F477718

General Info

Members Datasets Scaffolds Average Seq Length
727 363 726 134

Family's Representative Sequence

Representative Sequence 3300001978|JGI24747J21853_1009353|JGI24747J21853_10093532
Length 150
Sequence MSLFLPVPPGPLSPATNRKGPQMIDHIYLPVTNIKRSLDFYSALLTPLGKADRWKFEAKAGYPDLWGFGEPQPGFWLKESNASFPALYVAFAALSEQAVNEAFDAALAHGGKDNGAPGLRPQFLPDYYAANVLDPDGYSLEICFKPWLYE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2738543012 Acidovorax sp. CF301 Isolate Unclassified
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
198 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
199 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
213 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
214 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
221 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
227 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
228 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
229 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
230 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
231 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
232 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
240 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
241 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
242 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
245 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
246 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
247 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
248 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
249 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
252 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
282 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
286 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
287 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
288 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
289 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
319 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
320 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
321 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
326 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
344 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
345 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
346 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
353 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
354 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
355 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
358 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.6
Nodule 0
Rhizoplane 2.61
Rhizosphere 84.46
Stem 0
Stem Tuber 0
Unclassified 6.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3239005 2162886007 Bacteria 3268
2 JGI24747J21853_1009353 3300001978 Bacteria 967
3 JGI24739J22299_10064142 3300001989 Bacteria 1155
4 JGI24748J21848_1012606 3300002074 Bacteria 998
5 JGI24738J21930_10005840 3300002075 Bacteria 2924
6 JGI24744J21845_10002652 3300002077 Bacteria 3651
7 JGI25162J39368_1000010 3300002737 Bacteria 389629
8 JGI25163J39215_1000005 3300002771 Bacteria 128851
9 JGI25164J39214_1000003 3300002772 Bacteria 389390
10 rootH2_10016961 3300003320 Bacteria 5664
11 Ga0055538_1000009 3300003751 Bacteria 389629
12 Ga0055539_1000013 3300003752 Bacteria 389629
13 Ga0055533_1000017 3300003756 Bacteria 389629
14 Ga0055525_1000019 3300003759 Bacteria 389629
15 Ga0055541_1000010 3300003841 Bacteria 389629
16 Ga0065704_10001203 3300005289 Bacteria 8956
17 Ga0065704_10131855 3300005289 Bacteria 1619
18 Ga0065704_10165426 3300005289 Bacteria 1325
19 Ga0070676_10523544 3300005328 Bacteria 845
20 Ga0070690_100038790 3300005330 Bacteria 3008
21 Ga0068869_100010287 3300005334 Bacteria 6097
22 Ga0070666_10197535 3300005335 Bacteria 1415
23 Ga0070680_100240017 3300005336 Bacteria 1532
24 Ga0070682_100044718 3300005337 Bacteria 2742
25 Ga0068868_100004689 3300005338 Bacteria 9601
26 Ga0070660_100029000 3300005339 Bacteria 4145
27 Ga0070689_100019874 3300005340 Bacteria 4973
28 Ga0070691_10006182 3300005341 Bacteria 5464
29 Ga0070687_100011551 3300005343 Bacteria 3866
30 Ga0070661_100022741 3300005344 Bacteria 4489
31 Ga0070692_10358177 3300005345 Bacteria 909
32 Ga0070668_100120512 3300005347 Bacteria 2096
33 Ga0070669_100021971 3300005353 Bacteria 4562
34 Ga0070675_101755630 3300005354 Bacteria 572
35 Ga0070671_100085463 3300005355 Bacteria 2639
36 Ga0070673_100242496 3300005364 Bacteria 1568
37 Ga0070688_100063907 3300005365 Bacteria 2334
38 Ga0070659_100030764 3300005366 Bacteria 4154
39 Ga0070667_100000794 3300005367 Bacteria 29595
40 Ga0070703_10033674 3300005406 Bacteria 1561
41 Ga0070709_10005916 3300005434 Bacteria 6637
42 Ga0070714_100403384 3300005435 Bacteria 1293
43 Ga0070710_10100630 3300005437 Bacteria 1720
44 Ga0070701_10004576 3300005438 Bacteria 5624
45 Ga0070711_100192768 3300005439 Bacteria 1567
46 Ga0070705_100037004 3300005440 Bacteria 2749
47 Ga0070700_100002695 3300005441 Bacteria 9071
48 Ga0070694_100003295 3300005444 Bacteria 9656
49 Ga0070663_100176515 3300005455 Bacteria 1654
50 Ga0070678_100008828 3300005456 Bacteria 6062
51 Ga0070662_100239877 3300005457 Bacteria 1453
52 Ga0068867_100047479 3300005459 Bacteria 3156
53 Ga0070685_10156918 3300005466 Bacteria 1447
54 Ga0070706_100215073 3300005467 Bacteria 1794
55 Ga0070706_101306245 3300005467 Bacteria 665
56 Ga0070707_100004763 3300005468 Bacteria 12697
57 Ga0070698_100286381 3300005471 Bacteria 1579
58 Ga0070698_100685396 3300005471 Bacteria 967
59 Ga0070679_100386165 3300005530 Bacteria 1347
60 Ga0070697_100060684 3300005536 Bacteria 3083
61 Ga0070697_100069270 3300005536 Bacteria 2889
62 Ga0068853_100080626 3300005539 Bacteria 2848
63 Ga0070686_100038219 3300005544 Bacteria 2982
64 Ga0070695_100001855 3300005545 Bacteria 11929
65 Ga0070696_100075923 3300005546 Bacteria 2371
66 Ga0070693_100042155 3300005547 Bacteria 2571
67 Ga0070665_100037045 3300005548 Bacteria 4905
68 Ga0070665_100087338 3300005548 Bacteria 3124
69 Ga0070704_100023719 3300005549 Bacteria 4013
70 Ga0068855_100007614 3300005563 Bacteria 13101
71 Ga0068855_100333596 3300005563 Bacteria 1674
72 Ga0068854_100184291 3300005578 Bacteria 1632
73 Ga0068856_100198181 3300005614 Bacteria 2022
74 Ga0070702_100002761 3300005615 Bacteria 7689
75 Ga0068852_100111989 3300005616 Bacteria 2482
76 Ga0068859_100002434 3300005617 Bacteria 18947
77 Ga0068866_10001034 3300005718 Bacteria 12238
78 Ga0068861_100174020 3300005719 Bacteria 1786
79 Ga0068851_10459988 3300005834 Bacteria 757
80 Ga0068858_100063666 3300005842 Bacteria 3412
81 Ga0068860_100049201 3300005843 Bacteria 4016
82 Ga0068862_100003107 3300005844 Bacteria 14482
83 Ga0075364_10004291 3300006051 Bacteria 8186
84 Ga0075364_10445885 3300006051 Bacteria 884
85 Ga0070715_10044920 3300006163 Bacteria 1870
86 Ga0070716_100018247 3300006173 Bacteria 3651
87 Ga0070712_100068290 3300006175 Bacteria 2532
88 Ga0075362_10000015 3300006177 Bacteria 84026
89 Ga0075367_10119800 3300006178 Bacteria 1621
90 Ga0075369_10000089 3300006186 Bacteria 24511
91 Ga0075366_10000072 3300006195 Bacteria 39088
92 Ga0097621_100258302 3300006237 Bacteria 1527
93 Ga0075370_10063904 3300006353 Bacteria 2099
94 Ga0068865_100048976 3300006881 Bacteria 2910
95 Ga0075436_100377182 3300006914 Bacteria 1025
96 Ga0097620_100002434 3300006931 Bacteria 18947
97 Ga0099794_10697660 3300007265 Bacteria 540
98 Ga0099795_10007162 3300007788 Bacteria 3094
99 Ga0099795_10097734 3300007788 Bacteria 1147
100 Ga0105251_10004367 3300009011 Bacteria 9652
101 Ga0105244_10039053 3300009036 Bacteria 2473
102 Ga0105250_10001159 3300009092 Bacteria 14825
103 Ga0105250_10008431 3300009092 Bacteria 4380
104 Ga0105240_11466340 3300009093 Bacteria 716
105 Ga0105245_10002500 3300009098 Bacteria 16582
106 Ga0105247_10016195 3300009101 Bacteria 4466
107 Ga0105247_10094556 3300009101 Bacteria 1902
108 Ga0105243_10130617 3300009148 Bacteria 2130
109 Ga0105243_10186394 3300009148 Bacteria 1809
110 Ga0105241_10175486 3300009174 Bacteria 1773
111 Ga0105242_10009509 3300009176 Bacteria 7450
112 Ga0105248_10146596 3300009177 Bacteria 2664
113 Ga0105237_10022373 3300009545 Bacteria 6486
114 Ga0105237_10051981 3300009545 Bacteria 4115
115 Ga0105238_10631853 3300009551 Bacteria 1080
116 Ga0105249_10014068 3300009553 Bacteria 7073
117 Ga0099796_10380729 3300010159 Bacteria 615
118 Ga0105239_10059356 3300010375 Bacteria 4198
119 Ga0105246_10000102 3300011119 Bacteria 37463
120 Ga0105246_10267507 3300011119 Bacteria 1365
121 Ga0157373_10639381 3300013100 Bacteria 776
122 Ga0157371_10013871 3300013102 Bacteria 6105
123 Ga0157371_10168600 3300013102 Bacteria 1564
124 Ga0157370_10118720 3300013104 Bacteria 2470
125 Ga0157369_10002042 3300013105 Bacteria 24345
126 Ga0157369_10217830 3300013105 Bacteria 1999
127 Ga0157374_10253610 3300013296 Bacteria 1732
128 Ga0157374_11315059 3300013296 Bacteria 745
129 Ga0157378_10159532 3300013297 Bacteria 2108
130 Ga0157378_11524596 3300013297 Bacteria 713
131 Ga0163162_10087004 3300013306 Bacteria 3203
132 Ga0163162_10288082 3300013306 Bacteria 1774
133 Ga0163162_10378602 3300013306 Bacteria 1548
134 Ga0157372_10003068 3300013307 Bacteria 17992
135 Ga0157372_10073167 3300013307 Bacteria 3862
136 Ga0157375_10000819 3300013308 Bacteria 27196
137 Ga0157375_10001585 3300013308 Bacteria 19562
138 Ga0157375_10949221 3300013308 Bacteria 1002
139 Ga0163163_10115530 3300014325 Bacteria 2715
140 Ga0157380_10007831 3300014326 Bacteria 7603
141 Ga0182008_10020924 3300014497 Bacteria 3365
142 Ga0182008_10024200 3300014497 Bacteria 3093
143 Ga0182008_10026807 3300014497 Bacteria 2921
144 Ga0182008_10384308 3300014497 Bacteria 751
145 Ga0182008_10583282 3300014497 Bacteria 625
146 Ga0157377_10025444 3300014745 Bacteria 3157
147 Ga0157379_10001763 3300014968 Bacteria 17891
148 Ga0157376_10043329 3300014969 Bacteria 3693
149 Ga0182006_1000066 3300015261 Bacteria 151095
150 Ga0182006_1005946 3300015261 Bacteria 5737
151 Ga0182007_10034208 3300015262 Bacteria 1718
152 Ga0182005_1001642 3300015265 Bacteria 8697
153 Ga0182005_1002721 3300015265 Bacteria 6179
154 Ga0182005_1108373 3300015265 Bacteria 783
155 Ga0182005_1108553 3300015265 Bacteria 783
156 Ga0163161_10001211 3300017792 Bacteria 19428
157 Ga0163161_10056133 3300017792 Bacteria 2860
158 Ga0209760_100038 3300025207 Bacteria 126360
159 Ga0209784_100012 3300025224 Bacteria 535823
160 Ga0209566_100010 3300025225 Bacteria 535823
161 Ga0209674_100023 3300025226 Bacteria 535823
162 Ga0209563_100027 3300025230 Bacteria 535823
