035451 | Ga0495682_0035451_617_1018 | 133 |
| 609 | 3300050489 | nmdc:mga03683_3_c1 | nmdc:mga03683_3_c1_270640_271041 | 133 |
| 610 | 3300050490 | nmdc:mga03n38_250728_c1 | nmdc:mga03n38_250728_c1_122_523 | 133 |
| 611 | 3300050491 | nmdc:mga00v17_741837_c1 | nmdc:mga00v17_741837_c1_167_568 | 133 |
| 612 | 3300050492 | nmdc:mga0yw44_100328_c1 | nmdc:mga0yw44_100328_c1_791_1192 | 133 |
| 613 | 3300050493 | nmdc:mga0k408_2_c1 | nmdc:mga0k408_2_c1_279988_280389 | 133 |
| 614 | 3300050516 | nmdc:mga0sz30_162_c1 | nmdc:mga0sz30_162_c1_16711_17112 | 133 |
| 615 | 3300053087 | Ga0500643_003161 | Ga0500643_003161_1661_2062 | 133 |
| 616 | 3300053125 | Ga0500618_000087 | Ga0500618_000087_13819_14220 | 133 |
| 617 | 3300053140 | Ga0500573_0329255 | Ga0500573_0329255_292_693 | 133 |
| 618 | 3300053147 | Ga0500589_091940 | Ga0500589_091940_10_411 | 133 |
| 619 | 3300053158 | Ga0500627_0126076 | Ga0500627_0126076_80_484 | 133 |
| 620 | 3300053730 | Ga0500645_025607 | Ga0500645_025607_1339_1743 | 133 |
| 621 | 3300053735 | Ga0500596_031575 | Ga0500596_031575_170_571 | 133 |
| 622 | 3300002737 | JGI25162J39368_1000010 | JGI25162J39368_1000010291 | 134 |
| 623 | 3300002771 | JGI25163J39215_1000005 | JGI25163J39215_100000563 | 134 |
| 624 | 3300002772 | JGI25164J39214_1000003 | JGI25164J39214_100000374 | 134 |
| 625 | 3300003751 | Ga0055538_1000009 | Ga0055538_1000009291 | 134 |
| 626 | 3300003752 | Ga0055539_1000013 | Ga0055539_1000013291 | 134 |
| 627 | 3300003756 | Ga0055533_1000017 | Ga0055533_1000017291 | 134 |
| 628 | 3300003759 | Ga0055525_1000019 | Ga0055525_1000019291 | 134 |
| 629 | 3300003841 | Ga0055541_1000010 | Ga0055541_1000010291 | 134 |
| 630 | 3300005289 | Ga0065704_10001203 | Ga0065704_100012033 | 134 |
| 631 | 3300005563 | Ga0068855_100007614 | Ga0068855_10000761410 | 134 |
| 632 | 3300009011 | Ga0105251_10004367 | Ga0105251_100043675 | 134 |
| 633 | 3300009545 | Ga0105237_10051981 | Ga0105237_100519812 | 134 |
| 634 | 3300014325 | Ga0163163_10115530 | Ga0163163_101155303 | 134 |
| 635 | 3300025207 | Ga0209760_100038 | Ga0209760_10003821 | 134 |
| 636 | 3300025224 | Ga0209784_100012 | Ga0209784_100012286 | 134 |
| 637 | 3300025225 | Ga0209566_100010 | Ga0209566_100010286 | 134 |
| 638 | 3300025226 | Ga0209674_100023 | Ga0209674_100023286 | 134 |
| 639 | 3300025230 | Ga0209563_100027 | Ga0209563_100027286 | 134 |
| 640 | 3300025231 | Ga0207427_100017 | Ga0207427_100017286 | 134 |
| 641 | 3300025233 | Ga0209437_100029 | Ga0209437_100029286 | 134 |
| 642 | 3300025253 | Ga0209677_100014 | Ga0209677_100014286 | 134 |
| 643 | 3300025261 | Ga0209233_1001957 | Ga0209233_10019574 | 134 |
| 644 | 3300025303 | Ga0209051_1033397 | Ga0209051_10333973 | 134 |
| 645 | 3300025711 | Ga0207696_1000788 | Ga0207696_10007886 | 134 |
| 646 | 3300025728 | Ga0207655_1004784 | Ga0207655_10047843 | 134 |
| 647 | 3300025735 | Ga0207713_1005257 | Ga0207713_10052576 | 134 |
| 648 | 3300025914 | Ga0207671_10046544 | Ga0207671_100465442 | 134 |
| 649 | 3300025925 | Ga0207650_11144089 | Ga0207650_111440892 | 134 |
| 650 | 3300025949 | Ga0207667_10022678 | Ga0207667_100226783 | 134 |
| 651 | 3300031456 | Ga0307513_10011047 | Ga0307513_100110472 | 134 |
| 652 | 3300042146 | Ga0450907_000187 | Ga0450907_000187_7553_7957 | 134 |
| 653 | 3300046453 | Ga0495627_004795 | Ga0495627_004795_1652_2062 | 134 |
| 654 | 3300046455 | Ga0495603_0354944 | Ga0495603_0354944_58_468 | 134 |
| 655 | 3300046458 | Ga0495591_003342 | Ga0495591_003342_5359_5769 | 134 |