163 Ga0207427_100017 3300025231 Bacteria 535823
164 Ga0209437_100029 3300025233 Bacteria 535823
165 Ga0209677_100014 3300025253 Bacteria 535823
166 Ga0209233_1001957 3300025261 Bacteria 7838
167 Ga0209675_1014477 3300025291 Bacteria 2401
168 Ga0209025_1057859 3300025294 Bacteria 1477
169 Ga0209051_1033397 3300025303 Bacteria 1947
170 Ga0207696_1000788 3300025711 Bacteria 20764
171 Ga0207696_1044933 3300025711 Bacteria 1279
172 Ga0207655_1004784 3300025728 Bacteria 9440
173 Ga0207655_1037207 3300025728 Bacteria 2145
174 Ga0207713_1005257 3300025735 Bacteria 8159
175 Ga0207653_10025305 3300025885 Bacteria 1898
176 Ga0207692_10015153 3300025898 Unclassified 3386
177 Ga0207710_10077637 3300025900 Bacteria 1534
178 Ga0207710_10089879 3300025900 Bacteria 1436
179 Ga0207688_10002669 3300025901 Bacteria 9661
180 Ga0207680_10249618 3300025903 Bacteria 1225
181 Ga0207647_10010922 3300025904 Bacteria 6389
182 Ga0207685_10215763 3300025905 Bacteria 910
183 Ga0207699_10067409 3300025906 Bacteria 2175
184 Ga0207645_10416088 3300025907 Bacteria 905
185 Ga0207684_10563400 3300025910 Bacteria 974
186 Ga0207654_10093561 3300025911 Bacteria 1838
187 Ga0207695_11427946 3300025913 Bacteria 572
188 Ga0207671_10046544 3300025914 Bacteria 3209
189 Ga0207693_10006185 3300025915 Bacteria 9931
190 Ga0207663_10157710 3300025916 Bacteria 1598
191 Ga0207662_10147914 3300025918 Bacteria 1492
192 Ga0207657_10213700 3300025919 Bacteria 1547
193 Ga0207657_10729149 3300025919 Bacteria 769
194 Ga0207649_10027626 3300025920 Bacteria 3332
195 Ga0207646_10052718 3300025922 Bacteria 3640
196 Ga0207681_10242241 3300025923 Bacteria 1404
197 Ga0207694_10504583 3300025924 Bacteria 1013
198 Ga0207650_10000241 3300025925 Bacteria 60600
199 Ga0207650_11144089 3300025925 Bacteria 662
200 Ga0207659_11339754 3300025926 Unclassified 614
201 Ga0207687_10011422 3300025927 Bacteria 5805
202 Ga0207664_10306464 3300025929 Bacteria 1398
203 Ga0207644_10026605 3300025931 Bacteria 3988
204 Ga0207690_10200239 3300025932 Bacteria 1516
205 Ga0207706_10003200 3300025933 Bacteria 15717
206 Ga0207686_10027452 3300025934 Unclassified 3334
207 Ga0207709_10224168 3300025935 Bacteria 1358
208 Ga0207669_10253153 3300025937 Bacteria 1312
209 Ga0207704_10001403 3300025938 Bacteria 10761
210 Ga0207665_10001697 3300025939 Bacteria 14811
211 Ga0207711_10035562 3300025941 Bacteria 4223
212 Ga0207689_10016615 3300025942 Bacteria 6228
213 Ga0207667_10022678 3300025949 Bacteria 6926
214 Ga0207667_10833486 3300025949 Bacteria 917
215 Ga0207712_10054178 3300025961 Bacteria 2816
216 Ga0207640_10039103 3300025981 Bacteria 2999
217 Ga0207658_10274952 3300025986 Bacteria 1441
218 Ga0207677_10174098 3300026023 Bacteria 1686
219 Ga0207703_10095813 3300026035 Bacteria 2504
220 Ga0207639_10173499 3300026041 Bacteria 1828
221 Ga0207678_10013359 3300026067 Bacteria 7206
222 Ga0207678_10205900 3300026067 Bacteria 1683
223 Ga0207708_10000709 3300026075 Bacteria 25151
224 Ga0207702_10836971 3300026078 Bacteria 910
225 Ga0207648_10003479 3300026089 Bacteria 16501
226 Ga0207675_100002920 3300026118 Bacteria 16818
227 Ga0207683_10016343 3300026121 Bacteria 6317
228 Ga0268266_10490930 3300028379 Bacteria 1171
229 Ga0268265_10270481 3300028380 Bacteria 1515
230 Ga0268264_10098966 3300028381 Bacteria 2530
231 Ga0265328_10006401 3300031239 Bacteria 4990
232 Ga0265331_10118347 3300031250 Unclassified 1212
233 Ga0265316_10451345 3300031344 Unclassified 922
234 Ga0307513_10011047 3300031456 Bacteria 11261
235 Ga0265313_10107084 3300031595 Unclassified 1233
236 Ga0307508_10209678 3300031616 Bacteria 1549
237 Ga0265342_10038998 3300031712 Bacteria 2889
238 Ga0307405_10000197 3300031731 Bacteria 22213
239 Ga0307413_11626549 3300031824 Bacteria 574
240 Ga0307412_10057221 3300031911 Bacteria 2602
241 Ga0307412_10209117 3300031911 Bacteria 1487
242 Ga0307409_100099415 3300031995 Bacteria 2409
243 Ga0307416_100024736 3300032002 Bacteria 4390
244 Ga0307414_10116885 3300032004 Bacteria 2042
245 Ga0307414_10140135 3300032004 Bacteria 1892
246 Ga0373948_0044341 3300034817 Bacteria 940
247 Ga0373950_0133409 3300034818 Bacteria 558
248 Ga0373928_0018535 3300035084 Bacteria 1443
249 Ga0373929_0054064 3300035085 Bacteria 924
250 Ga0373951_0113344 3300035091 Bacteria 732
251 Ga0373923_0426870 3300035111 Bacteria 641
252 Ga0373932_0036069 3300035112 Bacteria 1402
253 Ga0373939_0026098 3300035114 Bacteria 1644
254 Ga0373941_0002351 3300035115 Bacteria 4150
255 Ga0373945_0105604 3300035116 Bacteria 1107
256 Ga0373960_0038531 3300035121 Bacteria 1370
257 Ga0373943_0176050 3300035170 Bacteria 1173
258 Ga0373946_0092203 3300035171 Bacteria 1344
259 Ga0373942_0039573 3300035207 Bacteria 1283
260 Ga0373961_0010227 3300035241 Bacteria 2308
261 Ga0373962_0002951 3300035242 Bacteria 4081
262 Ga0373931_0003666 3300035691 Bacteria 6944
263 Ga0373935_0097113 3300035692 Bacteria 1937
264 Ga0373927_0142429 3300035695 Bacteria 1568
265 Ga0373947_0116463 3300035725 Bacteria 1694
266 Ga0439438_000008 3300041405 Bacteria 178072
267 Ga0439438_000186 3300041405 Bacteria 27822
268 Ga0439438_000263 3300041405 Bacteria 23508
269 Ga0439438_004688 3300041405 Bacteria 5189
270 Ga0439447_000059 3300041407 Bacteria 38399
271 Ga0439447_000518 3300041407 Bacteria 14295
272 Ga0439447_001639 3300041407 Bacteria 8210
273 Ga0439447_002371 3300041407 Bacteria 6885
274 Ga0439447_004319 3300041407 Bacteria 4921
275 Ga0439447_008309 3300041407 Bacteria 3223
276 Ga0439447_014819 3300041407 Bacteria 2176
277 Ga0439466_0000208 3300041411 Bacteria 23209
278 Ga0439466_0000324 3300041411 Bacteria 18343
279 Ga0439466_0001870 3300041411 Bacteria 8239
280 Ga0439466_0002995 3300041411 Bacteria 6591
281 Ga0439466_0010687 3300041411 Bacteria 3410
282 Ga0439466_0052458 3300041411 Bacteria 1333
283 Ga0439466_0108390 3300041411 Bacteria 862
284 Ga0439466_0180631 3300041411 Bacteria 643
285 Ga0439465_0210734 3300041413 Bacteria 710
286 Ga0451791_1855958 3300041451 Bacteria 1068
287 Ga0451795_0134650 3300041456 Bacteria 546
288 Ga0451833_1493046 3300041491 Bacteria 730
289 Ga0439431_0000006 3300041997 Bacteria 41057
290 Ga0439445_0010886 3300042004 Bacteria 2160
291 Ga0439432_000189 3300042006 Bacteria 21998
292 Ga0439432_002172 3300042006 Bacteria 7400
293 Ga0439432_004118 3300042006 Bacteria 5314
294 Ga0439432_038751 3300042006 Bacteria 1517
295 Ga0439451_001083 3300042009 Bacteria 5317
296 Ga0439451_002714 3300042009 Bacteria 3593
297 Ga0439452_000253 3300042010 Bacteria 36669
298 Ga0439452_000674 3300042010 Bacteria 16810
299 Ga0439452_001028 3300042010 Bacteria 12348
300 Ga0439452_001344 3300042010 Bacteria 10253
301 Ga0439456_000526 3300042013 Bacteria 8160
302 Ga0439456_001325 3300042013 Bacteria 4942
303 Ga0439456_001725 3300042013 Bacteria 4409
304 Ga0439456_043549 3300042013 Bacteria 976
305 Ga0439456_058855 3300042013 Bacteria 843
306 Ga0439463_002428 3300042016 Bacteria 4749
307 Ga0439463_024801 3300042016 Bacteria 1503
308 Ga0450911_000009 3300042115 Bacteria 162968
309 Ga0450911_003941 3300042115 Bacteria 2507
310 Ga0450897_001266 3300042128 Bacteria 1683
311 Ga0450894_001394 3300042131 Bacteria 3493
312 Ga0450898_001209 3300042134 Bacteria 3336
313 Ga0450902_027869 3300042137 Bacteria 947
314 Ga0450904_000480 3300042139 Bacteria 7829
315 Ga0450907_000003 3300042146 Bacteria 138102
316 Ga0450907_000187 3300042146 Bacteria 22632
317 Ga0450907_010268 3300042146 Bacteria 1554
318 Ga0450910_000195 3300042147 Bacteria 6700
319 Ga0439446_0000420 3300042156 Bacteria 8284
320 Ga0439446_0013445 3300042156 Bacteria 2246
321 Ga0450909_000681 3300042185 Bacteria 4537
322 Ga0439434_0000019 3300042435 Bacteria 41172
323 Ga0439434_0040467 3300042435 Bacteria 1431
324 Ga0450901_002242 3300042533 Bacteria 2119
325 Ga0439440_0003448 3300042993 Bacteria 3044
326 Ga0495617_000024 3300046452 Bacteria 174402
327 Ga0495617_002558 3300046452 Bacteria 7175
328 Ga0495617_006193 3300046452 Bacteria 4209
329 Ga0495617_064083 3300046452 Bacteria 1213
330 Ga0495617_067476 3300046452 Bacteria 1178
331 Ga0495617_075218 3300046452 Bacteria 1108
332 Ga0495627_004795 3300046453 Bacteria 5588
333 Ga0495627_020253 3300046453 Bacteria 2219
334 Ga0495627_035217 3300046453 Bacteria 1561
335 Ga0495603_0000535 3300046455 Bacteria 21117
336 Ga0495603_0354944 3300046455 Bacteria 841
337 Ga0495590_0003530 3300046457 Bacteria 6374
338 Ga0495590_0077647 3300046457 Bacteria 1168
339 Ga0495590_0104061 3300046457 Bacteria 1010
340 Ga0495591_000054 3300046458 Bacteria 135364
341 Ga0495591_000055 3300046458 Bacteria 135355
342 Ga0495591_001528 3300046458 Bacteria 14219
343 Ga0495591_001589 3300046458 Bacteria 13759
344 Ga0495591_003342 3300046458 Bacteria 8335
345 Ga0495591_003749 3300046458 Bacteria 7682
346 Ga0495591_005366 3300046458 Bacteria 5954
347 Ga0495591_007279 3300046458 Bacteria 4734
348 Ga0495629_0290941 3300046459 Bacteria 1120
349 Ga0495629_0672281 3300046459 Bacteria 689
350 Ga0495638_0001316 3300046460 Bacteria 22896
351 Ga0495638_0005377 3300046460 Bacteria 9547
352 Ga0495638_0015276 3300046460 Bacteria 5158
353 Ga0495638_0031710 3300046460 Bacteria 3394
354 Ga0495653_0011626 3300046463 Bacteria 7186
355 Ga0495653_0019616 3300046463 Bacteria 5483
356 Ga0495650_0000052 3300046471 Bacteria 318176
357 Ga0495650_0000632 3300046471 Bacteria 47322
358 Ga0495650_0000775 3300046471 Bacteria 39396
359 Ga0495650_0001762 3300046471 Bacteria 19648
360 Ga0495650_0002438 3300046471 Bacteria 15060
361 Ga0495650_0003367 3300046471 Bacteria 11722
362 Ga0495650_0007323 3300046471 Bacteria 6654
363 Ga0495650_0082378 3300046471 Bacteria 1238
364 Ga0495605_0000002 3300046474 Bacteria 522417
365 Ga0495605_0000006 3300046474 Bacteria 361304
366 Ga0495605_0000257 3300046474 Bacteria 62503
367 Ga0495605_0002034 3300046474 Bacteria 12759
368 Ga0495605_0005581 3300046474 Bacteria 7316
369 Ga0495605_0006241 3300046474 Bacteria 6871
370 Ga0495605_0015217 3300046474 Bacteria 4191
371 Ga0495605_0162357 3300046474 Bacteria 991
372 Ga0495639_0296621 3300046475 Bacteria 805
373 Ga0495584_0011786 3300046491 Bacteria 4470
374 Ga0495584_0044274 3300046491 Bacteria 2246
375 Ga0495584_0046508 3300046491 Bacteria 2189
376 Ga0495584_0073708 3300046491 Bacteria 1715
377 Ga0495584_0258040 3300046491 Bacteria 886
378 Ga0495585_0000047 3300046492 Bacteria 120650
379 Ga0495585_0001935 3300046492 Bacteria 15481
380 Ga0495585_0011595 3300046492 Bacteria 5212
381 Ga0495585_0020632 3300046492 Bacteria 3788
382 Ga0495594_0003396 3300046499 Bacteria 8225
383 Ga0495596_0017635 3300046500 Bacteria 2953
384 Ga0495596_0021759 3300046500 Bacteria 2614
385 Ga0495596_0067160 3300046500 Bacteria 1394
386 Ga0495607_0001046 3300046501 Bacteria 25267
387 Ga0495607_0001263 3300046501 Bacteria 22608
388 Ga0495607_0004807 3300046501 Bacteria 9853
389 Ga0495607_0009595 3300046501 Bacteria 6541
390 Ga0495607_0013946 3300046501 Bacteria 5249
391 Ga0495607_0030474 3300046501 Bacteria 3312
392 Ga0495607_0037709 3300046501 Bacteria 2901
393 Ga0495607_0078121 3300046501 Bacteria 1826
394 Ga0495607_0095300 3300046501 Bacteria 1604
395 Ga0495607_0116804 3300046501 Bacteria 1406
396 Ga0495607_0188671 3300046501 Bacteria 1028
397 Ga0495607_0258190 3300046501 Bacteria 835
398 Ga0495607_0288418 3300046501 Bacteria 776
399 Ga0495583_0000012 3300046506 Bacteria 324839
400 Ga0495583_0006122 3300046506 Bacteria 7936
401 Ga0495583_0177279 3300046506 Bacteria 873
402 Ga0495583_0349408 3300046506 Bacteria 584
403 Ga0495606_0000207 3300046507 Bacteria 103669
404 Ga0495606_0000477 3300046507 Bacteria 65883
405 Ga0495606_0000577 3300046507 Bacteria 58248
406 Ga0495606_0009283 3300046507 Bacteria 8346
407 Ga0495606_0011103 3300046507 Bacteria 7387
408 Ga0495606_0011915 3300046507 Bacteria 7033
409 Ga0495606_0014035 3300046507 Bacteria 6279
410 Ga0495606_0047981 3300046507 Bacteria 2813
411 Ga0495606_0051281 3300046507 Bacteria 2692
412 Ga0495606_0086581 3300046507 Bacteria 1936
413 Ga0495606_0245498 3300046507 Bacteria 996
414 Ga0495610_0000209 3300046512 Bacteria 64342
415 Ga0495610_0003616 3300046512 Bacteria 11929
416 Ga0495610_0011838 3300046512 Bacteria 5300
417 Ga0495610_0021129 3300046512 Bacteria 3586
418 Ga0495610_0027234 3300046512 Bacteria 3040
419 Ga0495610_0048608 3300046512 Bacteria 2081
420 Ga0495610_0204110 3300046512 Bacteria 807
421 Ga0495616_0000430 3300046513 Bacteria 32094
422 Ga0495616_0000655 3300046513 Bacteria 25722
423 Ga0495616_0021707 3300046513 Bacteria 3472
424 Ga0495616_0048208 3300046513 Bacteria 2141
425 Ga0495616_0106851 3300046513 Bacteria 1305
426 Ga0495616_0143594 3300046513 Bacteria 1085
427 Ga0495620_0000010 3300046515 Bacteria 173604
428 Ga0495620_0000029 3300046515 Bacteria 122326
429 Ga0495620_0000137 3300046515 Bacteria 59671
430 Ga0495620_0000484 3300046515 Bacteria 25815
431 Ga0495620_0000843 3300046515 Bacteria 18930
432 Ga0495620_0001400 3300046515 Bacteria 14475
433 Ga0495620_0006940 3300046515 Bacteria 6187
434 Ga0495620_0026310 3300046515 Bacteria 2738
435 Ga0495620_0073257 3300046515 Bacteria 1396
436 Ga0495620_0266708 3300046515 Bacteria 652
437 Ga0495630_0004914 3300046517 Bacteria 9395
438 Ga0495631_0000239 3300046518 Bacteria 37813
439 Ga0495631_0003091 3300046518 Bacteria 9175
440 Ga0495631_0006776 3300046518 Bacteria 5881
441 Ga0495631_0026174 3300046518 Bacteria 2682
442 Ga0495631_0026452 3300046518 Bacteria 2664
443 Ga0495631_0109452 3300046518 Bacteria 1188
444 Ga0495631_0143185 3300046518 Bacteria 1026
445 Ga0495632_0000755 3300046519 Bacteria 29084
446 Ga0495632_0015196 3300046519 Bacteria 4327
447 Ga0495632_0015916 3300046519 Bacteria 4199
448 Ga0495632_0024893 3300046519 Bacteria 3173
449 Ga0495632_0059685 3300046519 Bacteria 1855
450 Ga0495632_0065486 3300046519 Bacteria 1755
451 Ga0495632_0094516 3300046519 Bacteria 1414
452 Ga0495632_0210056 3300046519 Bacteria 883
453 Ga0495637_0000077 3300046520 Bacteria 78543
454 Ga0495637_0000098 3300046520 Bacteria 66534
455 Ga0495637_0005725 3300046520 Bacteria 6299
456 Ga0495637_0006993 3300046520 Bacteria 5621
457 Ga0495637_0038311 3300046520 Bacteria 2076
458 Ga0495637_0059306 3300046520 Bacteria 1575
459 Ga0495637_0249705 3300046520 Bacteria 639
460 Ga0495643_0000345 3300046522 Bacteria 63090
461 Ga0495643_0001038 3300046522 Bacteria 28173
462 Ga0495643_0008035 3300046522 Bacteria 6727
463 Ga0495643_0012951 3300046522 Bacteria 5012
464 Ga0495643_0014006 3300046522 Bacteria 4781
465 Ga0495643_0018458 3300046522 Bacteria 4053
466 Ga0495643_0245524 3300046522 Bacteria 838
467 Ga0495644_0196336 3300046523 Bacteria 777
468 Ga0495644_0254488 3300046523 Bacteria 682
469 Ga0495644_0278501 3300046523 Bacteria 652
470 Ga0495644_0412284 3300046523 Bacteria 535
471 Ga0495648_0001842 3300046524 Bacteria 20345
472 Ga0495648_0002821 3300046524 Bacteria 15628
473 Ga0495648_0004200 3300046524 Bacteria 12370
474 Ga0495648_0005523 3300046524 Bacteria 10492
475 Ga0495648_0012291 3300046524 Bacteria 6394
476 Ga0495648_0030708 3300046524 Bacteria 3549
477 Ga0495648_0076217 3300046524 Bacteria 1926
478 Ga0495663_0144567 3300046525 Bacteria 809
479 Ga0495666_0007013 3300046526 Bacteria 5659
480 Ga0495666_0028597 3300046526 Bacteria 2743
481 Ga0495666_0373932 3300046526 Bacteria 641
482 Ga0495642_0001167 3300046528 Bacteria 12052
483 Ga0495654_0000897 3300046530 Bacteria 22238
484 Ga0495654_0001265 3300046530 Bacteria 17803
485 Ga0495654_0001437 3300046530 Bacteria 16377
486 Ga0495654_0005810 3300046530 Bacteria 7110
487 Ga0495654_0010281 3300046530 Bacteria 5095
488 Ga0495654_0017995 3300046530 Bacteria 3707
489 Ga0495654_0018015 3300046530 Bacteria 3704
490 Ga0495654_0018398 3300046530 Bacteria 3662
491 Ga0495654_0023888 3300046530 Bacteria 3163
492 Ga0495587_0000190 3300046536 Bacteria 45240
493 Ga0495587_0068285 3300046536 Bacteria 2070
494 Ga0495598_0180265 3300046537 Bacteria 753
495 Ga0495609_0000008 3300046538 Bacteria 383025
496 Ga0495609_0000014 3300046538 Bacteria 326023
497 Ga0495609_0000188 3300046538 Bacteria 61830
498 Ga0495609_0000534 3300046538 Bacteria 30280
499 Ga0495609_0009645 3300046538 Bacteria 4662
500 Ga0495609_0219709 3300046538 Bacteria 789
501 Ga0495597_0000061 3300046542 Bacteria 92012
502 Ga0495597_0000269 3300046542 Bacteria 47594
503 Ga0495597_0030227 3300046542 Bacteria 2469
504 Ga0495597_0099287 3300046542 Bacteria 1229
505 Ga0495597_0268678 3300046542 Bacteria 666
506 Ga0495622_0000003 3300046557 Bacteria 268681
507 Ga0495622_0000367 3300046557 Bacteria 31492
508 Ga0495622_0012670 3300046557 Bacteria 3908
509 Ga0495622_0089635 3300046557 Bacteria 1413
510 Ga0495622_0116695 3300046557 Bacteria 1220
511 Ga0495633_0000009 3300046558 Bacteria 293183
512 Ga0495633_0000278 3300046558 Bacteria 59112
513 Ga0495633_0031492 3300046558 Bacteria 2570
514 Ga0495656_0025230 3300046615 Bacteria 2355
515 Ga0495668_0004899 3300046616 Bacteria 9292
516 Ga0495668_0014521 3300046616 Bacteria 4614
517 Ga0495668_0021456 3300046616 Bacteria 3703
518 Ga0495668_0187839 3300046616 Bacteria 1131
519 Ga0495668_0231348 3300046616 Bacteria 1012
520 Ga0495634_0001714 3300046642 Bacteria 19026
521 Ga0495611_0000862 3300046648 Bacteria 16628
522 Ga0495611_0002339 3300046648 Bacteria 8740
523 Ga0495611_0008181 3300046648 Bacteria 4436
524 Ga0495611_0009279 3300046648 Bacteria 4153
525 Ga0495611_0020467 3300046648 Bacteria 2848
526 Ga0495611_0046899 3300046648 Bacteria 1938
527 Ga0495625_0000004 3300046660 Bacteria 611314
528 Ga0495625_0001992 3300046660 Bacteria 23058
529 Ga0495625_0014183 3300046660 Bacteria 6372
530 Ga0495625_0035565 3300046660 Bacteria 3670
531 Ga0495625_0189495 3300046660 Bacteria 1363
532 Ga0495625_0436228 3300046660 Bacteria 812
533 Ga0495625_0753640 3300046660 Bacteria 570
534 Ga0495635_0000350 3300046663 Bacteria 29321
535 Ga0495659_0319614 3300046664 Bacteria 659
536 Ga0495661_0000029 3300046665 Bacteria 173899
537 Ga0495661_0001443 3300046665 Bacteria 19884
538 Ga0495661_0003921 3300046665 Bacteria 10865
539 Ga0495661_0007584 3300046665 Bacteria 7562
540 Ga0495661_0015812 3300046665 Bacteria 5025
541 Ga0495661_0043197 3300046665 Bacteria 2772
542 Ga0495661_0054378 3300046665 Bacteria 2403
543 Ga0495661_0072228 3300046665 Bacteria 2013
544 Ga0495588_0075663 3300046674 Bacteria 1754
545 Ga0495588_0220681 3300046674 Bacteria 1001
546 Ga0495646_0000790 3300046680 Bacteria 17703
547 Ga0495669_0000708 3300046684 Bacteria 14522
548 Ga0495669_0543667 3300046684 Bacteria 565
549 Ga0495669_0606626 3300046684 Bacteria 532
550 Ga0495624_0038386 3300046690 Bacteria 3077
551 Ga0495670_0015653 3300046691 Bacteria 3727
552 Ga0495670_0017504 3300046691 Bacteria 3526
553 Ga0495670_0025997 3300046691 Bacteria 2898
554 Ga0495670_0071423 3300046691 Bacteria 1757
555 Ga0495670_0116656 3300046691 Bacteria 1385
556 Ga0495670_0195726 3300046691 Bacteria 1069
557 Ga0495671_0000397 3300046692 Bacteria 35515
558 Ga0495671_0001790 3300046692 Bacteria 13904
559 Ga0495671_0003980 3300046692 Bacteria 8936
560 Ga0495671_0011517 3300046692 Bacteria 4859
561 Ga0495671_0013827 3300046692 Bacteria 4356
562 Ga0495671_0030327 3300046692 Bacteria 2770
563 Ga0495671_0053127 3300046692 Bacteria 2012
564 Ga0495671_0181488 3300046692 Bacteria 1022
565 Ga0495649_0000081 3300046694 Bacteria 82700
566 Ga0495649_0006509 3300046694 Bacteria 7267
567 Ga0495649_0041448 3300046694 Bacteria 2518
568 Ga0495649_0058857 3300046694 Bacteria 2069
569 Ga0495589_0000251 3300046794 Bacteria 43879
570 Ga0495589_0006350 3300046794 Bacteria 6242
571 Ga0495589_0047098 3300046794 Bacteria 2137
572 Ga0495589_0098173 3300046794 Bacteria 1419
573 Ga0495660_0000006 3300046810 Bacteria 571713
574 Ga0495660_0000052 3300046810 Bacteria 137821
575 Ga0495660_0000148 3300046810 Bacteria 76297
576 Ga0495660_0001102 3300046810 Bacteria 19296
577 Ga0495660_0001450 3300046810 Bacteria 16216
578 Ga0495660_0002640 3300046810 Bacteria 11375
579 Ga0495660_0002969 3300046810 Bacteria 10603
580 Ga0495660_0003761 3300046810 Bacteria 9309
581 Ga0495660_0004153 3300046810 Bacteria 8812
582 Ga0495660_0028324 3300046810 Bacteria 3166
583 Ga0495660_0070439 3300046810 Bacteria 1856
584 Ga0495660_0159048 3300046810 Bacteria 1109
585 Ga0495604_0041768 3300047317 Bacteria 3596
586 Ga0495672_0000407 3300047320 Bacteria 52187
587 Ga0495672_0003314 3300047320 Bacteria 13917
588 Ga0495672_0010278 3300047320 Bacteria 6686
589 Ga0495672_0065591 3300047320 Bacteria 2075
590 Ga0495680_0079938 3300047322 Bacteria 2471
591 Ga0495683_0000033 3300047323 Bacteria 149031
592 Ga0495683_0000042 3300047323 Bacteria 137528
593 Ga0495683_0003014 3300047323 Bacteria 9925
594 Ga0495683_0037337 3300047323 Bacteria 2463
595 Ga0495683_0150885 3300047323 Bacteria 1082
596 Ga0495683_0161786 3300047323 Bacteria 1035
597 Ga0495683_0475347 3300047323 Bacteria 510
598 Ga0495675_0008889 3300047444 Bacteria 6240
599 Ga0495677_0071032 3300047445 Bacteria 1297
600 Ga0495677_0329765 3300047445 Bacteria 601
601 Ga0495679_000015 3300047446 Bacteria 287256
602 Ga0495679_000060 3300047446 Bacteria 109240
603 Ga0495679_001075 3300047446 Bacteria 16546
604 Ga0495679_002354 3300047446 Bacteria 9691
605 Ga0495679_004740 3300047446 Bacteria 6172
606 Ga0495673_0000036 3300047469 Bacteria 311035
607 Ga0495673_0000300 3300047469 Bacteria 66221
608 Ga0495673_0000525 3300047469 Bacteria 40095
609 Ga0495673_0002620 3300047469 Bacteria 12469
610 Ga0495673_0002993 3300047469 Bacteria 11385
611 Ga0495673_0003465 3300047469 Bacteria 10383
612 Ga0495673_0007028 3300047469 Bacteria 6534
613 Ga0495673_0009795 3300047469 Bacteria 5267
614 Ga0495673_0018360 3300047469 Bacteria 3528
615 Ga0495673_0023211 3300047469 Bacteria 3023
616 Ga0495673_0039676 3300047469 Bacteria 2134
617 Ga0495673_0051764 3300047469 Bacteria 1797
618 Ga0495673_0056862 3300047469 Bacteria 1690
619 Ga0495673_0060999 3300047469 Bacteria 1616
620 Ga0495673_0122618 3300047469 Bacteria 1028
621 Ga0495681_0000768 3300047470 Bacteria 24709
622 Ga0495681_0001769 3300047470 Bacteria 15908
623 Ga0495681_0041668 3300047470 Bacteria 2228
624 Ga0495681_0226062 3300047470 Bacteria 748
625 Ga0495681_0253499 3300047470 Bacteria 694
626 Ga0495684_0038169 3300047471 Bacteria 3683
627 Ga0495686_0000708 3300047472 Bacteria 44947
628 Ga0495686_0004371 3300047472 Bacteria 11662
629 Ga0495686_0046828 3300047472 Bacteria 2732
630 Ga0495686_0587285 3300047472 Bacteria 578
631 Ga0495593_0009302 3300047673 Bacteria 5702
632 Ga0495615_0169726 3300048090 Bacteria 659
633 Ga0495626_0000012 3300048091 Bacteria 258483
634 Ga0495626_0001745 3300048091 Bacteria 16582
635 Ga0495626_0174777 3300048091 Bacteria 893
636 Ga0495626_0220184 3300048091 Bacteria 771
637 Ga0496100_0033443 3300048903 Unclassified 3217
638 Ga0496101_0005620 3300048904 Bacteria 7995
639 Ga0496102_0000821 3300048905 Bacteria 30135
640 Ga0496102_0002660 3300048905 Bacteria 15200
641 Ga0496102_0740281 3300048905 Bacteria 906
642 Ga0496102_1513441 3300048905 Bacteria 590
643 Ga0496103_0002064 3300048906 Bacteria 12847
644 Ga0496103_0003108 3300048906 Bacteria 10204
645 Ga0496104_0011249 3300048907 Bacteria 8008
646 Ga0496106_0001032 3300048909 Bacteria 20508
647 Ga0496106_0006041 3300048909 Bacteria 8964
648 Ga0496107_0171409 3300048910 Bacteria 1610
649 Ga0496110_1060037 3300048913 Bacteria 718
650 Ga0496114_0038162 3300048917 Bacteria 3974
651 Ga0496114_0344161 3300048917 Bacteria 1318
652 Ga0496115_0210434 3300048918 Bacteria 1606
653 Ga0496115_0735125 3300048918 Bacteria 773
654 Ga0496116_0000020 3300048919 Bacteria 501307
655 Ga0496116_0011895 3300048919 Bacteria 7159
656 Ga0496116_0150413 3300048919 Bacteria 1294
657 Ga0496117_0000246 3300048920 Bacteria 102783
658 Ga0496117_0001151 3300048920 Bacteria 39820
659 Ga0496117_0008832 3300048920 Bacteria 9507
660 Ga0496117_0265579 3300048920 Bacteria 927
661 Ga0496118_0003083 3300048921 Bacteria 21369
662 Ga0496118_0041846 3300048921 Bacteria 3621
663 Ga0496118_0348059 3300048921 Bacteria 791
664 Ga0496119_0015131 3300048922 Bacteria 5971
665 Ga0496119_0019254 3300048922 Bacteria 5037
666 Ga0496120_0001430 3300048923 Bacteria 28786
667 Ga0496120_0007714 3300048923 Bacteria 7965
668 Ga0496121_0000782 3300048924 Bacteria 58365
669 Ga0496121_0024059 3300048924 Bacteria 5836
670 Ga0496121_0037696 3300048924 Bacteria 4290
671 Ga0496121_0042734 3300048924 Bacteria 3937
672 Ga0496121_0047827 3300048924 Bacteria 3645
673 Ga0496121_0112158 3300048924 Bacteria 2078
674 Ga0496121_0192598 3300048924 Bacteria 1460
675 Ga0496121_0238564 3300048924 Bacteria 1269
676 Ga0496122_0000010 3300048925 Bacteria 547417
677 Ga0496122_0016615 3300048925 Bacteria 6945
678 Ga0496123_0000025 3300048926 Bacteria 323956
679 Ga0496123_0006592 3300048926 Bacteria 11212
680 Ga0496124_0000084 3300048927 Bacteria 204993
681 Ga0496124_0001319 3300048927 Bacteria 37386
682 Ga0496124_0024406 3300048927 Bacteria 5497
683 Ga0496124_0034155 3300048927 Bacteria 4467
684 Ga0496124_0069717 3300048927 Bacteria 2918
685 Ga0496124_0076475 3300048927 Bacteria 2763
686 Ga0496125_0000071 3300048928 Bacteria 243580
687 Ga0496125_0001337 3300048928 Bacteria 36347
688 Ga0496125_0083021 3300048928 Bacteria 2439
689 Ga0496125_0403803 3300048928 Bacteria 797
690 Ga0496125_0468744 3300048928 Bacteria 717
691 Ga0496126_0042934 3300048929 Bacteria 4174
692 Ga0496126_0049632 3300048929 Bacteria 3829
693 Ga0496126_0305398 3300048929 Bacteria 1311
694 Ga0496126_0480541 3300048929 Bacteria 995
695 Ga0495678_000011 3300049459 Bacteria 335512
696 Ga0495678_000052 3300049459 Bacteria 157731
697 Ga0495678_003094 3300049459 Bacteria 10546
698 Ga0495678_003321 3300049459 Bacteria 10029
699 Ga0495678_003781 3300049459 Bacteria 9134
700 Ga0495678_013815 3300049459 Bacteria 3779
701 Ga0495678_182866 3300049459 Bacteria 656
702 Ga0495682_0000073 3300049460 Bacteria 92060
703 Ga0495682_0000542 3300049460 Bacteria 26108
704 Ga0495682_0008714 3300049460 Bacteria 3992
705 Ga0495682_0035451 3300049460 Bacteria 1838
706 nmdc:mga03683_3_c1 3300050489 Bacteria 285872
707 nmdc:mga03n38_250728_c1 3300050490 Bacteria 935
708 nmdc:mga00v17_741837_c1 3300050491 Bacteria 628
709 nmdc:mga0yw44_100328_c1 3300050492 Bacteria 1843
710 nmdc:mga0k408_2_c1 3300050493 Bacteria 395671
711 nmdc:mga0sz30_162_c1 3300050516 Bacteria 24511
712 Ga0500643_003161 3300053087 Bacteria 8051
713 Ga0500647_0086977 3300053091 Bacteria 1498
714 Ga0500572_154950 3300053111 Bacteria 749
715 Ga0500607_008676 3300053121 Bacteria 6160
716 Ga0500618_000087 3300053125 Bacteria 75294
717 Ga0500618_000095 3300053125 Bacteria 72432
718 Ga0500573_0329255 3300053140 Bacteria 751
719 Ga0500586_229215 3300053145 Bacteria 594
720 Ga0500589_091940 3300053147 Bacteria 1334
721 Ga0500616_0411022 3300053153 Bacteria 539
722 Ga0500627_0126076 3300053158 Bacteria 1156
723 Ga0500625_026844 3300053729 Bacteria 2729
724 Ga0500645_025607 3300053730 Bacteria 1799
725 Ga0500596_016113 3300053735 Bacteria 1123
726 Ga0500596_031575 3300053735 Bacteria 823

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10064142 JGI24739J22299_100641422 128
2 3300002075 JGI24738J21930_10005840 JGI24738J21930_100058402 128
3 3300002077 JGI24744J21845_10002652 JGI24744J21845_100026522 128
4 3300005330 Ga0070690_100038790 Ga0070690_1000387902 128
5 3300005334 Ga0068869_100010287 Ga0068869_1000102874 128
6 3300005335 Ga0070666_10197535 Ga0070666_101975352 128
7 3300005336 Ga0070680_100240017 Ga0070680_1002400172 128
8 3300005337 Ga0070682_100044718 Ga0070682_1000447183 128
9 3300005338 Ga0068868_100004689 Ga0068868_1000046892 128
10 3300005339 Ga0070660_100029000 Ga0070660_1000290005 128
11 3300005340 Ga0070689_100019874 Ga0070689_1000198747 128
12 3300005341 Ga0070691_10006182 Ga0070691_100061822 128
13 3300005343 Ga0070687_100011551 Ga0070687_1000115512 128
14 3300005345 Ga0070692_10358177 Ga0070692_103581772 128
15 3300005347 Ga0070668_100120512 Ga0070668_1001205123 128
16 3300005353 Ga0070669_100021971 Ga0070669_1000219716 128
17 3300005354 Ga0070675_101755630 Ga0070675_1017556301 128
18 3300005355 Ga0070671_100085463 Ga0070671_1000854632 128
19 3300005364 Ga0070673_100242496 Ga0070673_1002424963 128
20 3300005365 Ga0070688_100063907 Ga0070688_1000639073 128
21 3300005366 Ga0070659_100030764 Ga0070659_1000307643 128
22 3300005367 Ga0070667_100000794 Ga0070667_10000079419 128
23 3300005434 Ga0070709_10005916 Ga0070709_100059166 128
24 3300005435 Ga0070714_100403384 Ga0070714_1004033841 128
25 3300005437 Ga0070710_10100630 Ga0070710_101006303 128
26 3300005438 Ga0070701_10004576 Ga0070701_100045766 128
27 3300005439 Ga0070711_100192768 Ga0070711_1001927683 128
28 3300005440 Ga0070705_100037004 Ga0070705_1000370043 128
29 3300005441 Ga0070700_100002695 Ga0070700_1000026954 128
30 3300005444 Ga0070694_100003295 Ga0070694_1000032952 128
31 3300005455 Ga0070663_100176515 Ga0070663_1001765153 128
32 3300005456 Ga0070678_100008828 Ga0070678_1000088282 128
33 3300005457 Ga0070662_100239877 Ga0070662_1002398772 128
34 3300005459 Ga0068867_100047479 Ga0068867_1000474794 128
35 3300005466 Ga0070685_10156918 Ga0070685_101569183 128
36 3300005467 Ga0070706_101306245 Ga0070706_1013062451 128
37 3300005530 Ga0070679_100386165 Ga0070679_1003861652 128
38 3300005536 Ga0070697_100060684 Ga0070697_1000606842 128
39 3300005539 Ga0068853_100080626 Ga0068853_1000806264 128
40 3300005544 Ga0070686_100038219 Ga0070686_1000382194 128
41 3300005545 Ga0070695_100001855 Ga0070695_10000185511 128
42 3300005546 Ga0070696_100075923 Ga0070696_1000759232 128
43 3300005547 Ga0070693_100042155 Ga0070693_1000421552 128
44 3300005548 Ga0070665_100037045 Ga0070665_1000370457 128
45 3300005549 Ga0070704_100023719 Ga0070704_1000237193 128
46 3300005563 Ga0068855_100333596 Ga0068855_1003335962 128
47 3300005614 Ga0068856_100198181 Ga0068856_1001981813 128
48 3300005615 Ga0070702_100002761 Ga0070702_1000027614 128
49 3300005616 Ga0068852_100111989 Ga0068852_1001119895 128
50 3300005834 Ga0068851_10459988 Ga0068851_104599881 128
51 3300005842 Ga0068858_100063666 Ga0068858_1000636663 128
52 3300005843 Ga0068860_100049201 Ga0068860_1000492013 128
53 3300005844 Ga0068862_100003107 Ga0068862_1000031072 128
54 3300006163 Ga0070715_10044920 Ga0070715_100449203 128
55 3300006173 Ga0070716_100018247 Ga0070716_1000182472 128
56 3300006175 Ga0070712_100068290 Ga0070712_1000682903 128
57 3300006237 Ga0097621_100258302 Ga0097621_1002583023 128
58 3300006881 Ga0068865_100048976 Ga0068865_1000489763 128
59 3300009092 Ga0105250_10008431 Ga0105250_100084312 128
60 3300009093 Ga0105240_11466340 Ga0105240_114663401 128
61 3300009098 Ga0105245_10002500 Ga0105245_1000250015 128
62 3300009101 Ga0105247_10016195 Ga0105247_100161955 128
63 3300009148 Ga0105243_10130617 Ga0105243_101306173 128
64 3300009174 Ga0105241_10175486 Ga0105241_101754862 128
65 3300009176 Ga0105242_10009509 Ga0105242_100095092 128
66 3300009177 Ga0105248_10146596 Ga0105248_101465964 128
67 3300009545 Ga0105237_10022373 Ga0105237_100223732 128
68 3300009551 Ga0105238_10631853 Ga0105238_106318532 128
69 3300009553 Ga0105249_10014068 Ga0105249_100140682 128
70 3300010375 Ga0105239_10059356 Ga0105239_100593563 128
71 3300011119 Ga0105246_10267507 Ga0105246_102675073 128
72 3300013100 Ga0157373_10639381 Ga0157373_106393812 128
73 3300013105 Ga0157369_10217830 Ga0157369_102178301 128
74 3300013296 Ga0157374_10253610 Ga0157374_102536102 128
75 3300013297 Ga0157378_10159532 Ga0157378_101595323 128
76 3300013306 Ga0163162_10378602 Ga0163162_103786022 128
77 3300013307 Ga0157372_10003068 Ga0157372_1000306818 128
78 3300013308 Ga0157375_10001585 Ga0157375_1000158519 128
79 3300014326 Ga0157380_10007831 Ga0157380_100078313 128
80 3300014745 Ga0157377_10025444 Ga0157377_100254444 128
81 3300014968 Ga0157379_10001763 Ga0157379_1000176317 128
82 3300014969 Ga0157376_10043329 Ga0157376_100433293 128
83 3300017792 Ga0163161_10001211 Ga0163161_1000121119 128
84 3300025711 Ga0207696_1044933 Ga0207696_10449332 128
85 3300025885 Ga0207653_10025305 Ga0207653_100253052 128
86 3300025898 Ga0207692_10015153 Ga0207692_100151531 128
87 3300025900 Ga0207710_10089879 Ga0207710_100898793 128
88 3300025901 Ga0207688_10002669 Ga0207688_100026692 128
89 3300025903 Ga0207680_10249618 Ga0207680_102496182 128
90 3300025904 Ga0207647_10010922 Ga0207647_100109223 128
91 3300025906 Ga0207699_10067409 Ga0207699_100674092 128
92 3300025907 Ga0207645_10416088 Ga0207645_104160882 128
93 3300025911 Ga0207654_10093561 Ga0207654_100935612 128
94 3300025913 Ga0207695_11427946 Ga0207695_114279461 128
95 3300025915 Ga0207693_10006185 Ga0207693_100061853 128
96 3300025916 Ga0207663_10157710 Ga0207663_101577102 128
97 3300025919 Ga0207657_10213700 Ga0207657_102137003 128
98 3300025926 Ga0207659_11339754 Ga0207659_113397541 128
99 3300025927 Ga0207687_10011422 Ga0207687_100114228 128
100 3300025931 Ga0207644_10026605 Ga0207644_100266055 128
101 3300025932 Ga0207690_10200239 Ga0207690_102002392 128
102 3300025933 Ga0207706_10003200 Ga0207706_100032007 128
103 3300025934 Ga0207686_10027452 Ga0207686_100274521 128
104 3300025937 Ga0207669_10253153 Ga0207669_102531532 128
105 3300025938 Ga0207704_10001403 Ga0207704_1000140310 128
106 3300025942 Ga0207689_10016615 Ga0207689_100166156 128
107 3300025949 Ga0207667_10833486 Ga0207667_108334861 128
108 3300025961 Ga0207712_10054178 Ga0207712_100541783 128
109 3300025986 Ga0207658_10274952 Ga0207658_102749522 128
110 3300026023 Ga0207677_10174098 Ga0207677_101740983 128
111 3300026035 Ga0207703_10095813 Ga0207703_100958131 128
112 3300026041 Ga0207639_10173499 Ga0207639_101734993 128
113 3300026067 Ga0207678_10013359 Ga0207678_100133597 128
114 3300026075 Ga0207708_10000709 Ga0207708_1000070916 128
115 3300026089 Ga0207648_10003479 Ga0207648_100034796 128
116 3300026118 Ga0207675_100002920 Ga0207675_10000292016 128
117 3300026121 Ga0207683_10016343 Ga0207683_100163433 128
118 3300028379 Ga0268266_10490930 Ga0268266_104909302 128
119 3300028380 Ga0268265_10270481 Ga0268265_102704812 128
120 3300028381 Ga0268264_10098966 Ga0268264_100989663 128
121 3300034817 Ga0373948_0044341 Ga0373948_0044341_491_877 128
122 3300034818 Ga0373950_0133409 Ga0373950_0133409_97_483 128
123 3300035084 Ga0373928_0018535 Ga0373928_0018535_95_481 128
124 3300035085 Ga0373929_0054064 Ga0373929_0054064_370_756 128
125 3300035091 Ga0373951_0113344 Ga0373951_0113344_130_516 128
126 3300035112 Ga0373932_0036069 Ga0373932_0036069_915_1301 128
127 3300035114 Ga0373939_0026098 Ga0373939_0026098_304_690 128
128 3300035115 Ga0373941_0002351 Ga0373941_0002351_531_917 128
129 3300035121 Ga0373960_0038531 Ga0373960_0038531_549_935 128
130 3300035207 Ga0373942_0039573 Ga0373942_0039573_621_1007 128
131 3300035241 Ga0373961_0010227 Ga0373961_0010227_1540_1926 128
132 3300035242 Ga0373962_0002951 Ga0373962_0002951_493_879 128
133 3300035691 Ga0373931_0003666 Ga0373931_0003666_3928_4314 128
134 3300048903 Ga0496100_0033443 Ga0496100_0033443_202_588 128
135 3300048904 Ga0496101_0005620 Ga0496101_0005620_7228_7614 128
136 3300048905 Ga0496102_0002660 Ga0496102_0002660_1523_1909 128
137 3300048906 Ga0496103_0003108 Ga0496103_0003108_622_1008 128
138 3300048909 Ga0496106_0006041 Ga0496106_0006041_5102_5488 128
139 3300048910 Ga0496107_0171409 Ga0496107_0171409_214_600 128
140 3300048917 Ga0496114_0344161 Ga0496114_0344161_860_1246 128
141 3300048918 Ga0496115_0210434 Ga0496115_0210434_707_1093 128
142 iso_pu_bacteria 2738543012 2739246529 130
143 3300006178 Ga0075367_10119800 Ga0075367_101198002 131
144 3300006353 Ga0075370_10063904 Ga0075370_100639042 131
145 3300013102 Ga0157371_10168600 Ga0157371_101686002 131
146 3300013297 Ga0157378_11524596 Ga0157378_115245962 131
147 3300001978 JGI24747J21853_1009353 JGI24747J21853_10093532 132
148 3300002074 JGI24748J21848_1012606 JGI24748J21848_10126062 132
149 3300003320 rootH2_10016961 rootH2_100169612 132
150 3300005328 Ga0070676_10523544 Ga0070676_105235442 132
151 3300005406 Ga0070703_10033674 Ga0070703_100336743 132
152 3300005548 Ga0070665_100087338 Ga0070665_1000873384 132
153 3300005578 Ga0068854_100184291 Ga0068854_1001842911 132
154 3300005617 Ga0068859_100002434 Ga0068859_1000024343 132
155 3300005718 Ga0068866_10001034 Ga0068866_100010343 132
156 3300005719 Ga0068861_100174020 Ga0068861_1001740203 132
157 3300006931 Ga0097620_100002434 Ga0097620_1000024343 132
158 3300007788 Ga0099795_10007162 Ga0099795_100071624 132
159 3300014497 Ga0182008_10020924 Ga0182008_100209243 132
160 3300014497 Ga0182008_10384308 Ga0182008_103843081 132
161 3300025905 Ga0207685_10215763 Ga0207685_102157632 132
162 3300025918 Ga0207662_10147914 Ga0207662_101479144 132
163 3300025923 Ga0207681_10242241 Ga0207681_102422413 132
164 3300025924 Ga0207694_10504583 Ga0207694_105045832 132
165 3300025929 Ga0207664_10306464 Ga0207664_103064641 132
166 3300025935 Ga0207709_10224168 Ga0207709_102241683 132
167 3300025939 Ga0207665_10001697 Ga0207665_100016973 132
168 3300025941 Ga0207711_10035562 Ga0207711_100355625 132
169 3300025981 Ga0207640_10039103 Ga0207640_100391033 132
170 3300026078 Ga0207702_10836971 Ga0207702_108369711 132
171 3300031250 Ga0265331_10118347 Ga0265331_101183471 132
172 3300031344 Ga0265316_10451345 Ga0265316_104513451 132
173 3300031595 Ga0265313_10107084 Ga0265313_101070841 132
174 3300031712 Ga0265342_10038998 Ga0265342_100389983 132
175 3300032002 Ga0307416_100024736 Ga0307416_1000247366 132
176 3300032004 Ga0307414_10140135 Ga0307414_101401352 132
177 3300035111 Ga0373923_0426870 Ga0373923_0426870_222_620 132
178 3300035116 Ga0373945_0105604 Ga0373945_0105604_148_546 132
179 3300035170 Ga0373943_0176050 Ga0373943_0176050_348_746 132
180 3300035171 Ga0373946_0092203 Ga0373946_0092203_856_1254 132
181 3300035692 Ga0373935_0097113 Ga0373935_0097113_1497_1895 132
182 3300035695 Ga0373927_0142429 Ga0373927_0142429_154_552 132
183 3300035725 Ga0373947_0116463 Ga0373947_0116463_148_546 132
184 3300041451 Ga0451791_1855958 Ga0451791_1855958_239_643 132
185 3300042139 Ga0450904_000480 Ga0450904_000480_5189_5587 132
186 3300046474 Ga0495605_0000006 Ga0495605_0000006_30357_30755 132
187 3300046474 Ga0495605_0006241 Ga0495605_0006241_2079_2483 132
188 3300046492 Ga0495585_0001935 Ga0495585_0001935_13694_14098 132
189 3300046500 Ga0495596_0017635 Ga0495596_0017635_1318_1722 132
190 3300046501 Ga0495607_0095300 Ga0495607_0095300_323_721 132
191 3300046501 Ga0495607_0288418 Ga0495607_0288418_62_460 132
192 3300046506 Ga0495583_0006122 Ga0495583_0006122_2094_2492 132
193 3300046512 Ga0495610_0204110 Ga0495610_0204110_73_477 132
194 3300046513 Ga0495616_0106851 Ga0495616_0106851_440_844 132
195 3300046518 Ga0495631_0026452 Ga0495631_0026452_524_928 132
196 3300046519 Ga0495632_0000755 Ga0495632_0000755_6330_6734 132
197 3300046520 Ga0495637_0059306 Ga0495637_0059306_569_973 132
198 3300046522 Ga0495643_0018458 Ga0495643_0018458_1763_2161 132
199 3300046524 Ga0495648_0030708 Ga0495648_0030708_1654_2058 132
200 3300046528 Ga0495642_0001167 Ga0495642_0001167_5395_5799 132
201 3300046536 Ga0495587_0068285 Ga0495587_0068285_1234_1638 132
202 3300046616 Ga0495668_0231348 Ga0495668_0231348_80_484 132
203 3300046665 Ga0495661_0001443 Ga0495661_0001443_16399_16803 132
204 3300046674 Ga0495588_0075663 Ga0495588_0075663_762_1166 132
205 3300046684 Ga0495669_0000708 Ga0495669_0000708_3873_4277 132
206 3300046691 Ga0495670_0071423 Ga0495670_0071423_414_818 132
207 3300046794 Ga0495589_0047098 Ga0495589_0047098_1329_1733 132
208 3300047323 Ga0495683_0037337 Ga0495683_0037337_235_639 132
209 3300047445 Ga0495677_0329765 Ga0495677_0329765_125_529 132
210 3300053091 Ga0500647_0086977 Ga0500647_0086977_495_893 132
211 3300053121 Ga0500607_008676 Ga0500607_008676_3959_4357 132
212 3300053729 Ga0500625_026844 Ga0500625_026844_1134_1532 132
213 3300053735 Ga0500596_016113 Ga0500596_016113_684_1082 132
214 3300005289 Ga0065704_10131855 Ga0065704_101318552 133
215 3300005289 Ga0065704_10165426 Ga0065704_101654262 133
216 3300005344 Ga0070661_100022741 Ga0070661_1000227412 133
217 3300005468 Ga0070707_100004763 Ga0070707_1000047635 133
218 3300005471 Ga0070698_100286381 Ga0070698_1002863813 133
219 3300005471 Ga0070698_100685396 Ga0070698_1006853962 133
220 3300005536 Ga0070697_100069270 Ga0070697_1000692702 133
221 3300006051 Ga0075364_10004291 Ga0075364_100042915 133
222 3300006051 Ga0075364_10445885 Ga0075364_104458851 133
223 3300006177 Ga0075362_10000015 Ga0075362_1000001543 133
224 3300006186 Ga0075369_10000089 Ga0075369_1000008915 133
225 3300006195 Ga0075366_10000072 Ga0075366_1000007220 133
226 3300006914 Ga0075436_100377182 Ga0075436_1003771822 133
227 3300007265 Ga0099794_10697660 Ga0099794_106976601 133
228 3300007788 Ga0099795_10097734 Ga0099795_100977343 133
229 3300009036 Ga0105244_10039053 Ga0105244_100390532 133
230 3300009101 Ga0105247_10094556 Ga0105247_100945562 133
231 3300009148 Ga0105243_10186394 Ga0105243_101863943 133
232 3300010159 Ga0099796_10380729 Ga0099796_103807292 133
233 3300011119 Ga0105246_10000102 Ga0105246_1000010220 133
234 3300013102 Ga0157371_10013871 Ga0157371_100138715 133
235 3300013104 Ga0157370_10118720 Ga0157370_101187202 133
236 3300013105 Ga0157369_10002042 Ga0157369_1000204224 133
237 3300013296 Ga0157374_11315059 Ga0157374_113150592 133
238 3300013306 Ga0163162_10288082 Ga0163162_102880822 133
239 3300013307 Ga0157372_10073167 Ga0157372_100731674 133
240 3300013308 Ga0157375_10000819 Ga0157375_1000081925 133
241 3300013308 Ga0157375_10949221 Ga0157375_109492212 133
242 3300014497 Ga0182008_10024200 Ga0182008_100242003 133
243 3300014497 Ga0182008_10026807 Ga0182008_100268073 133
244 3300014497 Ga0182008_10583282 Ga0182008_105832821 133
245 3300015261 Ga0182006_1000066 Ga0182006_100006656 133
246 3300015261 Ga0182006_1005946 Ga0182006_10059465 133
247 3300015262 Ga0182007_10034208 Ga0182007_100342082 133
248 3300015265 Ga0182005_1001642 Ga0182005_100164210 133
249 3300015265 Ga0182005_1002721 Ga0182005_10027217 133
250 3300015265 Ga0182005_1108373 Ga0182005_11083732 133
251 3300015265 Ga0182005_1108553 Ga0182005_11085532 133
252 3300017792 Ga0163161_10056133 Ga0163161_100561332 133
253 3300025291 Ga0209675_1014477 Ga0209675_10144772 133
254 3300025294 Ga0209025_1057859 Ga0209025_10578592 133
255 3300025728 Ga0207655_1037207 Ga0207655_10372072 133
256 3300025900 Ga0207710_10077637 Ga0207710_100776372 133
257 3300025910 Ga0207684_10563400 Ga0207684_105634001 133
258 3300025919 Ga0207657_10729149 Ga0207657_107291491 133
259 3300025920 Ga0207649_10027626 Ga0207649_100276263 133
260 3300025922 Ga0207646_10052718 Ga0207646_100527185 133
261 3300025925 Ga0207650_10000241 Ga0207650_1000024124 133
262 3300026067 Ga0207678_10205900 Ga0207678_102059002 133
263 3300031239 Ga0265328_10006401 Ga0265328_100064014 133
264 3300031616 Ga0307508_10209678 Ga0307508_102096782 133
265 3300031731 Ga0307405_10000197 Ga0307405_1000019720 133
266 3300031824 Ga0307413_11626549 Ga0307413_116265492 133
267 3300031911 Ga0307412_10057221 Ga0307412_100572212 133
268 3300031911 Ga0307412_10209117 Ga0307412_102091173 133
269 3300031995 Ga0307409_100099415 Ga0307409_1000994152 133
270 3300032004 Ga0307414_10116885 Ga0307414_101168852 133
271 3300041405 Ga0439438_000008 Ga0439438_000008_170536_170937 133
272 3300041405 Ga0439438_000186 Ga0439438_000186_19899_20300 133
273 3300041405 Ga0439438_000263 Ga0439438_000263_21056_21457 133
274 3300041405 Ga0439438_004688 Ga0439438_004688_1726_2127 133
275 3300041407 Ga0439447_000059 Ga0439447_000059_22218_22619 133
276 3300041407 Ga0439447_000518 Ga0439447_000518_11705_12106 133
277 3300041407 Ga0439447_001639 Ga0439447_001639_5605_6006 133
278 3300041407 Ga0439447_002371 Ga0439447_002371_2021_2422 133
279 3300041407 Ga0439447_004319 Ga0439447_004319_2299_2700 133
280 3300041407 Ga0439447_008309 Ga0439447_008309_2569_2970 133
281 3300041407 Ga0439447_014819 Ga0439447_014819_512_913 133
282 3300041411 Ga0439466_0000208 Ga0439466_0000208_17605_18006 133
283 3300041411 Ga0439466_0000324 Ga0439466_0000324_16145_16546 133
284 3300041411 Ga0439466_0001870 Ga0439466_0001870_1143_1544 133
285 3300041411 Ga0439466_0002995 Ga0439466_0002995_2935_3336 133
286 3300041411 Ga0439466_0010687 Ga0439466_0010687_2047_2448 133
287 3300041411 Ga0439466_0052458 Ga0439466_0052458_383_784 133
288 3300041411 Ga0439466_0108390 Ga0439466_0108390_240_641 133
289 3300041411 Ga0439466_0180631 Ga0439466_0180631_192_593 133
290 3300041413 Ga0439465_0210734 Ga0439465_0210734_78_479 133
291 3300041456 Ga0451795_0134650 Ga0451795_0134650_28_429 133
292 3300041491 Ga0451833_1493046 Ga0451833_1493046_60_461 133
293 3300041997 Ga0439431_0000006 Ga0439431_0000006_15102_15503 133
294 3300042004 Ga0439445_0010886 Ga0439445_0010886_757_1158 133
295 3300042006 Ga0439432_000189 Ga0439432_000189_13238_13639 133
296 3300042006 Ga0439432_002172 Ga0439432_002172_3049_3450 133
297 3300042006 Ga0439432_004118 Ga0439432_004118_2052_2453 133
298 3300042006 Ga0439432_038751 Ga0439432_038751_538_939 133
299 3300042009 Ga0439451_001083 Ga0439451_001083_3173_3574 133
300 3300042009 Ga0439451_002714 Ga0439451_002714_1116_1517 133
301 3300042010 Ga0439452_000253 Ga0439452_000253_17640_18041 133
302 3300042010 Ga0439452_000674 Ga0439452_000674_10059_10460 133
303 3300042010 Ga0439452_001028 Ga0439452_001028_7990_8391 133
304 3300042010 Ga0439452_001344 Ga0439452_001344_2287_2688 133
305 3300042013 Ga0439456_000526 Ga0439456_000526_2371_2772 133
306 3300042013 Ga0439456_001325 Ga0439456_001325_1380_1781 133
307 3300042013 Ga0439456_001725 Ga0439456_001725_1951_2352 133
308 3300042013 Ga0439456_043549 Ga0439456_043549_326_727 133
309 3300042013 Ga0439456_058855 Ga0439456_058855_25_426 133
310 3300042016 Ga0439463_002428 Ga0439463_002428_1380_1781 133
311 3300042016 Ga0439463_024801 Ga0439463_024801_521_922 133
312 3300042115 Ga0450911_000009 Ga0450911_000009_60797_61198 133
313 3300042115 Ga0450911_003941 Ga0450911_003941_1148_1549 133
314 3300042128 Ga0450897_001266 Ga0450897_001266_725_1126 133
315 3300042131 Ga0450894_001394 Ga0450894_001394_1031_1432 133
316 3300042134 Ga0450898_001209 Ga0450898_001209_458_859 133
317 3300042137 Ga0450902_027869 Ga0450902_027869_148_549 133
318 3300042146 Ga0450907_000003 Ga0450907_000003_15995_16396 133
319 3300042146 Ga0450907_010268 Ga0450907_010268_663_1064 133
320 3300042147 Ga0450910_000195 Ga0450910_000195_2212_2613 133
321 3300042156 Ga0439446_0000420 Ga0439446_0000420_2659_3060 133
322 3300042156 Ga0439446_0013445 Ga0439446_0013445_1592_1993 133
323 3300042185 Ga0450909_000681 Ga0450909_000681_1423_1824 133
324 3300042435 Ga0439434_0000019 Ga0439434_0000019_25041_25442 133
325 3300042435 Ga0439434_0040467 Ga0439434_0040467_39_440 133
326 3300042533 Ga0450901_002242 Ga0450901_002242_1321_1722 133
327 3300042993 Ga0439440_0003448 Ga0439440_0003448_1910_2311 133
328 3300046452 Ga0495617_000024 Ga0495617_000024_141732_142133 133
329 3300046452 Ga0495617_002558 Ga0495617_002558_6333_6734 133
330 3300046452 Ga0495617_006193 Ga0495617_006193_2778_3179 133
331 3300046452 Ga0495617_064083 Ga0495617_064083_440_841 133
332 3300046452 Ga0495617_067476 Ga0495617_067476_756_1157 133
333 3300046452 Ga0495617_075218 Ga0495617_075218_314_718 133
334 3300046453 Ga0495627_020253 Ga0495627_020253_743_1144 133
335 3300046453 Ga0495627_035217 Ga0495627_035217_756_1157 133
336 3300046455 Ga0495603_0000535 Ga0495603_0000535_2515_2916 133
337 3300046457 Ga0495590_0077647 Ga0495590_0077647_291_692 133
338 3300046457 Ga0495590_0104061 Ga0495590_0104061_465_869 133
339 3300046458 Ga0495591_000054 Ga0495591_000054_33331_33732 133
340 3300046458 Ga0495591_000055 Ga0495591_000055_10096_10497 133
341 3300046458 Ga0495591_001528 Ga0495591_001528_10372_10773 133
342 3300046458 Ga0495591_001589 Ga0495591_001589_11216_11617 133
343 3300046458 Ga0495591_003749 Ga0495591_003749_2777_3178 133
344 3300046458 Ga0495591_005366 Ga0495591_005366_3528_3929 133
345 3300046458 Ga0495591_007279 Ga0495591_007279_706_1107 133
346 3300046459 Ga0495629_0290941 Ga0495629_0290941_75_476 133
347 3300046459 Ga0495629_0672281 Ga0495629_0672281_42_479 133
348 3300046460 Ga0495638_0001316 Ga0495638_0001316_5702_6103 133
349 3300046460 Ga0495638_0005377 Ga0495638_0005377_810_1214 133
350 3300046460 Ga0495638_0015276 Ga0495638_0015276_1280_1681 133
351 3300046460 Ga0495638_0031710 Ga0495638_0031710_1045_1446 133
352 3300046463 Ga0495653_0011626 Ga0495653_0011626_5185_5586 133
353 3300046463 Ga0495653_0019616 Ga0495653_0019616_1986_2426 133
354 3300046471 Ga0495650_0000632 Ga0495650_0000632_35526_35927 133
355 3300046471 Ga0495650_0000775 Ga0495650_0000775_9049_9450 133
356 3300046471 Ga0495650_0002438 Ga0495650_0002438_6510_6911 133
357 3300046471 Ga0495650_0003367 Ga0495650_0003367_3581_3982 133
358 3300046471 Ga0495650_0007323 Ga0495650_0007323_4084_4485 133
359 3300046471 Ga0495650_0082378 Ga0495650_0082378_626_1027 133
360 3300046474 Ga0495605_0000257 Ga0495605_0000257_50885_51286 133
361 3300046474 Ga0495605_0005581 Ga0495605_0005581_3771_4172 133
362 3300046474 Ga0495605_0015217 Ga0495605_0015217_32_433 133
363 3300046474 Ga0495605_0162357 Ga0495605_0162357_537_941 133
364 3300046491 Ga0495584_0011786 Ga0495584_0011786_1902_2303 133
365 3300046491 Ga0495584_0044274 Ga0495584_0044274_1723_2124 133
366 3300046491 Ga0495584_0046508 Ga0495584_0046508_1120_1521 133
367 3300046491 Ga0495584_0073708 Ga0495584_0073708_642_1043 133
368 3300046491 Ga0495584_0258040 Ga0495584_0258040_324_725 133
369 3300046492 Ga0495585_0000047 Ga0495585_0000047_48817_49218 133
370 3300046492 Ga0495585_0011595 Ga0495585_0011595_1223_1624 133
371 3300046492 Ga0495585_0020632 Ga0495585_0020632_1480_1884 133
372 3300046500 Ga0495596_0021759 Ga0495596_0021759_1144_1545 133
373 3300046501 Ga0495607_0001046 Ga0495607_0001046_22718_23119 133
374 3300046501 Ga0495607_0001263 Ga0495607_0001263_9564_9965 133
375 3300046501 Ga0495607_0004807 Ga0495607_0004807_8216_8617 133
376 3300046501 Ga0495607_0009595 Ga0495607_0009595_3816_4217 133
377 3300046501 Ga0495607_0030474 Ga0495607_0030474_2427_2828 133
378 3300046501 Ga0495607_0037709 Ga0495607_0037709_2165_2566 133
379 3300046501 Ga0495607_0078121 Ga0495607_0078121_341_742 133
380 3300046501 Ga0495607_0188671 Ga0495607_0188671_163_564 133
381 3300046501 Ga0495607_0258190 Ga0495607_0258190_325_726 133
382 3300046506 Ga0495583_0177279 Ga0495583_0177279_152_553 133
383 3300046506 Ga0495583_0349408 Ga0495583_0349408_138_560 133
384 3300046507 Ga0495606_0000207 Ga0495606_0000207_9137_9538 133
385 3300046507 Ga0495606_0000477 Ga0495606_0000477_34018_34419 133
386 3300046507 Ga0495606_0000577 Ga0495606_0000577_47359_47760 133
387 3300046507 Ga0495606_0009283 Ga0495606_0009283_2604_3005 133
388 3300046507 Ga0495606_0011915 Ga0495606_0011915_2307_2708 133
389 3300046507 Ga0495606_0014035 Ga0495606_0014035_4443_4844 133
390 3300046507 Ga0495606_0047981 Ga0495606_0047981_1110_1511 133
391 3300046507 Ga0495606_0051281 Ga0495606_0051281_1454_1855 133
392 3300046507 Ga0495606_0086581 Ga0495606_0086581_747_1148 133
393 3300046507 Ga0495606_0245498 Ga0495606_0245498_30_431 133
394 3300046512 Ga0495610_0000209 Ga0495610_0000209_50160_50561 133
395 3300046512 Ga0495610_0003616 Ga0495610_0003616_7433_7834 133
396 3300046512 Ga0495610_0011838 Ga0495610_0011838_2894_3295 133
397 3300046512 Ga0495610_0021129 Ga0495610_0021129_2765_3166 133
398 3300046512 Ga0495610_0027234 Ga0495610_0027234_640_1041 133
399 3300046512 Ga0495610_0048608 Ga0495610_0048608_1260_1661 133
400 3300046513 Ga0495616_0000430 Ga0495616_0000430_20458_20859 133
401 3300046513 Ga0495616_0000655 Ga0495616_0000655_3468_3869 133
402 3300046513 Ga0495616_0021707 Ga0495616_0021707_418_819 133
403 3300046513 Ga0495616_0048208 Ga0495616_0048208_415_816 133
404 3300046513 Ga0495616_0143594 Ga0495616_0143594_534_938 133
405 3300046515 Ga0495620_0000010 Ga0495620_0000010_31665_32066 133
406 3300046515 Ga0495620_0000029 Ga0495620_0000029_110104_110505 133
407 3300046515 Ga0495620_0000137 Ga0495620_0000137_17657_18058 133
408 3300046515 Ga0495620_0000484 Ga0495620_0000484_9101_9502 133
409 3300046515 Ga0495620_0000843 Ga0495620_0000843_2975_3376 133
410 3300046515 Ga0495620_0001400 Ga0495620_0001400_639_1040 133
411 3300046515 Ga0495620_0026310 Ga0495620_0026310_390_791 133
412 3300046515 Ga0495620_0073257 Ga0495620_0073257_24_425 133
413 3300046515 Ga0495620_0266708 Ga0495620_0266708_134_535 133
414 3300046517 Ga0495630_0004914 Ga0495630_0004914_4241_4642 133
415 3300046518 Ga0495631_0000239 Ga0495631_0000239_14729_15130 133
416 3300046518 Ga0495631_0006776 Ga0495631_0006776_2014_2415 133
417 3300046518 Ga0495631_0026174 Ga0495631_0026174_1208_1609 133
418 3300046518 Ga0495631_0109452 Ga0495631_0109452_609_1013 133
419 3300046518 Ga0495631_0143185 Ga0495631_0143185_32_433 133
420 3300046519 Ga0495632_0015196 Ga0495632_0015196_1621_2022 133
421 3300046519 Ga0495632_0015916 Ga0495632_0015916_2334_2735 133
422 3300046519 Ga0495632_0024893 Ga0495632_0024893_2071_2472 133
423 3300046519 Ga0495632_0059685 Ga0495632_0059685_175_576 133
424 3300046519 Ga0495632_0065486 Ga0495632_0065486_393_794 133
425 3300046519 Ga0495632_0094516 Ga0495632_0094516_989_1390 133
426 3300046519 Ga0495632_0210056 Ga0495632_0210056_58_480 133
427 3300046520 Ga0495637_0000077 Ga0495637_0000077_73113_73514 133
428 3300046520 Ga0495637_0000098 Ga0495637_0000098_24310_24711 133
429 3300046520 Ga0495637_0005725 Ga0495637_0005725_4910_5311 133
430 3300046520 Ga0495637_0006993 Ga0495637_0006993_4592_4993 133
431 3300046520 Ga0495637_0038311 Ga0495637_0038311_1489_1890 133
432 3300046522 Ga0495643_0000345 Ga0495643_0000345_26203_26604 133
433 3300046522 Ga0495643_0001038 Ga0495643_0001038_19542_19943 133
434 3300046522 Ga0495643_0008035 Ga0495643_0008035_1824_2225 133
435 3300046522 Ga0495643_0012951 Ga0495643_0012951_3340_3741 133
436 3300046522 Ga0495643_0014006 Ga0495643_0014006_1700_2101 133
437 3300046522 Ga0495643_0245524 Ga0495643_0245524_391_792 133
438 3300046523 Ga0495644_0196336 Ga0495644_0196336_21_422 133
439 3300046523 Ga0495644_0254488 Ga0495644_0254488_249_650 133
440 3300046523 Ga0495644_0278501 Ga0495644_0278501_150_572 133
441 3300046523 Ga0495644_0412284 Ga0495644_0412284_90_491 133
442 3300046524 Ga0495648_0001842 Ga0495648_0001842_7973_8374 133
443 3300046524 Ga0495648_0002821 Ga0495648_0002821_2895_3296 133
444 3300046524 Ga0495648_0004200 Ga0495648_0004200_7331_7732 133
445 3300046524 Ga0495648_0012291 Ga0495648_0012291_1240_1641 133
446 3300046524 Ga0495648_0076217 Ga0495648_0076217_888_1289 133
447 3300046526 Ga0495666_0007013 Ga0495666_0007013_2108_2548 133
448 3300046526 Ga0495666_0028597 Ga0495666_0028597_747_1148 133
449 3300046526 Ga0495666_0373932 Ga0495666_0373932_78_479 133
450 3300046530 Ga0495654_0000897 Ga0495654_0000897_16299_16700 133
451 3300046530 Ga0495654_0001437 Ga0495654_0001437_13968_14369 133
452 3300046530 Ga0495654_0005810 Ga0495654_0005810_2148_2549 133
453 3300046530 Ga0495654_0017995 Ga0495654_0017995_27_428 133
454 3300046530 Ga0495654_0018015 Ga0495654_0018015_825_1226 133
455 3300046530 Ga0495654_0018398 Ga0495654_0018398_1819_2220 133
456 3300046530 Ga0495654_0023888 Ga0495654_0023888_1275_1676 133
457 3300046536 Ga0495587_0000190 Ga0495587_0000190_12365_12805 133
458 3300046537 Ga0495598_0180265 Ga0495598_0180265_249_653 133
459 3300046538 Ga0495609_0000014 Ga0495609_0000014_62084_62485 133
460 3300046538 Ga0495609_0000188 Ga0495609_0000188_2009_2410 133
461 3300046538 Ga0495609_0000534 Ga0495609_0000534_16665_17066 133
462 3300046538 Ga0495609_0009645 Ga0495609_0009645_3289_3693 133
463 3300046542 Ga0495597_0000061 Ga0495597_0000061_6806_7207 133
464 3300046542 Ga0495597_0000269 Ga0495597_0000269_14739_15140 133
465 3300046542 Ga0495597_0030227 Ga0495597_0030227_409_810 133
466 3300046542 Ga0495597_0099287 Ga0495597_0099287_485_886 133
467 3300046542 Ga0495597_0268678 Ga0495597_0268678_40_441 133
468 3300046557 Ga0495622_0012670 Ga0495622_0012670_1011_1412 133
469 3300046557 Ga0495622_0089635 Ga0495622_0089635_230_631 133
470 3300046557 Ga0495622_0116695 Ga0495622_0116695_160_561 133
471 3300046558 Ga0495633_0000009 Ga0495633_0000009_109388_109789 133
472 3300046558 Ga0495633_0000278 Ga0495633_0000278_41650_42051 133
473 3300046558 Ga0495633_0031492 Ga0495633_0031492_808_1209 133
474 3300046615 Ga0495656_0025230 Ga0495656_0025230_409_813 133
475 3300046616 Ga0495668_0004899 Ga0495668_0004899_1060_1461 133
476 3300046616 Ga0495668_0014521 Ga0495668_0014521_700_1101 133
477 3300046616 Ga0495668_0021456 Ga0495668_0021456_2242_2646 133
478 3300046616 Ga0495668_0187839 Ga0495668_0187839_13_414 133
479 3300046642 Ga0495634_0001714 Ga0495634_0001714_6970_7371 133
480 3300046648 Ga0495611_0000862 Ga0495611_0000862_6251_6652 133
481 3300046648 Ga0495611_0002339 Ga0495611_0002339_6696_7097 133
482 3300046648 Ga0495611_0008181 Ga0495611_0008181_2542_2943 133
483 3300046648 Ga0495611_0020467 Ga0495611_0020467_2388_2792 133
484 3300046648 Ga0495611_0046899 Ga0495611_0046899_530_931 133
485 3300046660 Ga0495625_0000004 Ga0495625_0000004_485879_486280 133
486 3300046660 Ga0495625_0001992 Ga0495625_0001992_5918_6319 133
487 3300046660 Ga0495625_0014183 Ga0495625_0014183_3584_3988 133
488 3300046660 Ga0495625_0035565 Ga0495625_0035565_2333_2734 133
489 3300046660 Ga0495625_0189495 Ga0495625_0189495_457_858 133
490 3300046660 Ga0495625_0436228 Ga0495625_0436228_47_448 133
491 3300046660 Ga0495625_0753640 Ga0495625_0753640_148_549 133
492 3300046663 Ga0495635_0000350 Ga0495635_0000350_17415_17855 133
493 3300046665 Ga0495661_0000029 Ga0495661_0000029_171016_171417 133
494 3300046665 Ga0495661_0003921 Ga0495661_0003921_2318_2719 133
495 3300046665 Ga0495661_0007584 Ga0495661_0007584_6004_6405 133
496 3300046665 Ga0495661_0015812 Ga0495661_0015812_4103_4504 133
497 3300046665 Ga0495661_0043197 Ga0495661_0043197_1797_2198 133
498 3300046665 Ga0495661_0054378 Ga0495661_0054378_1840_2241 133
499 3300046680 Ga0495646_0000790 Ga0495646_0000790_7012_7413 133
500 3300046684 Ga0495669_0543667 Ga0495669_0543667_63_464 133
501 3300046684 Ga0495669_0606626 Ga0495669_0606626_87_491 133
502 3300046691 Ga0495670_0017504 Ga0495670_0017504_1936_2337 133
503 3300046691 Ga0495670_0025997 Ga0495670_0025997_435_836 133
504 3300046691 Ga0495670_0116656 Ga0495670_0116656_374_775 133
505 3300046692 Ga0495671_0000397 Ga0495671_0000397_1994_2395 133
506 3300046692 Ga0495671_0001790 Ga0495671_0001790_3676_4077 133
507 3300046692 Ga0495671_0003980 Ga0495671_0003980_1989_2390 133
508 3300046692 Ga0495671_0011517 Ga0495671_0011517_1280_1681 133
509 3300046692 Ga0495671_0013827 Ga0495671_0013827_1842_2243 133
510 3300046692 Ga0495671_0030327 Ga0495671_0030327_297_698 133
511 3300046694 Ga0495649_0000081 Ga0495649_0000081_79689_80090 133
512 3300046694 Ga0495649_0006509 Ga0495649_0006509_4680_5081 133
513 3300046694 Ga0495649_0041448 Ga0495649_0041448_1054_1455 133
514 3300046694 Ga0495649_0058857 Ga0495649_0058857_647_1048 133
515 3300046794 Ga0495589_0000251 Ga0495589_0000251_17793_18194 133
516 3300046794 Ga0495589_0098173 Ga0495589_0098173_384_788 133
517 3300046810 Ga0495660_0000052 Ga0495660_0000052_74562_74963 133
518 3300046810 Ga0495660_0000148 Ga0495660_0000148_54741_55142 133
519 3300046810 Ga0495660_0001102 Ga0495660_0001102_12391_12792 133
520 3300046810 Ga0495660_0001450 Ga0495660_0001450_2796_3197 133
521 3300046810 Ga0495660_0002640 Ga0495660_0002640_5946_6347 133
522 3300046810 Ga0495660_0002969 Ga0495660_0002969_3741_4142 133
523 3300046810 Ga0495660_0003761 Ga0495660_0003761_2933_3334 133
524 3300046810 Ga0495660_0028324 Ga0495660_0028324_1532_1933 133
525 3300046810 Ga0495660_0070439 Ga0495660_0070439_59_460 133
526 3300046810 Ga0495660_0159048 Ga0495660_0159048_22_423 133
527 3300047317 Ga0495604_0041768 Ga0495604_0041768_1994_2395 133
528 3300047320 Ga0495672_0000407 Ga0495672_0000407_43919_44320 133
529 3300047320 Ga0495672_0003314 Ga0495672_0003314_8721_9122 133
530 3300047320 Ga0495672_0010278 Ga0495672_0010278_3274_3675 133
531 3300047320 Ga0495672_0065591 Ga0495672_0065591_1536_1937 133
532 3300047323 Ga0495683_0000033 Ga0495683_0000033_88929_89330 133
533 3300047323 Ga0495683_0003014 Ga0495683_0003014_4453_4854 133
534 3300047323 Ga0495683_0150885 Ga0495683_0150885_510_911 133
535 3300047323 Ga0495683_0161786 Ga0495683_0161786_481_885 133
536 3300047323 Ga0495683_0475347 Ga0495683_0475347_79_480 133
537 3300047444 Ga0495675_0008889 Ga0495675_0008889_2924_3325 133
538 3300047445 Ga0495677_0071032 Ga0495677_0071032_40_444 133
539 3300047446 Ga0495679_000015 Ga0495679_000015_110522_110923 133
540 3300047446 Ga0495679_001075 Ga0495679_001075_14053_14454 133
541 3300047446 Ga0495679_002354 Ga0495679_002354_5979_6380 133
542 3300047469 Ga0495673_0000036 Ga0495673_0000036_115062_115463 133
543 3300047469 Ga0495673_0000300 Ga0495673_0000300_64748_65149 133
544 3300047469 Ga0495673_0000525 Ga0495673_0000525_35475_35876 133
545 3300047469 Ga0495673_0002993 Ga0495673_0002993_8879_9280 133
546 3300047469 Ga0495673_0003465 Ga0495673_0003465_7487_7888 133
547 3300047469 Ga0495673_0007028 Ga0495673_0007028_2825_3226 133
548 3300047469 Ga0495673_0009795 Ga0495673_0009795_3794_4195 133
549 3300047469 Ga0495673_0018360 Ga0495673_0018360_27_428 133
550 3300047469 Ga0495673_0023211 Ga0495673_0023211_2487_2888 133
551 3300047469 Ga0495673_0039676 Ga0495673_0039676_1032_1433 133
552 3300047469 Ga0495673_0051764 Ga0495673_0051764_485_886 133
553 3300047469 Ga0495673_0122618 Ga0495673_0122618_30_431 133
554 3300047470 Ga0495681_0000768 Ga0495681_0000768_1280_1681 133
555 3300047470 Ga0495681_0041668 Ga0495681_0041668_677_1078 133
556 3300047470 Ga0495681_0226062 Ga0495681_0226062_36_437 133
557 3300047470 Ga0495681_0253499 Ga0495681_0253499_235_636 133
558 3300047471 Ga0495684_0038169 Ga0495684_0038169_2036_2437 133
559 3300047472 Ga0495686_0000708 Ga0495686_0000708_32614_33015 133
560 3300047472 Ga0495686_0004371 Ga0495686_0004371_10132_10533 133
561 3300047472 Ga0495686_0046828 Ga0495686_0046828_916_1317 133
562 3300047472 Ga0495686_0587285 Ga0495686_0587285_133_534 133
563 3300047673 Ga0495593_0009302 Ga0495593_0009302_3261_3701 133
564 3300048090 Ga0495615_0169726 Ga0495615_0169726_32_433 133
565 3300048091 Ga0495626_0000012 Ga0495626_0000012_249541_249942 133
566 3300048091 Ga0495626_0001745 Ga0495626_0001745_12463_12864 133
567 3300048091 Ga0495626_0174777 Ga0495626_0174777_78_479 133
568 3300048091 Ga0495626_0220184 Ga0495626_0220184_78_479 133
569 3300048905 Ga0496102_0000821 Ga0496102_0000821_17460_17900 133
570 3300048905 Ga0496102_0740281 Ga0496102_0740281_271_672 133
571 3300048906 Ga0496103_0002064 Ga0496103_0002064_691_1131 133
572 3300048909 Ga0496106_0001032 Ga0496106_0001032_8535_8936 133
573 3300048913 Ga0496110_1060037 Ga0496110_1060037_153_554 133
574 3300048917 Ga0496114_0038162 Ga0496114_0038162_540_953 133
575 3300048919 Ga0496116_0011895 Ga0496116_0011895_5243_5683 133
576 3300048920 Ga0496117_0008832 Ga0496117_0008832_1554_1994 133
577 3300048920 Ga0496117_0265579 Ga0496117_0265579_71_472 133
578 3300048921 Ga0496118_0003083 Ga0496118_0003083_12077_12517 133
579 3300048922 Ga0496119_0015131 Ga0496119_0015131_2299_2700 133
580 3300048923 Ga0496120_0001430 Ga0496120_0001430_3297_3698 133
581 3300048924 Ga0496121_0000782 Ga0496121_0000782_42010_42411 133
582 3300048924 Ga0496121_0024059 Ga0496121_0024059_3305_3706 133
583 3300048924 Ga0496121_0037696 Ga0496121_0037696_1694_2095 133
584 3300048924 Ga0496121_0042734 Ga0496121_0042734_3464_3904 133
585 3300048924 Ga0496121_0047827 Ga0496121_0047827_312_713 133
586 3300048924 Ga0496121_0192598 Ga0496121_0192598_559_960 133
587 3300048927 Ga0496124_0001319 Ga0496124_0001319_33442_33843 133
588 3300048927 Ga0496124_0024406 Ga0496124_0024406_2947_3348 133
589 3300048927 Ga0496124_0034155 Ga0496124_0034155_2185_2586 133
590 3300048927 Ga0496124_0069717 Ga0496124_0069717_2292_2693 133
591 3300048927 Ga0496124_0076475 Ga0496124_0076475_2255_2656 133
592 3300048928 Ga0496125_0001337 Ga0496125_0001337_3315_3716 133
593 3300048928 Ga0496125_0083021 Ga0496125_0083021_854_1255 133
594 3300048928 Ga0496125_0403803 Ga0496125_0403803_71_472 133
595 3300048929 Ga0496126_0042934 Ga0496126_0042934_2681_3082 133
596 3300048929 Ga0496126_0305398 Ga0496126_0305398_876_1289 133
597 3300048929 Ga0496126_0480541 Ga0496126_0480541_437_877 133
598 3300049459 Ga0495678_000011 Ga0495678_000011_97628_98029 133
599 3300049459 Ga0495678_000052 Ga0495678_000052_110870_111271 133
600 3300049459 Ga0495678_003094 Ga0495678_003094_583_984 133
601 3300049459 Ga0495678_003321 Ga0495678_003321_8604_9005 133
602 3300049459 Ga0495678_003781 Ga0495678_003781_3215_3616 133
603 3300049459 Ga0495678_013815 Ga0495678_013815_2155_2556 133
604 3300049459 Ga0495678_182866 Ga0495678_182866_136_537 133
605 3300049460 Ga0495682_0000073 Ga0495682_0000073_9279_9680 133
606 3300049460 Ga0495682_0000542 Ga0495682_0000542_10632_11033 133
607 3300049460 Ga0495682_0008714 Ga0495682_0008714_1561_1962 133
608 3300049460 Ga0495682_0035451 Ga0495682_0035451_617_1018 133
609 3300050489 nmdc:mga03683_3_c1 nmdc:mga03683_3_c1_270640_271041 133
610 3300050490 nmdc:mga03n38_250728_c1 nmdc:mga03n38_250728_c1_122_523 133
611 3300050491 nmdc:mga00v17_741837_c1 nmdc:mga00v17_741837_c1_167_568 133
612 3300050492 nmdc:mga0yw44_100328_c1 nmdc:mga0yw44_100328_c1_791_1192 133
613 3300050493 nmdc:mga0k408_2_c1 nmdc:mga0k408_2_c1_279988_280389 133
614 3300050516 nmdc:mga0sz30_162_c1 nmdc:mga0sz30_162_c1_16711_17112 133
615 3300053087 Ga0500643_003161 Ga0500643_003161_1661_2062 133
616 3300053125 Ga0500618_000087 Ga0500618_000087_13819_14220 133
617 3300053140 Ga0500573_0329255 Ga0500573_0329255_292_693 133
618 3300053147 Ga0500589_091940 Ga0500589_091940_10_411 133
619 3300053158 Ga0500627_0126076 Ga0500627_0126076_80_484 133
620 3300053730 Ga0500645_025607 Ga0500645_025607_1339_1743 133
621 3300053735 Ga0500596_031575 Ga0500596_031575_170_571 133
622 3300002737 JGI25162J39368_1000010 JGI25162J39368_1000010291 134
623 3300002771 JGI25163J39215_1000005 JGI25163J39215_100000563 134
624 3300002772 JGI25164J39214_1000003 JGI25164J39214_100000374 134
625 3300003751 Ga0055538_1000009 Ga0055538_1000009291 134
626 3300003752 Ga0055539_1000013 Ga0055539_1000013291 134
627 3300003756 Ga0055533_1000017 Ga0055533_1000017291 134
628 3300003759 Ga0055525_1000019 Ga0055525_1000019291 134
629 3300003841 Ga0055541_1000010 Ga0055541_1000010291 134
630 3300005289 Ga0065704_10001203 Ga0065704_100012033 134
631 3300005563 Ga0068855_100007614 Ga0068855_10000761410 134
632 3300009011 Ga0105251_10004367 Ga0105251_100043675 134
633 3300009545 Ga0105237_10051981 Ga0105237_100519812 134
634 3300014325 Ga0163163_10115530 Ga0163163_101155303 134
635 3300025207 Ga0209760_100038 Ga0209760_10003821 134
636 3300025224 Ga0209784_100012 Ga0209784_100012286 134
637 3300025225 Ga0209566_100010 Ga0209566_100010286 134
638 3300025226 Ga0209674_100023 Ga0209674_100023286 134
639 3300025230 Ga0209563_100027 Ga0209563_100027286 134
640 3300025231 Ga0207427_100017 Ga0207427_100017286 134
641 3300025233 Ga0209437_100029 Ga0209437_100029286 134
642 3300025253 Ga0209677_100014 Ga0209677_100014286 134
643 3300025261 Ga0209233_1001957 Ga0209233_10019574 134
644 3300025303 Ga0209051_1033397 Ga0209051_10333973 134
645 3300025711 Ga0207696_1000788 Ga0207696_10007886 134
646 3300025728 Ga0207655_1004784 Ga0207655_10047843 134
647 3300025735 Ga0207713_1005257 Ga0207713_10052576 134
648 3300025914 Ga0207671_10046544 Ga0207671_100465442 134
649 3300025925 Ga0207650_11144089 Ga0207650_111440892 134
650 3300025949 Ga0207667_10022678 Ga0207667_100226783 134
651 3300031456 Ga0307513_10011047 Ga0307513_100110472 134
652 3300042146 Ga0450907_000187 Ga0450907_000187_7553_7957 134
653 3300046453 Ga0495627_004795 Ga0495627_004795_1652_2062 134
654 3300046455 Ga0495603_0354944 Ga0495603_0354944_58_468 134
655 3300046458 Ga0495591_003342 Ga0495591_003342_5359_5769 134
656 3300046471 Ga0495650_0000052 Ga0495650_0000052_294183_294587 134
657 3300046471 Ga0495650_0001762 Ga0495650_0001762_13739_14149 134
658 3300046474 Ga0495605_0000002 Ga0495605_0000002_135260_135670 134
659 3300046475 Ga0495639_0296621 Ga0495639_0296621_191_601 134
660 3300046499 Ga0495594_0003396 Ga0495594_0003396_6111_6521 134
661 3300046501 Ga0495607_0013946 Ga0495607_0013946_1166_1570 134
662 3300046501 Ga0495607_0116804 Ga0495607_0116804_228_632 134
663 3300046506 Ga0495583_0000012 Ga0495583_0000012_297226_297636 134
664 3300046515 Ga0495620_0006940 Ga0495620_0006940_3390_3794 134
665 3300046518 Ga0495631_0003091 Ga0495631_0003091_7961_8371 134
666 3300046524 Ga0495648_0005523 Ga0495648_0005523_1734_2144 134
667 3300046530 Ga0495654_0001265 Ga0495654_0001265_10163_10573 134
668 3300046530 Ga0495654_0010281 Ga0495654_0010281_4227_4631 134
669 3300046538 Ga0495609_0000008 Ga0495609_0000008_96525_96935 134
670 3300046538 Ga0495609_0219709 Ga0495609_0219709_110_514 134
671 3300046557 Ga0495622_0000003 Ga0495622_0000003_143128_143541 134
672 3300046557 Ga0495622_0000367 Ga0495622_0000367_16221_16625 134
673 3300046648 Ga0495611_0009279 Ga0495611_0009279_3505_3915 134
674 3300046665 Ga0495661_0072228 Ga0495661_0072228_1301_1711 134
675 3300046674 Ga0495588_0220681 Ga0495588_0220681_326_736 134
676 3300046690 Ga0495624_0038386 Ga0495624_0038386_1951_2355 134
677 3300046691 Ga0495670_0195726 Ga0495670_0195726_381_791 134
678 3300046692 Ga0495671_0053127 Ga0495671_0053127_687_1097 134
679 3300046794 Ga0495589_0006350 Ga0495589_0006350_2552_2956 134
680 3300046810 Ga0495660_0000006 Ga0495660_0000006_286239_286643 134
681 3300046810 Ga0495660_0004153 Ga0495660_0004153_1300_1710 134
682 3300047323 Ga0495683_0000042 Ga0495683_0000042_55834_56244 134
683 3300047446 Ga0495679_000060 Ga0495679_000060_82157_82567 134
684 3300047446 Ga0495679_004740 Ga0495679_004740_3352_3756 134
685 3300047469 Ga0495673_0056862 Ga0495673_0056862_980_1390 134
686 3300047469 Ga0495673_0060999 Ga0495673_0060999_503_907 134
687 3300047470 Ga0495681_0001769 Ga0495681_0001769_12775_13185 134
688 3300048905 Ga0496102_1513441 Ga0496102_1513441_158_562 134
689 3300048907 Ga0496104_0011249 Ga0496104_0011249_7188_7592 134
690 3300048918 Ga0496115_0735125 Ga0496115_0735125_79_501 134
691 3300048919 Ga0496116_0000020 Ga0496116_0000020_301194_301598 134
692 3300048919 Ga0496116_0150413 Ga0496116_0150413_812_1219 134
693 3300048920 Ga0496117_0000246 Ga0496117_0000246_98759_99163 134
694 3300048920 Ga0496117_0001151 Ga0496117_0001151_3627_4031 134
695 3300048921 Ga0496118_0041846 Ga0496118_0041846_437_841 134
696 3300048921 Ga0496118_0348059 Ga0496118_0348059_168_575 134
697 3300048922 Ga0496119_0019254 Ga0496119_0019254_2638_3042 134
698 3300048923 Ga0496120_0007714 Ga0496120_0007714_5996_6400 134
699 3300048924 Ga0496121_0112158 Ga0496121_0112158_102_509 134
700 3300048924 Ga0496121_0238564 Ga0496121_0238564_526_996 134
701 3300048925 Ga0496122_0000010 Ga0496122_0000010_514428_514832 134
702 3300048925 Ga0496122_0016615 Ga0496122_0016615_2356_2766 134
703 3300048926 Ga0496123_0000025 Ga0496123_0000025_25675_26079 134
704 3300048926 Ga0496123_0006592 Ga0496123_0006592_2306_2716 134
705 3300048927 Ga0496124_0000084 Ga0496124_0000084_201115_201519 134
706 3300048928 Ga0496125_0000071 Ga0496125_0000071_211361_211765 134
707 3300048928 Ga0496125_0468744 Ga0496125_0468744_223_627 134
708 3300048929 Ga0496126_0049632 Ga0496126_0049632_1628_2032 134
709 3300053125 Ga0500618_000095 Ga0500618_000095_36260_36673 134
710 3300053153 Ga0500616_0411022 Ga0500616_0411022_93_497 134
711 3300046525 Ga0495663_0144567 Ga0495663_0144567_31_459 135
712 3300046507 Ga0495606_0011103 Ga0495606_0011103_5764_6177 137
713 3300046691 Ga0495670_0015653 Ga0495670_0015653_1208_1678 137
714 3300047322 Ga0495680_0079938 Ga0495680_0079938_589_1059 137
715 3300005467 Ga0070706_100215073 Ga0070706_1002150732 138
716 3300046457 Ga0495590_0003530 Ga0495590_0003530_1486_1962 138
717 3300046474 Ga0495605_0002034 Ga0495605_0002034_10366_10842 138
718 3300047469 Ga0495673_0002620 Ga0495673_0002620_10076_10552 138
719 3300053111 Ga0500572_154950 Ga0500572_154950_179_595 138
720 3300053145 Ga0500586_229215 Ga0500586_229215_85_579 138
721 3300046500 Ga0495596_0067160 Ga0495596_0067160_866_1327 139
722 3300046520 Ga0495637_0249705 Ga0495637_0249705_93_572 139
723 3300046664 Ga0495659_0319614 Ga0495659_0319614_17_478 139
724 3300046692 Ga0495671_0181488 Ga0495671_0181488_525_1004 139
725 2162886007 SwRhRL2b_contig_3239005 SwRhRL2b_0418.00001970 140
726 3300009092 Ga0105250_10001159 Ga0105250_1000115913 140
727 3300013306 Ga0163162_10087004 Ga0163162_100870042 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

142

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8967 6 132
4z04-assembly1.cif.gz_A-2 crystal structure of a probable lactoylglutathione lyase from brucella melitensis in complex with glutathione 0.8622 6 132
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8521 6 133
4qb5-assembly2.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8434 6 133
4qb5-assembly1.cif.gz_C crystal structure of a glyoxalase/bleomycin resistance protein from albidiferax ferrireducens t118 0.8389 6 133
ID Description Score Start End Superfamily
af_Q8IK86_519_679_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9497 75 98 3.40.50.300
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8967 6 132 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8912 75 132 3.30.720.110
4z04A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8622 6 132 3.10.180.10
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.846 75 131 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A8B3GEU0-F1-model_v4 deleted 1.008 74 138
AF-A0A7Y8B6K7-F1-model_v4 deleted 1.002 76 137
AF-A0A514BFE7-F1-model_v4 deleted 0.9987 76 139
AF-A0A2V1CTG9-F1-model_v4 VOC domain-containing protein 0.9979 76 133
AF-I0SCL7-F1-model_v4 Glyoxalase domain protein 0.9962 75 132

Feature Viewer

pLDDT pTM Quality
89.4 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map