| 656 | 3300046471 | Ga0495650_0000052 | Ga0495650_0000052_294183_294587 | 134 |
| 657 | 3300046471 | Ga0495650_0001762 | Ga0495650_0001762_13739_14149 | 134 |
| 658 | 3300046474 | Ga0495605_0000002 | Ga0495605_0000002_135260_135670 | 134 |
| 659 | 3300046475 | Ga0495639_0296621 | Ga0495639_0296621_191_601 | 134 |
| 660 | 3300046499 | Ga0495594_0003396 | Ga0495594_0003396_6111_6521 | 134 |
| 661 | 3300046501 | Ga0495607_0013946 | Ga0495607_0013946_1166_1570 | 134 |
| 662 | 3300046501 | Ga0495607_0116804 | Ga0495607_0116804_228_632 | 134 |
| 663 | 3300046506 | Ga0495583_0000012 | Ga0495583_0000012_297226_297636 | 134 |
| 664 | 3300046515 | Ga0495620_0006940 | Ga0495620_0006940_3390_3794 | 134 |
| 665 | 3300046518 | Ga0495631_0003091 | Ga0495631_0003091_7961_8371 | 134 |
| 666 | 3300046524 | Ga0495648_0005523 | Ga0495648_0005523_1734_2144 | 134 |
| 667 | 3300046530 | Ga0495654_0001265 | Ga0495654_0001265_10163_10573 | 134 |
| 668 | 3300046530 | Ga0495654_0010281 | Ga0495654_0010281_4227_4631 | 134 |
| 669 | 3300046538 | Ga0495609_0000008 | Ga0495609_0000008_96525_96935 | 134 |
| 670 | 3300046538 | Ga0495609_0219709 | Ga0495609_0219709_110_514 | 134 |
| 671 | 3300046557 | Ga0495622_0000003 | Ga0495622_0000003_143128_143541 | 134 |
| 672 | 3300046557 | Ga0495622_0000367 | Ga0495622_0000367_16221_16625 | 134 |
| 673 | 3300046648 | Ga0495611_0009279 | Ga0495611_0009279_3505_3915 | 134 |
| 674 | 3300046665 | Ga0495661_0072228 | Ga0495661_0072228_1301_1711 | 134 |
| 675 | 3300046674 | Ga0495588_0220681 | Ga0495588_0220681_326_736 | 134 |
| 676 | 3300046690 | Ga0495624_0038386 | Ga0495624_0038386_1951_2355 | 134 |
| 677 | 3300046691 | Ga0495670_0195726 | Ga0495670_0195726_381_791 | 134 |
| 678 | 3300046692 | Ga0495671_0053127 | Ga0495671_0053127_687_1097 | 134 |
| 679 | 3300046794 | Ga0495589_0006350 | Ga0495589_0006350_2552_2956 | 134 |
| 680 | 3300046810 | Ga0495660_0000006 | Ga0495660_0000006_286239_286643 | 134 |
| 681 | 3300046810 | Ga0495660_0004153 | Ga0495660_0004153_1300_1710 | 134 |
| 682 | 3300047323 | Ga0495683_0000042 | Ga0495683_0000042_55834_56244 | 134 |
| 683 | 3300047446 | Ga0495679_000060 | Ga0495679_000060_82157_82567 | 134 |
| 684 | 3300047446 | Ga0495679_004740 | Ga0495679_004740_3352_3756 | 134 |
| 685 | 3300047469 | Ga0495673_0056862 | Ga0495673_0056862_980_1390 | 134 |
| 686 | 3300047469 | Ga0495673_0060999 | Ga0495673_0060999_503_907 | 134 |
| 687 | 3300047470 | Ga0495681_0001769 | Ga0495681_0001769_12775_13185 | 134 |
| 688 | 3300048905 | Ga0496102_1513441 | Ga0496102_1513441_158_562 | 134 |
| 689 | 3300048907 | Ga0496104_0011249 | Ga0496104_0011249_7188_7592 | 134 |
| 690 | 3300048918 | Ga0496115_0735125 | Ga0496115_0735125_79_501 | 134 |
| 691 | 3300048919 | Ga0496116_0000020 | Ga0496116_0000020_301194_301598 | 134 |
| 692 | 3300048919 | Ga0496116_0150413 | Ga0496116_0150413_812_1219 | 134 |
| 693 | 3300048920 | Ga0496117_0000246 | Ga0496117_0000246_98759_99163 | 134 |
| 694 | 3300048920 | Ga0496117_0001151 | Ga0496117_0001151_3627_4031 | 134 |
| 695 | 3300048921 | Ga0496118_0041846 | Ga0496118_0041846_437_841 | 134 |
| 696 | 3300048921 | Ga0496118_0348059 | Ga0496118_0348059_168_575 | 134 |
| 697 | 3300048922 | Ga0496119_0019254 | Ga0496119_0019254_2638_3042 | 134 |
| 698 | 3300048923 | Ga0496120_0007714 | Ga0496120_0007714_5996_6400 | 134 |
| 699 | 3300048924 | Ga0496121_0112158 | Ga0496121_0112158_102_509 | 134 |
| 700 | 3300048924 | Ga0496121_0238564 | Ga0496121_0238564_526_996 | 134 |
| 701 | 3300048925 | Ga0496122_0000010 | Ga0496122_0000010_514428_514832 | 134 |
| 702 | 3300048925 | Ga0496122_0016615 | Ga0496122_0016615_2356_2766 | 134 |
| 703 | 3300048926 | Ga0496123_0000025 | Ga0496123_0000025_25675_26079 | 134 |
| 704 | 3300048926 | Ga0496123_0006592 | Ga0496123_0006592_2306_2716 | 134 |
| 705 | 3300048927 | Ga0496124_0000084 | Ga0496124_0000084_201115_201519 | 134 |
| 706 | 3300048928 | Ga0496125_0000071 | Ga0496125_0000071_211361_211765 | 134 |
| 707 | 3300048928 | Ga0496125_0468744 | Ga0496125_0468744_223_627 | 134 |
| 708 | 3300048929 | Ga0496126_0049632 | Ga0496126_0049632_1628_2032 | 134 |
| 709 | 3300053125 | Ga0500618_000095 | Ga0500618_000095_36260_36673 | 134 |
| 710 | 3300053153 | Ga0500616_0411022 | Ga0500616_0411022_93_497 | 134 |
| 711 | 3300046525 | Ga0495663_0144567 | Ga0495663_0144567_31_459 | 135 |
| 712 | 3300046507 | Ga0495606_0011103 | Ga0495606_0011103_5764_6177 | 137 |
| 713 | 3300046691 | Ga0495670_0015653 | Ga0495670_0015653_1208_1678 | 137 |
| 714 | 3300047322 | Ga0495680_0079938 | Ga0495680_0079938_589_1059 | 137 |
| 715 | 3300005467 | Ga0070706_100215073 | Ga0070706_1002150732 | 138 |
| 716 | 3300046457 | Ga0495590_0003530 | Ga0495590_0003530_1486_1962 | 138 |
| 717 | 3300046474 | Ga0495605_0002034 | Ga0495605_0002034_10366_10842 | 138 |
| 718 | 3300047469 | Ga0495673_0002620 | Ga0495673_0002620_10076_10552 | 138 |
| 719 | 3300053111 | Ga0500572_154950 | Ga0500572_154950_179_595 | 138 |
| 720 | 3300053145 | Ga0500586_229215 | Ga0500586_229215_85_579 | 138 |
| 721 | 3300046500 | Ga0495596_0067160 | Ga0495596_0067160_866_1327 | 139 |
| 722 | 3300046520 | Ga0495637_0249705 | Ga0495637_0249705_93_572 | 139 |
| 723 | 3300046664 | Ga0495659_0319614 | Ga0495659_0319614_17_478 | 139 |
| 724 | 3300046692 | Ga0495671_0181488 | Ga0495671_0181488_525_1004 | 139 |
| 725 | 2162886007 | SwRhRL2b_contig_3239005 | SwRhRL2b_0418.00001970 | 140 |
| 726 | 3300009092 | Ga0105250_10001159 | Ga0105250_1000115913 | 140 |
| 727 | 3300013306 | Ga0163162_10087004 | Ga0163162_100870042 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.8967 | 6 | 132 |
| 4z04-assembly1.cif.gz_A-2 | crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione | 0.8622 | 6 | 132 |
| 4qb5-assembly1.cif.gz_C | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8521 | 6 | 133 |
| 4qb5-assembly2.cif.gz_B | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8434 | 6 | 133 |
| 4qb5-assembly1.cif.gz_C | crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 | 0.8389 | 6 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IK86_519_679_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9497 | 75 | 98 | 3.40.50.300 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8967 | 6 | 132 | 3.10.180.10 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8912 | 75 | 132 | 3.30.720.110 |
| 4z04A00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8622 | 6 | 132 | 3.10.180.10 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.846 | 75 | 131 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B3GEU0-F1-model_v4 | deleted | 1.008 | 74 | 138 |
|
| AF-A0A7Y8B6K7-F1-model_v4 | deleted | 1.002 | 76 | 137 |
|
| AF-A0A514BFE7-F1-model_v4 | deleted | 0.9987 | 76 | 139 |
|
| AF-A0A2V1CTG9-F1-model_v4 | VOC domain-containing protein | 0.9979 | 76 | 133 |
|
| AF-I0SCL7-F1-model_v4 | Glyoxalase domain protein | 0.9962 | 75 | 132 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar