F477699

General Info

Members Datasets Scaffolds Average Seq Length
726 398 588 135

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0147625|Ga0495625_0147625_208_669
Length 153
Sequence VYPELIENQRTATMSCTGSAVRPLNIGEAAKASGVTAKMIRHYESIGLVEAARRTDAGYRLYSQQDVQVLQFIHRARALGFSLDRIGSLLALWQDKQRASSDVRALARSHIDELNQKIAELESMRRTLERLADSCHGDGRSDCPILDDLAHCE

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231022 Pseudomonas sp. GM79 Isolate Nodule
10 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
11 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
12 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
13 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
14 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
15 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
16 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
17 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
18 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
19 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
20 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
21 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
22 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
23 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
24 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
25 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
26 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
27 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
28 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
29 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
30 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
31 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
32 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
33 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
34 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
35 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
36 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
37 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
38 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
39 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
40 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
41 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
42 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
43 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
44 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
45 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
46 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
47 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
48 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
49 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
50 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
51 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
52 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
53 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
54 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
55 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
56 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
57 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
58 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
59 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
60 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
61 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
62 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
63 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
64 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
65 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
66 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
67 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
68 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
69 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
70 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
71 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
72 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
73 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
74 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
75 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
76 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
77 2773857670 Pseudomonas sp. 478 Isolate Unclassified
78 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
79 2784132072 Pseudomonas sp. 460 Isolate Unclassified
80 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
81 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
82 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
83 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
84 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
85 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
86 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
87 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
88 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
89 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
90 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
91 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
92 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
93 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
94 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
95 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
96 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
97 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
98 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
99 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
100 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
101 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
102 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
103 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
104 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
105 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
106 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
107 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
108 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
109 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
110 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
111 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
112 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
113 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
114 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
115 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
116 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
117 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
118 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
119 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
120 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
121 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
122 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
123 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
124 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
125 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
126 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
127 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
128 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
129 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
130 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
131 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
132 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
133 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
134 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
135 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
136 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
137 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
138 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
139 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
140 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
141 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
142 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
143 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
144 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
145 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
146 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
147 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
148 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
149 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
150 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
151 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
152 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
153 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
154 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
157 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
158 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
159 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
162 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
171 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
174 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
175 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
176 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
182 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
183 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
189 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
190 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
191 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
192 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
193 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
203 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
205 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
206 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
230 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
235 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
236 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
237 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
238 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
241 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
253 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
254 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
255 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
259 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
260 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
261 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
262 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
267 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
268 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
269 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
270 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
271 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
272 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
273 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
274 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
275 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
278 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
279 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
280 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
287 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
288 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
291 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
292 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
297 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
298 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
299 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
300 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
301 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
306 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
307 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
308 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
309 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
310 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
311 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
312 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
322 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
326 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
331 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
332 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
333 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
340 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
343 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
344 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
345 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
346 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
347 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
348 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
349 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
350 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
351 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
352 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
353 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
354 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
355 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
356 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
357 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
358 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
370 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
373 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
378 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
379 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
380 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
381 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
382 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
383 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
384 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
385 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
386 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
387 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
388 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
389 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
390 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
391 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
392 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
393 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
394 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
395 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
396 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
397 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
398 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.99
Metatranscriptomes 0
Isolates 19.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 5.51
Nodule 1.52
Rhizoplane 8.26
Rhizosphere 72.31
Stem 0
Stem Tuber 0
Unclassified 12.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_727 2124908027 Bacteria 23550
2 SwRhRL2b_contig_1615826 2162886007 Bacteria 1639
3 JGI25162J39368_1000195 3300002737 Bacteria 63625
4 JGI25154J39366_1012163 3300002738 Bacteria 959
5 JGI25163J39215_1000579 3300002771 Bacteria 10320
6 JGI25164J39214_1000225 3300002772 Bacteria 44028
7 JGI25165J46597_1000291 3300003214 Bacteria 63625
8 rootL2_10071690 3300003322 Bacteria 2275
9 rootL2_10105701 3300003322 Bacteria 1612
10 Ga0055538_1000267 3300003751 Bacteria 27438
11 Ga0055539_1000295 3300003752 Bacteria 27433
12 Ga0055533_1000065 3300003756 Bacteria 166911
13 Ga0055532_1000322 3300003758 Bacteria 27406
14 Ga0055525_1000083 3300003759 Bacteria 157373
15 Ga0055535_1004161 3300003761 Bacteria 3667
16 Ga0055529_1000462 3300003763 Bacteria 39388
17 Ga0055530_10000689 3300003791 Bacteria 28611
18 Ga0055540_1000535 3300003792 Bacteria 28611
19 Ga0055541_1000040 3300003841 Bacteria 166911
20 Ga0065714_10000168 3300005288 Bacteria 8218
21 Ga0065714_10002357 3300005288 Bacteria 27822
22 Ga0065714_10175277 3300005288 Bacteria 983
23 Ga0065714_10503449 3300005288 Bacteria 522
24 Ga0065704_10070617 3300005289 Bacteria 19040
25 Ga0065704_10117922 3300005289 Bacteria 1826
26 Ga0065704_10258281 3300005289 Bacteria 972
27 Ga0065712_10008795 3300005290 Bacteria 2179
28 Ga0065715_10024237 3300005293 Bacteria 1282
29 Ga0065715_10689073 3300005293 Bacteria 659
30 Ga0070670_100001525 3300005331 Bacteria 18646
31 Ga0070668_100143273 3300005347 Bacteria 1927
32 Ga0070669_100293682 3300005353 Bacteria 1305
33 Ga0070674_100151358 3300005356 Bacteria 1751
34 Ga0070673_100533701 3300005364 Bacteria 1064
35 Ga0070667_100076790 3300005367 Bacteria 2852
36 Ga0070663_100136478 3300005455 Bacteria 1868
37 Ga0070706_100215203 3300005467 Bacteria 1794
38 Ga0070706_101719335 3300005467 Bacteria 571
39 Ga0070697_101989901 3300005536 Bacteria 520
40 Ga0075368_10304288 3300006042 Bacteria 688
41 Ga0075364_10043351 3300006051 Bacteria 2925
42 Ga0075364_10267456 3300006051 Bacteria 1162
43 Ga0075364_10725105 3300006051 Bacteria 678
44 Ga0075432_10037846 3300006058 Bacteria 1680
45 Ga0075362_10054820 3300006177 Bacteria 1793
46 Ga0075436_100302451 3300006914 Bacteria 1147
47 Ga0099823_1035910 3300006944 Bacteria 3838
48 Ga0079104_1000580 3300006946 Bacteria 36883
49 Ga0079104_1010442 3300006946 Bacteria 3061
50 Ga0099826_10003389 3300006948 Bacteria 10787
51 Ga0105251_10000400 3300009011 Bacteria 42392
52 Ga0105251_10007164 3300009011 Bacteria 6933
53 Ga0105251_10011432 3300009011 Bacteria 5074
54 Ga0105251_10085373 3300009011 Bacteria 1455
55 Ga0105251_10105636 3300009011 Bacteria 1286
56 Ga0105251_10164698 3300009011 Bacteria 999
57 Ga0105244_10000571 3300009036 Bacteria 33026
58 Ga0105244_10003191 3300009036 Bacteria 11894
59 Ga0105244_10008931 3300009036 Bacteria 6206
60 Ga0105244_10011441 3300009036 Bacteria 5321
61 Ga0105244_10014876 3300009036 Bacteria 4480
62 Ga0105244_10017095 3300009036 Bacteria 4110
63 Ga0105244_10025821 3300009036 Bacteria 3186
64 Ga0105244_10029972 3300009036 Bacteria 2900
65 Ga0105244_10037831 3300009036 Bacteria 2519
66 Ga0105244_10104872 3300009036 Bacteria 1380
67 Ga0105244_10203916 3300009036 Bacteria 932
68 Ga0105244_10220533 3300009036 Bacteria 889
69 Ga0105244_10447917 3300009036 Bacteria 594
70 Ga0105250_10077131 3300009092 Bacteria 1349
71 Ga0105250_10082724 3300009092 Bacteria 1302
72 Ga0105250_10099084 3300009092 Bacteria 1189
73 Ga0105245_10276311 3300009098 Bacteria 1640
74 Ga0105243_10000225 3300009148 Bacteria 65179
75 Ga0105243_10007889 3300009148 Bacteria 8176
76 Ga0105243_10113506 3300009148 Bacteria 2272
77 Ga0105243_10228153 3300009148 Bacteria 1650
78 Ga0105241_11308807 3300009174 Bacteria 690
79 Ga0105242_10159756 3300009176 Bacteria 1971
80 Ga0105242_11218609 3300009176 Bacteria 773
81 Ga0105248_10003881 3300009177 Bacteria 16523
82 Ga0105238_10969377 3300009551 Bacteria 871
83 Ga0105249_10009810 3300009553 Bacteria 8392
84 Ga0105246_11053400 3300011119 Bacteria 740
85 Ga0157345_1027256 3300012498 Bacteria 620
86 Ga0157373_10000305 3300013100 Bacteria 39678
87 Ga0157373_10012441 3300013100 Bacteria 6256
88 Ga0157373_10033274 3300013100 Bacteria 3710
89 Ga0157373_10237438 3300013100 Bacteria 1288
90 Ga0157371_10000648 3300013102 Bacteria 41246
91 Ga0157371_10003311 3300013102 Bacteria 14734
92 Ga0157371_10003379 3300013102 Bacteria 14517
93 Ga0157371_10028415 3300013102 Bacteria 4050
94 Ga0157370_10005104 3300013104 Bacteria 14808
95 Ga0157370_10055914 3300013104 Bacteria 3757
96 Ga0157370_10061179 3300013104 Bacteria 3574
97 Ga0157370_10480057 3300013104 Bacteria 1142
98 Ga0157369_10001225 3300013105 Bacteria 31970
99 Ga0157369_10004980 3300013105 Bacteria 15564
100 Ga0157369_10006448 3300013105 Bacteria 13603
101 Ga0157369_10033106 3300013105 Bacteria 5682
102 Ga0157369_10091235 3300013105 Bacteria 3252
103 Ga0157374_10754818 3300013296 Bacteria 988
104 Ga0157378_10773875 3300013297 Bacteria 984
105 Ga0163162_10007954 3300013306 Bacteria 10339
106 Ga0163162_10067177 3300013306 Bacteria 3635
107 Ga0157372_10003237 3300013307 Bacteria 17594
108 Ga0157372_10584345 3300013307 Bacteria 1302
109 Ga0157375_10001163 3300013308 Bacteria 22743
110 Ga0157375_10004898 3300013308 Bacteria 11636
111 Ga0157375_10234817 3300013308 Bacteria 1993
112 Ga0157375_11769486 3300013308 Bacteria 732
113 Ga0163163_11878591 3300014325 Bacteria 659
114 Ga0182008_10019749 3300014497 Bacteria 3474
115 Ga0157379_11548530 3300014968 Bacteria 646
116 Ga0182006_1001648 3300015261 Bacteria 13162
117 Ga0182006_1001723 3300015261 Bacteria 12725
118 Ga0182006_1021586 3300015261 Bacteria 2683
119 Ga0182006_1060333 3300015261 Bacteria 1433
120 Ga0182006_1082202 3300015261 Bacteria 1173
121 Ga0182007_10000375 3300015262 Bacteria 28103
122 Ga0182005_1001375 3300015265 Bacteria 9907
123 Ga0182005_1265821 3300015265 Bacteria 535
124 Ga0163161_10025875 3300017792 Bacteria 4155
125 Ga0163161_10052410 3300017792 Bacteria 2957
126 Ga0163161_10239656 3300017792 Bacteria 1410
127 Ga0163161_10491405 3300017792 Bacteria 998
128 Ga0163161_10492032 3300017792 Bacteria 997
129 Ga0163161_11455665 3300017792 Bacteria 600
130 Ga0213876_10426534 3300021384 Bacteria 705
131 Ga0213875_10275436 3300021388 Unclassified 794
132 Ga0209435_101590 3300025206 Bacteria 2803
133 Ga0209760_100031 3300025207 Bacteria 141487
134 Ga0209784_100028 3300025224 Bacteria 357464
135 Ga0209566_100028 3300025225 Bacteria 357464
136 Ga0209674_100047 3300025226 Bacteria 357464
137 Ga0209147_100031 3300025229 Bacteria 357464
138 Ga0209563_100050 3300025230 Bacteria 357464
139 Ga0207427_100067 3300025231 Bacteria 164839
140 Ga0209437_100016 3300025233 Bacteria 710118
141 Ga0209258_100170 3300025242 Bacteria 145191
142 Ga0209646_1000444 3300025246 Bacteria 22148
143 Ga0209677_100029 3300025253 Bacteria 357464
144 Ga0209759_1020143 3300025256 Bacteria 1559
145 Ga0209233_1000156 3300025261 Bacteria 164839
146 Ga0209455_1000121 3300025272 Bacteria 173350
147 Ga0209676_1000426 3300025292 Bacteria 73938
148 Ga0209676_1000534 3300025292 Bacteria 59125
149 Ga0209050_1001272 3300025298 Bacteria 28964
150 Ga0209051_1000206 3300025303 Bacteria 104064
151 Ga0209257_1013385 3300025304 Bacteria 3657
152 Ga0207696_1034388 3300025711 Bacteria 1514
153 Ga0207696_1047951 3300025711 Bacteria 1230
154 Ga0207696_1049995 3300025711 Bacteria 1198
155 Ga0207696_1075538 3300025711 Bacteria 934
156 Ga0207655_1000014 3300025728 Bacteria 607124
157 Ga0207655_1000532 3300025728 Bacteria 48217
158 Ga0207655_1000715 3300025728 Bacteria 37724
159 Ga0207655_1002812 3300025728 Bacteria 13497
160 Ga0207655_1003033 3300025728 Bacteria 12823
161 Ga0207655_1005774 3300025728 Bacteria 8339
162 Ga0207655_1009120 3300025728 Bacteria 6205
163 Ga0207655_1017777 3300025728 Bacteria 3818
164 Ga0207655_1027401 3300025728 Bacteria 2715
165 Ga0207655_1057534 3300025728 Bacteria 1526
166 Ga0207655_1093252 3300025728 Bacteria 1055
167 Ga0207713_1000540 3300025735 Bacteria 37977
168 Ga0207713_1001991 3300025735 Bacteria 15370
169 Ga0207713_1004877 3300025735 Bacteria 8590
170 Ga0207713_1018289 3300025735 Bacteria 3475
171 Ga0207713_1029199 3300025735 Bacteria 2475
172 Ga0207713_1076410 3300025735 Bacteria 1219
173 Ga0207713_1076906 3300025735 Bacteria 1213
174 Ga0207713_1076924 3300025735 Bacteria 1213
175 Ga0207680_10142542 3300025903 Bacteria 1590
176 Ga0207681_10301372 3300025923 Bacteria 1268
177 Ga0207681_10998270 3300025923 Bacteria 702
178 Ga0207694_10664415 3300025924 Bacteria 878
179 Ga0207650_10000073 3300025925 Bacteria 137141
180 Ga0207687_10451196 3300025927 Bacteria 1066
181 Ga0207706_10736066 3300025933 Bacteria 841
182 Ga0207686_10073608 3300025934 Bacteria 2205
183 Ga0207709_10000366 3300025935 Bacteria 45478
184 Ga0207709_10003976 3300025935 Bacteria 8624
185 Ga0207709_10096013 3300025935 Bacteria 1949
186 Ga0207709_10142204 3300025935 Bacteria 1650
187 Ga0207669_10261762 3300025937 Bacteria 1294
188 Ga0207711_10025731 3300025941 Bacteria 4934
189 Ga0207651_10471496 3300025960 Bacteria 1080
190 Ga0207712_10023432 3300025961 Bacteria 4073
191 Ga0207668_10579152 3300025972 Bacteria 975
192 Ga0207658_10226620 3300025986 Bacteria 1575
193 Ga0207678_10463169 3300026067 Bacteria 1103
194 Ga0209281_1000033 3300027111 Bacteria 383539
195 Ga0209281_1005381 3300027111 Bacteria 3566
196 Ga0209371_1000132 3300027312 Bacteria 122524
197 Ga0209371_1040546 3300027312 Bacteria 947
198 Ga0209983_1018121 3300027665 Bacteria 1461
199 Ga0209813_10220940 3300027866 Bacteria 709
200 Ga0207428_10024625 3300027907 Bacteria 5054
201 Ga0207428_10388827 3300027907 Bacteria 1022
202 Ga0307517_10088988 3300028786 Bacteria 2547
203 Ga0268256_1000106 3300030500 Bacteria 122524
204 Ga0268256_1040738 3300030500 Bacteria 1042
205 Ga0307511_10344644 3300030521 Bacteria 644
206 Ga0316179_1050601 3300030734 Bacteria 4028
207 Ga0316178_1092012 3300030735 Bacteria 40323
208 Ga0316181_1054663 3300030744 Bacteria 2238
209 Ga0307513_10808783 3300031456 Bacteria 643
210 Ga0307408_100000441 3300031548 Bacteria 36650
211 Ga0307408_100008474 3300031548 Bacteria 6790
212 Ga0307408_100497761 3300031548 Bacteria 1066
213 Ga0307408_100575022 3300031548 Bacteria 997
214 Ga0307405_10001479 3300031731 Bacteria 9922
215 Ga0307405_10001499 3300031731 Bacteria 9882
216 Ga0307413_10003987 3300031824 Bacteria 6340
217 Ga0307407_10025104 3300031903 Bacteria 3136
218 Ga0307407_10125928 3300031903 Bacteria 1632
219 Ga0307407_10826770 3300031903 Bacteria 706
220 Ga0307412_10069557 3300031911 Bacteria 2396
221 Ga0307412_10194867 3300031911 Bacteria 1534
222 Ga0307412_10437167 3300031911 Bacteria 1074
223 Ga0307412_11674299 3300031911 Bacteria 582
224 Ga0307409_100016056 3300031995 Bacteria 4940
225 Ga0307409_100441029 3300031995 Bacteria 1254
226 Ga0307414_10020180 3300032004 Bacteria 4148
227 Ga0307414_10063624 3300032004 Bacteria 2623
228 Ga0307414_10240318 3300032004 Bacteria 1499
229 Ga0307414_10670352 3300032004 Bacteria 936
230 Ga0307411_10035304 3300032005 Bacteria 3120
231 Ga0307411_10050653 3300032005 Bacteria 2705
232 Ga0307411_10069651 3300032005 Bacteria 2376
233 Ga0307411_11602616 3300032005 Bacteria 601
234 Ga0395899_0977378 3300037312 Bacteria 512
235 Ga0395901_0000104 3300038443 Bacteria 114939
236 Ga0436365_0722690 3300039437 Bacteria 5697
237 Ga0436365_0849926 3300039437 Bacteria 98452
238 Ga0436365_1762761 3300039437 Bacteria 637
239 Ga0436363_0386876 3300039450 Bacteria 4088
240 Ga0439438_001139 3300041405 Bacteria 11848
241 Ga0439438_002917 3300041405 Bacteria 7099
242 Ga0439438_003496 3300041405 Bacteria 6342
243 Ga0439438_004112 3300041405 Bacteria 5680
244 Ga0439447_001552 3300041407 Bacteria 8394
245 Ga0439447_040188 3300041407 Bacteria 1142
246 Ga0439466_0000583 3300041411 Bacteria 13697
247 Ga0439466_0026609 3300041411 Bacteria 2009
248 Ga0439466_0027776 3300041411 Bacteria 1957
249 Ga0439466_0071565 3300041411 Bacteria 1103
250 Ga0439465_0027238 3300041413 Bacteria 1809
251 Ga0451853_2768710 3300041512 Bacteria 891
252 Ga0439431_0010901 3300041997 Bacteria 2070
253 Ga0439437_033836 3300042000 Bacteria 648
254 Ga0439445_0014600 3300042004 Bacteria 1914
255 Ga0439432_000348 3300042006 Bacteria 16898
256 Ga0439432_001422 3300042006 Bacteria 9005
257 Ga0439432_009369 3300042006 Bacteria 3416
258 Ga0439432_010453 3300042006 Bacteria 3211
259 Ga0439432_013098 3300042006 Bacteria 2824
260 Ga0439451_000192 3300042009 Bacteria 11690
261 Ga0439451_006417 3300042009 Bacteria 2406
262 Ga0439451_043929 3300042009 Bacteria 895
263 Ga0439452_000305 3300042010 Bacteria 31596
264 Ga0439452_005591 3300042010 Bacteria 4029
265 Ga0439452_005880 3300042010 Bacteria 3900
266 Ga0439452_016975 3300042010 Bacteria 1967
267 Ga0439452_036581 3300042010 Bacteria 1175
268 Ga0439456_000241 3300042013 Bacteria 14327
269 Ga0439456_000432 3300042013 Bacteria 9338
270 Ga0439456_005222 3300042013 Bacteria 2636
271 Ga0439463_001213 3300042016 Bacteria 6883
272 Ga0439463_090512 3300042016 Bacteria 787
273 Ga0450911_000337 3300042115 Bacteria 16605
274 Ga0450911_003294 3300042115 Bacteria 2883
275 Ga0450911_016176 3300042115 Bacteria 985
276 Ga0450913_015191 3300042117 Bacteria 663
277 Ga0450919_000223 3300042121 Bacteria 6307
278 Ga0450922_005326 3300042124 Bacteria 1189
279 Ga0450890_000369 3300042127 Bacteria 6580
280 Ga0450891_008222 3300042129 Bacteria 957
281 Ga0450902_004446 3300042137 Bacteria 2087
282 Ga0450903_000573 3300042138 Bacteria 7553
283 Ga0450903_025703 3300042138 Bacteria 899
284 Ga0450903_030546 3300042138 Bacteria 814
285 Ga0450904_010332 3300042139 Bacteria 921
286 Ga0450905_000436 3300042142 Bacteria 5117
287 Ga0450906_000124 3300042145 Bacteria 13539
288 Ga0450906_000338 3300042145 Bacteria 9533
289 Ga0450907_000023 3300042146 Bacteria 73314
290 Ga0450907_000787 3300042146 Bacteria 7917
291 Ga0439446_0004604 3300042156 Bacteria 3499
292 Ga0439446_0008441 3300042156 Bacteria 2735
293 Ga0450908_001020 3300042184 Bacteria 5422
294 Ga0450909_001505 3300042185 Bacteria 3248
295 Ga0439434_0000273 3300042435 Bacteria 14740
296 Ga0439464_0146472 3300042439 Bacteria 737
297 Ga0439460_0000614 3300042461 Bacteria 7861
298 Ga0439460_0001105 3300042461 Bacteria 6296
299 Ga0450916_008376 3300042530 Bacteria 1257
300 Ga0450918_003244 3300042531 Bacteria 3033
301 Ga0450893_0003300 3300042532 Bacteria 2540
302 Ga0439440_0000050 3300042993 Bacteria 14850
303 Ga0439440_0005371 3300042993 Bacteria 2545
304 Ga0495617_000363 3300046452 Bacteria 25020
305 Ga0495617_000371 3300046452 Bacteria 24874
306 Ga0495617_026399 3300046452 Bacteria 1955
307 Ga0495617_067533 3300046452 Bacteria 1177
308 Ga0495603_0009093 3300046455 Bacteria 6005
309 Ga0495603_0044482 3300046455 Bacteria 2649
310 Ga0495603_0045469 3300046455 Bacteria 2618
311 Ga0495603_0128046 3300046455 Bacteria 1479
312 Ga0495603_0197221 3300046455 Bacteria 1164
313 Ga0495603_0229056 3300046455 Bacteria 1071
314 Ga0495590_0001079 3300046457 Bacteria 12015
315 Ga0495629_0034430 3300046459 Bacteria 3580
316 Ga0495638_0002915 3300046460 Bacteria 13661
317 Ga0495638_0052289 3300046460 Bacteria 2544
318 Ga0495638_0084307 3300046460 Bacteria 1923
319 Ga0495638_0092042 3300046460 Bacteria 1825
320 Ga0495653_0117764 3300046463 Bacteria 1897
321 Ga0495650_0002941 3300046471 Bacteria 12910
322 Ga0495650_0015898 3300046471 Bacteria 3840
323 Ga0495650_0018217 3300046471 Bacteria 3495
324 Ga0495582_0035562 3300046473 Bacteria 2740
325 Ga0495605_0003506 3300046474 Bacteria 9331
326 Ga0495605_0005872 3300046474 Bacteria 7093
327 Ga0495605_0026626 3300046474 Bacteria 3004
328 Ga0495605_0033403 3300046474 Bacteria 2610
329 Ga0495605_0202088 3300046474 Bacteria 865
330 Ga0495639_0000045 3300046475 Bacteria 54350
331 Ga0495639_0105608 3300046475 Bacteria 1333
332 Ga0495662_0653983 3300046476 Bacteria 513
333 Ga0495584_0001998 3300046491 Bacteria 11727
334 Ga0495584_0003975 3300046491 Bacteria 7975
335 Ga0495584_0006645 3300046491 Bacteria 6046
336 Ga0495584_0007777 3300046491 Bacteria 5578
337 Ga0495584_0012231 3300046491 Bacteria 4384
338 Ga0495584_0021527 3300046491 Bacteria 3274
339 Ga0495584_0026174 3300046491 Bacteria 2955
340 Ga0495584_0144166 3300046491 Bacteria 1210
341 Ga0495585_0032252 3300046492 Bacteria 2968
342 Ga0495585_0055389 3300046492 Bacteria 2191
343 Ga0495585_0119189 3300046492 Bacteria 1397
344 Ga0495594_0002459 3300046499 Bacteria 9638
345 Ga0495594_0025858 3300046499 Bacteria 3156
346 Ga0495594_0033128 3300046499 Bacteria 2807
347 Ga0495594_0055182 3300046499 Bacteria 2190
348 Ga0495594_0160638 3300046499 Bacteria 1277
349 Ga0495594_0334405 3300046499 Bacteria 862
350 Ga0495594_0553012 3300046499 Bacteria 653
351 Ga0495607_0000273 3300046501 Bacteria 55633
352 Ga0495607_0001088 3300046501 Bacteria 24822
353 Ga0495607_0005119 3300046501 Bacteria 9478
354 Ga0495607_0068632 3300046501 Bacteria 1987
355 Ga0495607_0089148 3300046501 Bacteria 1675
356 Ga0495607_0100942 3300046501 Bacteria 1545
357 Ga0495607_0121022 3300046501 Bacteria 1374
358 Ga0495607_0140437 3300046501 Bacteria 1246
359 Ga0495607_0411387 3300046501 Bacteria 613
360 Ga0495583_0000235 3300046506 Bacteria 91939
361 Ga0495583_0000683 3300046506 Bacteria 43938
362 Ga0495583_0023624 3300046506 Bacteria 3106
363 Ga0495583_0266333 3300046506 Bacteria 685
364 Ga0495606_0000524 3300046507 Bacteria 62049
365 Ga0495606_0001283 3300046507 Bacteria 34807
366 Ga0495606_0274833 3300046507 Bacteria 924
367 Ga0495606_0328021 3300046507 Bacteria 820
368 Ga0495610_0005206 3300046512 Bacteria 9313
369 Ga0495610_0093603 3300046512 Bacteria 1357
370 Ga0495610_0190175 3300046512 Bacteria 848
371 Ga0495616_0001582 3300046513 Bacteria 15619
372 Ga0495616_0002190 3300046513 Bacteria 13066
373 Ga0495616_0011118 3300046513 Bacteria 5169
374 Ga0495630_0213130 3300046517 Bacteria 1474
375 Ga0495631_0040010 3300046518 Bacteria 2078
376 Ga0495631_0088451 3300046518 Bacteria 1334
377 Ga0495631_0213587 3300046518 Bacteria 824
378 Ga0495632_0000408 3300046519 Bacteria 40601
379 Ga0495632_0001886 3300046519 Bacteria 16810
380 Ga0495632_0002087 3300046519 Bacteria 15629
381 Ga0495637_0000087 3300046520 Bacteria 72113
382 Ga0495637_0001534 3300046520 Bacteria 13504
383 Ga0495637_0001573 3300046520 Bacteria 13275
384 Ga0495637_0008137 3300046520 Bacteria 5162
385 Ga0495643_0000159 3300046522 Bacteria 108642
386 Ga0495643_0001221 3300046522 Bacteria 24843
387 Ga0495643_0002132 3300046522 Bacteria 16309
388 Ga0495643_0012769 3300046522 Bacteria 5053
389 Ga0495643_0020971 3300046522 Bacteria 3757
390 Ga0495643_0026151 3300046522 Bacteria 3296
391 Ga0495643_0163039 3300046522 Bacteria 1095
392 Ga0495643_0371837 3300046522 Bacteria 636
393 Ga0495644_0147657 3300046523 Bacteria 899
394 Ga0495648_0000614 3300046524 Bacteria 38113
395 Ga0495648_0028290 3300046524 Bacteria 3736
396 Ga0495648_0084935 3300046524 Bacteria 1790
397 Ga0495648_0168199 3300046524 Bacteria 1126
398 Ga0495666_0011607 3300046526 Bacteria 4391
399 Ga0495666_0035748 3300046526 Bacteria 2420
400 Ga0495666_0038203 3300046526 Bacteria 2335
401 Ga0495666_0057758 3300046526 Bacteria 1857
402 Ga0495642_0000051 3300046528 Bacteria 71226
403 Ga0495642_0064991 3300046528 Bacteria 1518
404 Ga0495642_0284342 3300046528 Bacteria 724
405 Ga0495654_0000074 3300046530 Bacteria 114325
406 Ga0495654_0002203 3300046530 Bacteria 12636
407 Ga0495654_0023690 3300046530 Bacteria 3177
408 Ga0495654_0025879 3300046530 Bacteria 3021
409 Ga0495654_0027841 3300046530 Bacteria 2892
410 Ga0495665_0074862 3300046531 Bacteria 1782
411 Ga0495665_0077400 3300046531 Bacteria 1750
412 Ga0495640_0146020 3300046533 Bacteria 1522
413 Ga0495586_0061144 3300046535 Bacteria 2049
414 Ga0495587_0010667 3300046536 Bacteria 5836
415 Ga0495609_0000469 3300046538 Bacteria 32618
416 Ga0495609_0002380 3300046538 Bacteria 11583
417 Ga0495597_0000254 3300046542 Bacteria 48567
418 Ga0495597_0005584 3300046542 Bacteria 6636
419 Ga0495597_0015136 3300046542 Bacteria 3656
420 Ga0495597_0021670 3300046542 Bacteria 2986
421 Ga0495597_0031403 3300046542 Bacteria 2417
422 Ga0495597_0141116 3300046542 Bacteria 993
423 Ga0495622_0000501 3300046557 Bacteria 24481
424 Ga0495622_0002067 3300046557 Bacteria 9809
425 Ga0495622_0004949 3300046557 Bacteria 6171
426 Ga0495622_0010144 3300046557 Bacteria 4356
427 Ga0495622_0035044 3300046557 Bacteria 2340
428 Ga0495622_0035169 3300046557 Bacteria 2337
429 Ga0495622_0050145 3300046557 Bacteria 1937
430 Ga0495622_0383772 3300046557 Bacteria 606
431 Ga0495622_0493528 3300046557 Bacteria 524
432 Ga0495633_0025551 3300046558 Bacteria 2906
433 Ga0495633_0306715 3300046558 Bacteria 721
434 Ga0495656_0206660 3300046615 Bacteria 976
435 Ga0495668_0099915 3300046616 Bacteria 1587
436 Ga0495634_0105447 3300046642 Bacteria 1817
437 Ga0495611_0130712 3300046648 Bacteria 1171
438 Ga0495611_0155004 3300046648 Bacteria 1069
439 Ga0495611_0185232 3300046648 Bacteria 972
440 Ga0495625_0034662 3300046660 Bacteria 3724
441 Ga0495625_0057705 3300046660 Bacteria 2759
442 Ga0495625_0132388 3300046660 Bacteria 1688
443 Ga0495625_0147625 3300046660 Bacteria 1582
444 Ga0495625_0418118 3300046660 Bacteria 834
445 Ga0495625_0419737 3300046660 Bacteria 832
446 Ga0495659_0000509 3300046664 Bacteria 14330
447 Ga0495659_0006077 3300046664 Bacteria 3817
448 Ga0495659_0047930 3300046664 Bacteria 1546
449 Ga0495661_0040249 3300046665 Bacteria 2900
450 Ga0495661_0297219 3300046665 Bacteria 809
451 Ga0495661_0398636 3300046665 Bacteria 669
452 Ga0495588_0097152 3300046674 Bacteria 1545
453 Ga0495588_0109494 3300046674 Bacteria 1454
454 Ga0495588_0117281 3300046674 Unclassified 1403
455 Ga0495588_0136978 3300046674 Bacteria 1292
456 Ga0495588_0359982 3300046674 Bacteria 764
457 Ga0495588_0392847 3300046674 Bacteria 728
458 Ga0495623_0060019 3300046679 Bacteria 2387
459 Ga0495623_0072382 3300046679 Bacteria 2143
460 Ga0495624_0005841 3300046690 Bacteria 8806
461 Ga0495670_0000711 3300046691 Bacteria 15847
462 Ga0495670_0028001 3300046691 Bacteria 2793
463 Ga0495670_0057440 3300046691 Bacteria 1954
464 Ga0495670_0090287 3300046691 Bacteria 1567
465 Ga0495670_0155327 3300046691 Bacteria 1200
466 Ga0495671_0001196 3300046692 Bacteria 17772
467 Ga0495671_0001566 3300046692 Bacteria 15187
468 Ga0495671_0004836 3300046692 Bacteria 7962
469 Ga0495671_0030582 3300046692 Bacteria 2756
470 Ga0495649_0000222 3300046694 Bacteria 50180
471 Ga0495649_0000280 3300046694 Bacteria 44939
472 Ga0495649_0005636 3300046694 Bacteria 7912
473 Ga0495649_0343995 3300046694 Bacteria 754
474 Ga0495589_0000348 3300046794 Bacteria 36271
475 Ga0495589_0066218 3300046794 Bacteria 1769
476 Ga0495589_0552448 3300046794 Bacteria 525
477 Ga0495600_0074589 3300046809 Bacteria 2215
478 Ga0495600_0601768 3300046809 Bacteria 668
479 Ga0495660_0030729 3300046810 Bacteria 3025
480 Ga0495660_0048036 3300046810 Bacteria 2335
481 Ga0495660_0080791 3300046810 Bacteria 1705
482 Ga0495660_0082272 3300046810 Bacteria 1686
483 Ga0495660_0160510 3300046810 Bacteria 1103
484 Ga0495581_0068503 3300047315 Bacteria 2052
485 Ga0495581_0073787 3300047315 Bacteria 1974
486 Ga0495581_0085768 3300047315 Bacteria 1825
487 Ga0495581_0099111 3300047315 Bacteria 1693
488 Ga0495604_0309277 3300047317 Bacteria 1059
489 Ga0495604_1052332 3300047317 Bacteria 501
490 Ga0495636_0000564 3300047318 Bacteria 13616
491 Ga0495636_0002822 3300047318 Bacteria 6703
492 Ga0495636_0044635 3300047318 Bacteria 1846
493 Ga0495674_0016113 3300047319 Bacteria 6976
494 Ga0495674_0200025 3300047319 Bacteria 1658
495 Ga0495672_0003116 3300047320 Bacteria 14469
496 Ga0495672_0004114 3300047320 Bacteria 12113
497 Ga0495672_0004346 3300047320 Bacteria 11663
498 Ga0495672_0067356 3300047320 Bacteria 2039
499 Ga0495676_0135387 3300047321 Unclassified 1772
500 Ga0495676_0954859 3300047321 Bacteria 548
501 Ga0495680_0122709 3300047322 Bacteria 1917
502 Ga0495683_0000542 3300047323 Bacteria 28674
503 Ga0495683_0041062 3300047323 Bacteria 2335
504 Ga0495683_0094916 3300047323 Bacteria 1441
505 Ga0495687_000721 3300047443 Bacteria 36612
506 Ga0495687_009090 3300047443 Bacteria 5596
507 Ga0495687_145260 3300047443 Bacteria 819
508 Ga0495677_0001398 3300047445 Bacteria 9672
509 Ga0495677_0013090 3300047445 Bacteria 3019
510 Ga0495677_0067007 3300047445 Bacteria 1336
511 Ga0495679_030984 3300047446 Bacteria 1730
512 Ga0495679_038725 3300047446 Bacteria 1491
513 Ga0495685_070349 3300047447 Bacteria 1172
514 Ga0495685_168788 3300047447 Bacteria 707
515 Ga0495673_0000236 3300047469 Bacteria 79618
516 Ga0495673_0001540 3300047469 Bacteria 18124
517 Ga0495673_0001969 3300047469 Bacteria 15199
518 Ga0495673_0013858 3300047469 Bacteria 4213
519 Ga0495673_0029929 3300047469 Bacteria 2564
520 Ga0495681_0000171 3300047470 Bacteria 54448
521 Ga0495681_0004947 3300047470 Bacteria 8994
522 Ga0495681_0016962 3300047470 Bacteria 4061
523 Ga0495681_0083492 3300047470 Bacteria 1422
524 Ga0495681_0248804 3300047470 Bacteria 702
525 Ga0495686_0137430 3300047472 Bacteria 1444
526 Ga0495593_0024700 3300047673 Bacteria 3328
527 Ga0495593_0079587 3300047673 Bacteria 1696
528 Ga0495593_0317806 3300047673 Bacteria 778
529 Ga0495626_0002512 3300048091 Bacteria 12647
530 Ga0495626_0018502 3300048091 Bacteria 3497
531 Ga0495626_0040051 3300048091 Bacteria 2214
532 Ga0495626_0057883 3300048091 Bacteria 1772
533 Ga0496102_0015332 3300048905 Bacteria 6674
534 Ga0496104_0265523 3300048907 Bacteria 1629
535 Ga0496105_0175587 3300048908 Bacteria 1755
536 Ga0496106_0162397 3300048909 Bacteria 1767
537 Ga0496107_0521854 3300048910 Bacteria 881
538 Ga0496111_0821883 3300048914 Bacteria 672
539 Ga0496114_0024698 3300048917 Bacteria 4906
540 Ga0496114_0037718 3300048917 Bacteria 3998
541 Ga0496115_0014669 3300048918 Bacteria 5934
542 Ga0496115_0363825 3300048918 Bacteria 1178
543 Ga0496115_0385167 3300048918 Bacteria 1140
544 Ga0496115_0528345 3300048918 Bacteria 945
545 Ga0496115_0877530 3300048918 Bacteria 693
546 Ga0496116_0000338 3300048919 Bacteria 75100
547 Ga0496116_0001034 3300048919 Bacteria 33983
548 Ga0496116_0078254 3300048919 Bacteria 2063
549 Ga0496117_0004165 3300048920 Bacteria 16165
550 Ga0496117_0004412 3300048920 Bacteria 15544
551 Ga0496117_0005165 3300048920 Bacteria 13929
552 Ga0496117_0079192 3300048920 Bacteria 2166
553 Ga0496118_0002192 3300048921 Bacteria 27140
554 Ga0496118_0414863 3300048921 Bacteria 694
555 Ga0496119_0000652 3300048922 Bacteria 46693
556 Ga0496119_0057393 3300048922 Bacteria 2352
557 Ga0496120_0010240 3300048923 Bacteria 6563
558 Ga0496120_0050162 3300048923 Bacteria 2390
559 Ga0496121_0000713 3300048924 Bacteria 61654
560 Ga0496121_0075092 3300048924 Bacteria 2702
561 Ga0496121_0191894 3300048924 Bacteria 1464
562 Ga0496122_0001163 3300048925 Bacteria 45014
563 Ga0496122_0006952 3300048925 Bacteria 12751
564 Ga0496122_0163841 3300048925 Bacteria 1351
565 Ga0496122_0182475 3300048925 Bacteria 1250
566 Ga0496123_0002157 3300048926 Bacteria 25145
567 Ga0496123_0003594 3300048926 Bacteria 17170
568 Ga0496124_0001078 3300048927 Bacteria 43125
569 Ga0496124_0018596 3300048927 Bacteria 6503
570 Ga0496124_0050780 3300048927 Bacteria 3531
571 Ga0496124_0112819 3300048927 Bacteria 2185
572 Ga0496124_0149566 3300048927 Bacteria 1834
573 Ga0496124_0294546 3300048927 Bacteria 1175
574 Ga0496125_0035487 3300048928 Bacteria 4372
575 Ga0496125_0041465 3300048928 Bacteria 3934
576 Ga0496125_0043972 3300048928 Bacteria 3784
577 Ga0496125_0060020 3300048928 Bacteria 3060
578 Ga0496126_0009230 3300048929 Bacteria 10516
579 Ga0496126_1267943 3300048929 Bacteria 538
580 Ga0495678_000979 3300049459 Bacteria 24551
581 Ga0495678_015533 3300049459 Bacteria 3499
582 Ga0495678_068239 3300049459 Bacteria 1311
583 Ga0495682_0029161 3300049460 Bacteria 2043
584 Ga0495682_0186156 3300049460 Bacteria 737
585 Ga0501241_005235 3300049758 Bacteria 2421
586 nmdc:mga03683_21571_c1 3300050489 Bacteria 2485
587 Ga0500594_0022133 3300053118 Bacteria 1600
588 Ga0500618_000474 3300053125 Bacteria 26046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2510065053 2510285304 124
2 iso_pu_bacteria 2510065055 2510295886 124
3 iso_pu_bacteria 2510065058 2510313515 124
4 iso_pu_bacteria 2773857672 2774132220 124
5 iso_pu_bacteria 2917832318 2917833910 124
6 iso_pu_bacteria 2919125081 2919128430 124
7 iso_pu_bacteria 2974298342 2974298785 124
8 iso_pu_bacteria 2984499530 2984501077 124
9 iso_pu_bacteria 2984504281 2984505475 124
10 iso_pu_bacteria 8016728285 8016732612 124
11 iso_pu_bacteria 3007872151 3007875804 127
12 3300003322 rootL2_10071690 rootL2_100716903 128
13 3300003322 rootL2_10105701 rootL2_101057013 128
14 3300003763 Ga0055529_1000462 Ga0055529_10004625 128
15 3300005293 Ga0065715_10689073 Ga0065715_106890732 128
16 3300005467 Ga0070706_100215203 Ga0070706_1002152032 128
17 3300005467 Ga0070706_101719335 Ga0070706_1017193351 128
18 3300005536 Ga0070697_101989901 Ga0070697_1019899011 128
19 3300006177 Ga0075362_10054820 Ga0075362_100548202 128
20 3300009036 Ga0105244_10014876 Ga0105244_100148762 128
21 3300009036 Ga0105244_10029972 Ga0105244_100299722 128
22 3300013100 Ga0157373_10237438 Ga0157373_102374383 128
23 3300013102 Ga0157371_10000648 Ga0157371_1000064820 128
24 3300013102 Ga0157371_10003311 Ga0157371_100033112 128
25 3300013102 Ga0157371_10028415 Ga0157371_100284152 128
26 3300013105 Ga0157369_10006448 Ga0157369_100064484 128
27 3300013307 Ga0157372_10584345 Ga0157372_105843452 128
28 3300025272 Ga0209455_1000121 Ga0209455_10001214 128
29 3300025728 Ga0207655_1027401 Ga0207655_10274012 128
30 3300025728 Ga0207655_1057534 Ga0207655_10575343 128
31 3300027312 Ga0209371_1040546 Ga0209371_10405462 128
32 3300030500 Ga0268256_1040738 Ga0268256_10407382 128
33 3300030744 Ga0316181_1054663 Ga0316181_10546632 128
34 3300031456 Ga0307513_10808783 Ga0307513_108087832 128
35 3300037312 Ga0395899_0977378 Ga0395899_0977378_49_462 128
36 3300039437 Ga0436365_1762761 Ga0436365_1762761_196_609 128
37 3300042139 Ga0450904_010332 Ga0450904_010332_343_762 128
38 3300046455 Ga0495603_0045469 Ga0495603_0045469_820_1239 128
39 3300046455 Ga0495603_0128046 Ga0495603_0128046_1000_1422 128
40 3300046455 Ga0495603_0229056 Ga0495603_0229056_512_901 128
41 3300046459 Ga0495629_0034430 Ga0495629_0034430_157_567 128
42 3300046463 Ga0495653_0117764 Ga0495653_0117764_1168_1590 128
43 3300046471 Ga0495650_0002941 Ga0495650_0002941_35_421 128
44 3300046473 Ga0495582_0035562 Ga0495582_0035562_112_534 128
45 3300046474 Ga0495605_0202088 Ga0495605_0202088_212_607 128
46 3300046476 Ga0495662_0653983 Ga0495662_0653983_60_482 128
47 3300046491 Ga0495584_0012231 Ga0495584_0012231_1382_1777 128
48 3300046491 Ga0495584_0026174 Ga0495584_0026174_201_590 128
49 3300046491 Ga0495584_0144166 Ga0495584_0144166_729_1151 128
50 3300046492 Ga0495585_0055389 Ga0495585_0055389_391_780 128
51 3300046492 Ga0495585_0119189 Ga0495585_0119189_191_586 128
52 3300046499 Ga0495594_0002459 Ga0495594_0002459_7828_8217 128
53 3300046499 Ga0495594_0033128 Ga0495594_0033128_2003_2422 128
54 3300046499 Ga0495594_0160638 Ga0495594_0160638_297_719 128
55 3300046499 Ga0495594_0334405 Ga0495594_0334405_436_846 128
56 3300046499 Ga0495594_0553012 Ga0495594_0553012_174_593 128
57 3300046501 Ga0495607_0121022 Ga0495607_0121022_803_1198 128
58 3300046506 Ga0495583_0000235 Ga0495583_0000235_10201_10623 128
59 3300046506 Ga0495583_0266333 Ga0495583_0266333_54_449 128
60 3300046517 Ga0495630_0213130 Ga0495630_0213130_220_642 128
61 3300046518 Ga0495631_0040010 Ga0495631_0040010_1504_1893 128
62 3300046520 Ga0495637_0000087 Ga0495637_0000087_67415_67801 128
63 3300046522 Ga0495643_0026151 Ga0495643_0026151_2785_3180 128
64 3300046523 Ga0495644_0147657 Ga0495644_0147657_397_792 128
65 3300046526 Ga0495666_0011607 Ga0495666_0011607_1771_2193 128
66 3300046526 Ga0495666_0035748 Ga0495666_0035748_1397_1786 128
67 3300046526 Ga0495666_0038203 Ga0495666_0038203_1798_2220 128
68 3300046526 Ga0495666_0057758 Ga0495666_0057758_998_1408 128
69 3300046528 Ga0495642_0284342 Ga0495642_0284342_39_458 128
70 3300046530 Ga0495654_0000074 Ga0495654_0000074_74332_74718 128
71 3300046531 Ga0495665_0074862 Ga0495665_0074862_329_739 128
72 3300046531 Ga0495665_0077400 Ga0495665_0077400_1250_1672 128
73 3300046533 Ga0495640_0146020 Ga0495640_0146020_964_1386 128
74 3300046535 Ga0495586_0061144 Ga0495586_0061144_252_674 128
75 3300046536 Ga0495587_0010667 Ga0495587_0010667_4349_4771 128
76 3300046542 Ga0495597_0015136 Ga0495597_0015136_2691_3107 128
77 3300046557 Ga0495622_0004949 Ga0495622_0004949_3103_3522 128
78 3300046557 Ga0495622_0035044 Ga0495622_0035044_86_508 128
79 3300046557 Ga0495622_0035169 Ga0495622_0035169_884_1294 128
80 3300046557 Ga0495622_0050145 Ga0495622_0050145_701_1123 128
81 3300046557 Ga0495622_0493528 Ga0495622_0493528_80_475 128
82 3300046558 Ga0495633_0306715 Ga0495633_0306715_317_706 128
83 3300046616 Ga0495668_0099915 Ga0495668_0099915_1003_1404 128
84 3300046642 Ga0495634_0105447 Ga0495634_0105447_197_619 128
85 3300046648 Ga0495611_0155004 Ga0495611_0155004_362_751 128
86 3300046660 Ga0495625_0147625 Ga0495625_0147625_208_669 128
87 3300046665 Ga0495661_0398636 Ga0495661_0398636_49_465 128
88 3300046674 Ga0495588_0109494 Ga0495588_0109494_436_846 128
89 3300046674 Ga0495588_0117281 Ga0495588_0117281_316_735 128
90 3300046674 Ga0495588_0136978 Ga0495588_0136978_54_476 128
91 3300046679 Ga0495623_0060019 Ga0495623_0060019_157_564 128
92 3300046679 Ga0495623_0072382 Ga0495623_0072382_1054_1476 128
93 3300046690 Ga0495624_0005841 Ga0495624_0005841_6376_6798 128
94 3300046691 Ga0495670_0155327 Ga0495670_0155327_175_564 128
95 3300046694 Ga0495649_0343995 Ga0495649_0343995_25_444 128
96 3300046794 Ga0495589_0552448 Ga0495589_0552448_49_438 128
97 3300046809 Ga0495600_0074589 Ga0495600_0074589_205_627 128
98 3300046809 Ga0495600_0601768 Ga0495600_0601768_49_477 128
99 3300047315 Ga0495581_0073787 Ga0495581_0073787_1323_1745 128
100 3300047315 Ga0495581_0085768 Ga0495581_0085768_1201_1623 128
101 3300047315 Ga0495581_0099111 Ga0495581_0099111_35_463 128
102 3300047317 Ga0495604_0309277 Ga0495604_0309277_221_640 128
103 3300047317 Ga0495604_1052332 Ga0495604_1052332_34_456 128
104 3300047318 Ga0495636_0000564 Ga0495636_0000564_4927_5316 128
105 3300047319 Ga0495674_0016113 Ga0495674_0016113_205_615 128
106 3300047319 Ga0495674_0200025 Ga0495674_0200025_1221_1643 128
107 3300047321 Ga0495676_0135387 Ga0495676_0135387_150_569 128
108 3300047321 Ga0495676_0954859 Ga0495676_0954859_86_496 128
109 3300047322 Ga0495680_0122709 Ga0495680_0122709_477_905 128
110 3300047323 Ga0495683_0094916 Ga0495683_0094916_281_676 128
111 3300047443 Ga0495687_145260 Ga0495687_145260_71_493 128
112 3300047445 Ga0495677_0013090 Ga0495677_0013090_228_617 128
113 3300047445 Ga0495677_0067007 Ga0495677_0067007_157_552 128
114 3300047469 Ga0495673_0013858 Ga0495673_0013858_3499_3894 128
115 3300047673 Ga0495593_0079587 Ga0495593_0079587_289_717 128
116 3300047673 Ga0495593_0317806 Ga0495593_0317806_252_674 128
117 3300048918 Ga0496115_0014669 Ga0496115_0014669_2591_3028 128
118 3300048918 Ga0496115_0363825 Ga0496115_0363825_63_488 128
119 3300048918 Ga0496115_0385167 Ga0496115_0385167_316_738 128
120 3300048918 Ga0496115_0528345 Ga0496115_0528345_436_855 128
121 3300048918 Ga0496115_0877530 Ga0496115_0877530_120_524 128
122 3300048925 Ga0496122_0182475 Ga0496122_0182475_287_673 128
123 3300048929 Ga0496126_0009230 Ga0496126_0009230_6524_6910 128
124 3300050489 nmdc:mga03683_21571_c1 nmdc:mga03683_21571_c1_2062_2454 128
125 3300053125 Ga0500618_000474 Ga0500618_000474_51_437 128
126 iso_pu_bacteria 2597489888 2597861886 128
127 iso_pu_bacteria 2597489889 2597867619 128
128 iso_pu_bacteria 2599185189 2599506646 128
129 iso_pu_bacteria 2600255296 2601692562 128
130 iso_pu_bacteria 2643221571 2643872400 128
131 iso_pu_bacteria 2643221713 2644619910 128
132 iso_pu_bacteria 2721755607 2723246781 128
133 iso_pu_bacteria 2738541294 2738807676 128
134 iso_pu_bacteria 2738541309 2738895036 128
135 iso_pu_bacteria 2738543020 2739289519 128
136 iso_pu_bacteria 2738543021 2739294831 128
137 iso_pu_bacteria 2806310737 2807410244 128
138 iso_pu_bacteria 2806310745 2807458592 128
139 iso_pu_bacteria 2842805378 2842809967 128
140 iso_pu_bacteria 2842826826 2842831410 128
141 iso_pu_bacteria 2842837860 2842842355 128
142 iso_pu_bacteria 2912963787 2912964403 128
143 iso_pu_bacteria 2919155634 2919158706 128
144 iso_pu_bacteria 2929189879 2929190510 128
145 iso_pu_bacteria 2939651529 2939656528 128
146 iso_pu_bacteria 2947233263 2947235397 128
147 iso_pu_bacteria 3007803356 3007806568 128
148 iso_pu_bacteria 8011350971 8011355717 128
149 iso_pu_bacteria 8054347763 8054349912 128
150 iso_pu_bacteria 8055878733 8055880596 128
151 iso_pu_bacteria 8056115690 8056116938 128
152 iso_pu_bacteria 8056120720 8056121490 128
153 iso_pu_bacteria 8056131705 8056132535 128
154 iso_pu_bacteria 8056137416 8056142340 128
155 iso_pu_bacteria 8056148874 8056152698 128
156 3300031548 Ga0307408_100000441 Ga0307408_1000004415 129
157 3300031731 Ga0307405_10001479 Ga0307405_100014799 129
158 iso_pu_bacteria 2511231156 2511822666 129
159 iso_pu_bacteria 2554235341 2555667659 129
160 iso_pu_bacteria 2599185160 2599356879 129
161 iso_pu_bacteria 2599185161 2599363091 129
162 iso_pu_bacteria 2599185162 2599369957 129
163 iso_pu_bacteria 2599185163 2599376200 129
164 iso_pu_bacteria 2599185164 2599381984 129
165 iso_pu_bacteria 2599185165 2599387872 129
166 iso_pu_bacteria 2599185166 2599395602 129
167 iso_pu_bacteria 2599185168 2599407367 129
168 iso_pu_bacteria 2599185181 2599463712 129
169 iso_pu_bacteria 2599185182 2599468940 129
170 iso_pu_bacteria 2599185186 2599492731 129
171 iso_pu_bacteria 2599185212 2599616434 129
172 iso_pu_bacteria 2599185311 2599996816 129
173 iso_pu_bacteria 2599185316 2600025094 129
174 iso_pu_bacteria 2599185317 2600031379 129
175 iso_pu_bacteria 2599185318 2600036924 129
176 iso_pu_bacteria 2599185319 2600045150 129
177 iso_pu_bacteria 2599185322 2600062573 129
178 iso_pu_bacteria 2599185323 2600066609 129
179 iso_pu_bacteria 2599185325 2600078333 129
180 iso_pu_bacteria 2599185356 2600216341 129
181 iso_pu_bacteria 2600254930 2600361097 129
182 iso_pu_bacteria 2600255313 2601776508 129
183 iso_pu_bacteria 2667528171 2671099732 129
184 iso_pu_bacteria 2667528176 2671129125 129
185 iso_pu_bacteria 2675903515 2678261217 129
186 iso_pu_bacteria 2728369097 2729145610 129
187 iso_pu_bacteria 2744054620 2745006528 129
188 iso_pu_bacteria 2818991464 2819705452 129
189 iso_pu_bacteria 2917070673 2917071413 129
190 iso_pu_bacteria 2923586266 2923591733 129
191 iso_pu_bacteria 2931369376 2931371632 129
192 iso_pu_bacteria 2935353572 2935359239 129
193 iso_pu_bacteria 637000220 637318052 129
194 iso_pu_bacteria 8019769354 8019770532 129
195 iso_pu_bacteria 8057798959 8057802939 129
196 3300031995 Ga0307409_100441029 Ga0307409_1004410292 130
197 3300032004 Ga0307414_10240318 Ga0307414_102403182 130
198 iso_pu_bacteria 2643221650 2644285652 130
199 iso_pu_bacteria 2825651385 2825654050 130
200 iso_pu_bacteria 3007419365 3007420232 130
201 3300009036 Ga0105244_10003191 Ga0105244_100031912 131
202 3300013308 Ga0157375_10004898 Ga0157375_100048982 131
203 3300025728 Ga0207655_1002812 Ga0207655_100281210 131
204 iso_pu_bacteria 2651869719 2652545847 131
205 2162886007 SwRhRL2b_contig_1615826 SwRhRL2b_0004.00007110 132
206 3300002738 JGI25154J39366_1012163 JGI25154J39366_10121632 132
207 3300003751 Ga0055538_1000267 Ga0055538_100026722 132
208 3300003752 Ga0055539_1000295 Ga0055539_100029522 132
209 3300003756 Ga0055533_1000065 Ga0055533_100006522 132
210 3300003758 Ga0055532_1000322 Ga0055532_100032222 132
211 3300003759 Ga0055525_1000083 Ga0055525_1000083116 132
212 3300003761 Ga0055535_1004161 Ga0055535_10041612 132
213 3300003841 Ga0055541_1000040 Ga0055541_100004022 132
214 3300005288 Ga0065714_10175277 Ga0065714_101752772 132
215 3300005289 Ga0065704_10117922 Ga0065704_101179222 132
216 3300005331 Ga0070670_100001525 Ga0070670_10000152519 132
217 3300006051 Ga0075364_10267456 Ga0075364_102674562 132
218 3300006058 Ga0075432_10037846 Ga0075432_100378462 132
219 3300006944 Ga0099823_1035910 Ga0099823_10359104 132
220 3300009011 Ga0105251_10007164 Ga0105251_100071647 132
221 3300009011 Ga0105251_10011432 Ga0105251_100114325 132
222 3300009011 Ga0105251_10085373 Ga0105251_100853732 132
223 3300009011 Ga0105251_10105636 Ga0105251_101056362 132
224 3300009036 Ga0105244_10000571 Ga0105244_1000057113 132
225 3300009036 Ga0105244_10008931 Ga0105244_100089314 132
226 3300009036 Ga0105244_10011441 Ga0105244_100114415 132
227 3300009036 Ga0105244_10037831 Ga0105244_100378312 132
228 3300009036 Ga0105244_10104872 Ga0105244_101048722 132
229 3300009036 Ga0105244_10203916 Ga0105244_102039162 132
230 3300009036 Ga0105244_10447917 Ga0105244_104479172 132
231 3300009092 Ga0105250_10077131 Ga0105250_100771312 132
232 3300009092 Ga0105250_10082724 Ga0105250_100827241 132
233 3300009148 Ga0105243_10007889 Ga0105243_100078894 132
234 3300013104 Ga0157370_10480057 Ga0157370_104800572 132
235 3300013105 Ga0157369_10033106 Ga0157369_100331062 132
236 3300013307 Ga0157372_10003237 Ga0157372_100032378 132
237 3300015261 Ga0182006_1082202 Ga0182006_10822022 132
238 3300017792 Ga0163161_10052410 Ga0163161_100524101 132
239 3300017792 Ga0163161_10239656 Ga0163161_102396562 132
240 3300017792 Ga0163161_10492032 Ga0163161_104920321 132
241 3300017792 Ga0163161_11455665 Ga0163161_114556651 132
242 3300025206 Ga0209435_101590 Ga0209435_1015902 132
243 3300025224 Ga0209784_100028 Ga0209784_100028279 132
244 3300025225 Ga0209566_100028 Ga0209566_100028279 132
245 3300025226 Ga0209674_100047 Ga0209674_100047279 132
246 3300025229 Ga0209147_100031 Ga0209147_100031279 132
247 3300025230 Ga0209563_100050 Ga0209563_100050279 132
248 3300025242 Ga0209258_100170 Ga0209258_100170103 132
249 3300025246 Ga0209646_1000444 Ga0209646_10004441 132
250 3300025253 Ga0209677_100029 Ga0209677_100029279 132
251 3300025256 Ga0209759_1020143 Ga0209759_10201431 132
252 3300025292 Ga0209676_1000534 Ga0209676_100053443 132
253 3300025711 Ga0207696_1034388 Ga0207696_10343882 132
254 3300025711 Ga0207696_1047951 Ga0207696_10479511 132
255 3300025711 Ga0207696_1049995 Ga0207696_10499952 132
256 3300025728 Ga0207655_1000532 Ga0207655_100053215 132
257 3300025728 Ga0207655_1000715 Ga0207655_100071515 132
258 3300025728 Ga0207655_1009120 Ga0207655_10091202 132
259 3300025728 Ga0207655_1093252 Ga0207655_10932522 132
260 3300025735 Ga0207713_1000540 Ga0207713_100054011 132
261 3300025735 Ga0207713_1004877 Ga0207713_10048775 132
262 3300025735 Ga0207713_1029199 Ga0207713_10291992 132
263 3300025735 Ga0207713_1076410 Ga0207713_10764101 132
264 3300025735 Ga0207713_1076924 Ga0207713_10769242 132
265 3300025923 Ga0207681_10301372 Ga0207681_103013722 132
266 3300025925 Ga0207650_10000073 Ga0207650_1000007319 132
267 3300025935 Ga0207709_10003976 Ga0207709_100039764 132
268 3300027312 Ga0209371_1000132 Ga0209371_100013214 132
269 3300030500 Ga0268256_1000106 Ga0268256_100010695 132
270 3300030521 Ga0307511_10344644 Ga0307511_103446442 132
271 3300031731 Ga0307405_10001499 Ga0307405_100014992 132
272 3300041512 Ga0451853_2768710 Ga0451853_2768710_245_646 132
273 3300042013 Ga0439456_000241 Ga0439456_000241_869_1273 132
274 3300042142 Ga0450905_000436 Ga0450905_000436_1670_2074 132
275 3300046501 Ga0495607_0005119 Ga0495607_0005119_5520_5921 132
276 3300046501 Ga0495607_0089148 Ga0495607_0089148_636_1037 132
277 3300046507 Ga0495606_0001283 Ga0495606_0001283_31690_32088 132
278 3300046512 Ga0495610_0005206 Ga0495610_0005206_808_1209 132
279 3300046512 Ga0495610_0190175 Ga0495610_0190175_235_636 132
280 3300046519 Ga0495632_0001886 Ga0495632_0001886_15182_15592 132
281 3300046522 Ga0495643_0000159 Ga0495643_0000159_71413_71811 132
282 3300046522 Ga0495643_0001221 Ga0495643_0001221_9338_9793 132
283 3300046522 Ga0495643_0002132 Ga0495643_0002132_13711_14121 132
284 3300046522 Ga0495643_0012769 Ga0495643_0012769_1727_2125 132
285 3300046524 Ga0495648_0000614 Ga0495648_0000614_22521_22976 132
286 3300046530 Ga0495654_0027841 Ga0495654_0027841_1882_2283 132
287 3300046542 Ga0495597_0000254 Ga0495597_0000254_24840_25241 132
288 3300046542 Ga0495597_0021670 Ga0495597_0021670_2078_2482 132
289 3300046660 Ga0495625_0132388 Ga0495625_0132388_1264_1662 132
290 3300046660 Ga0495625_0418118 Ga0495625_0418118_333_731 132
291 3300046692 Ga0495671_0001566 Ga0495671_0001566_6185_6583 132
292 3300046694 Ga0495649_0000222 Ga0495649_0000222_11411_11809 132
293 3300046810 Ga0495660_0082272 Ga0495660_0082272_475_876 132
294 3300046810 Ga0495660_0160510 Ga0495660_0160510_126_524 132
295 3300047446 Ga0495679_038725 Ga0495679_038725_858_1259 132
296 3300047470 Ga0495681_0016962 Ga0495681_0016962_202_600 132
297 3300048917 Ga0496114_0024698 Ga0496114_0024698_3128_3532 132
298 3300048917 Ga0496114_0037718 Ga0496114_0037718_3513_3923 132
299 3300048919 Ga0496116_0078254 Ga0496116_0078254_1398_1808 132
300 3300048920 Ga0496117_0004165 Ga0496117_0004165_13583_13993 132
301 3300048920 Ga0496117_0004412 Ga0496117_0004412_10726_11136 132
302 3300048921 Ga0496118_0002192 Ga0496118_0002192_23430_23840 132
303 3300048922 Ga0496119_0000652 Ga0496119_0000652_13244_13654 132
304 3300048922 Ga0496119_0057393 Ga0496119_0057393_837_1238 132
305 3300048923 Ga0496120_0010240 Ga0496120_0010240_5141_5551 132
306 3300048923 Ga0496120_0050162 Ga0496120_0050162_860_1261 132
307 3300048924 Ga0496121_0191894 Ga0496121_0191894_562_972 132
308 3300048925 Ga0496122_0001163 Ga0496122_0001163_13920_14330 132
309 3300048926 Ga0496123_0002157 Ga0496123_0002157_4015_4425 132
310 3300048927 Ga0496124_0001078 Ga0496124_0001078_31899_32303 132
311 3300048927 Ga0496124_0018596 Ga0496124_0018596_1262_1663 132
312 3300048927 Ga0496124_0050780 Ga0496124_0050780_1605_2015 132
313 3300048927 Ga0496124_0112819 Ga0496124_0112819_1463_1867 132
314 3300048927 Ga0496124_0294546 Ga0496124_0294546_757_1158 132
315 3300048928 Ga0496125_0035487 Ga0496125_0035487_1940_2350 132
316 3300048928 Ga0496125_0041465 Ga0496125_0041465_2274_2675 132
317 3300048929 Ga0496126_1267943 Ga0496126_1267943_43_447 132
318 3300002737 JGI25162J39368_1000195 JGI25162J39368_100019534 133
319 3300002771 JGI25163J39215_1000579 JGI25163J39215_10005792 133
320 3300002772 JGI25164J39214_1000225 JGI25164J39214_100022510 133
321 3300003214 JGI25165J46597_1000291 JGI25165J46597_100029134 133
322 3300003791 Ga0055530_10000689 Ga0055530_1000068927 133
323 3300003792 Ga0055540_1000535 Ga0055540_100053527 133
324 3300009148 Ga0105243_10000225 Ga0105243_1000022530 133
325 3300009553 Ga0105249_10009810 Ga0105249_100098103 133
326 3300013102 Ga0157371_10003379 Ga0157371_1000337911 133
327 3300013308 Ga0157375_11769486 Ga0157375_117694861 133
328 3300025207 Ga0209760_100031 Ga0209760_10003110 133
329 3300025231 Ga0207427_100067 Ga0207427_100067132 133
330 3300025233 Ga0209437_100016 Ga0209437_10001627 133
331 3300025261 Ga0209233_1000156 Ga0209233_1000156132 133
332 3300025298 Ga0209050_1001272 Ga0209050_10012722 133
333 3300025303 Ga0209051_1000206 Ga0209051_100020626 133
334 3300025304 Ga0209257_1013385 Ga0209257_10133852 133
335 3300025735 Ga0207713_1076906 Ga0207713_10769062 133
336 3300025935 Ga0207709_10000366 Ga0207709_1000036629 133
337 3300025961 Ga0207712_10023432 Ga0207712_100234323 133
338 3300031548 Ga0307408_100008474 Ga0307408_1000084747 133
339 3300031548 Ga0307408_100575022 Ga0307408_1005750222 133
340 3300031903 Ga0307407_10025104 Ga0307407_100251042 133
341 3300031911 Ga0307412_10194867 Ga0307412_101948672 133
342 3300032004 Ga0307414_10020180 Ga0307414_100201802 133
343 3300032005 Ga0307411_10050653 Ga0307411_100506532 133
344 3300042117 Ga0450913_015191 Ga0450913_015191_92_493 133
345 3300046452 Ga0495617_000363 Ga0495617_000363_3523_3927 133
346 3300046471 Ga0495650_0018217 Ga0495650_0018217_230_634 133
347 3300046507 Ga0495606_0000524 Ga0495606_0000524_49065_49469 133
348 3300046507 Ga0495606_0274833 Ga0495606_0274833_287_691 133
349 3300046520 Ga0495637_0001534 Ga0495637_0001534_3255_3659 133
350 3300046524 Ga0495648_0084935 Ga0495648_0084935_1080_1484 133
351 3300047469 Ga0495673_0000236 Ga0495673_0000236_66653_67057 133
352 3300047472 Ga0495686_0137430 Ga0495686_0137430_221_625 133
353 3300048919 Ga0496116_0000338 Ga0496116_0000338_45920_46324 133
354 3300048920 Ga0496117_0005165 Ga0496117_0005165_9668_10072 133
355 3300048921 Ga0496118_0414863 Ga0496118_0414863_187_591 133
356 3300048924 Ga0496121_0000713 Ga0496121_0000713_28873_29277 133
357 3300048925 Ga0496122_0163841 Ga0496122_0163841_159_563 133
358 3300048926 Ga0496123_0003594 Ga0496123_0003594_155_559 133
359 3300053118 Ga0500594_0022133 Ga0500594_0022133_656_1060 133
360 iso_pu_bacteria 2511231004 2511258098 133
361 iso_pu_bacteria 2511231007 2511273180 133
362 iso_pu_bacteria 2511231016 2511324326 133
363 iso_pu_bacteria 2511231022 2511361902 133
364 iso_pu_bacteria 2599185188 2599499900 133
365 iso_pu_bacteria 2599185248 2599769632 133
366 iso_pu_bacteria 2599185289 2599887051 133
367 iso_pu_bacteria 2599185291 2599898380 133
368 iso_pu_bacteria 2599185300 2599931111 133
369 iso_pu_bacteria 2599185302 2599944509 133
370 iso_pu_bacteria 2599185304 2599956148 133
371 iso_pu_bacteria 2599185305 2599961126 133
372 iso_pu_bacteria 2599185306 2599964769 133
373 iso_pu_bacteria 2599185308 2599977300 133
374 iso_pu_bacteria 2599185309 2599983086 133
375 iso_pu_bacteria 2599185310 2599991019 133
376 iso_pu_bacteria 2599185312 2600001109 133
377 iso_pu_bacteria 2599185314 2600011468 133
378 iso_pu_bacteria 2599185315 2600019298 133
379 iso_pu_bacteria 2599185320 2600048089 133
380 iso_pu_bacteria 2599185321 2600054357 133
381 iso_pu_bacteria 2599185324 2600073959 133
382 iso_pu_bacteria 2623620446 2624490004 133
383 iso_pu_bacteria 2643221633 2644189998 133
384 iso_pu_bacteria 2667528170 2671090580 133
385 iso_pu_bacteria 2713897148 2715754111 133
386 iso_pu_bacteria 2718217725 2718632398 133
387 iso_pu_bacteria 2757320392 2757571041 133
388 iso_pu_bacteria 2773857670 2774119316 133
389 iso_pu_bacteria 2784132072 2784317096 133
390 iso_pu_bacteria 2791355520 2794594246 133
391 iso_pu_bacteria 2808606361 2808858298 133
392 iso_pu_bacteria 2808606376 2808922522 133
393 iso_pu_bacteria 2808606378 2808938435 133
394 iso_pu_bacteria 2808606380 2808944209 133
395 iso_pu_bacteria 2808606383 2808966783 133
396 iso_pu_bacteria 2808606389 2809001617 133
397 iso_pu_bacteria 2842832357 2842834399 133
398 iso_pu_bacteria 2842843487 2842846122 133
399 iso_pu_bacteria 2913036834 2913037499 133
400 iso_pu_bacteria 2919385768 2919389531 133
401 iso_pu_bacteria 2919456309 2919460228 133
402 iso_pu_bacteria 2919481497 2919486642 133
403 iso_pu_bacteria 2919487758 2919493136 133
404 iso_pu_bacteria 2919697872 2919703893 133
405 iso_pu_bacteria 2929144301 2929145036 133
406 iso_pu_bacteria 2974289157 2974293110 133
407 iso_pu_bacteria 2988728565 2988732424 133
408 iso_pu_bacteria 2998139840 2998140707 133
409 iso_pu_bacteria 3007855910 3007859931 133
410 iso_pu_bacteria 3007866637 3007867250 133
411 iso_pu_bacteria 8019775933 8019782160 133
412 iso_pu_bacteria 8029995093 8030000035 133
413 iso_pu_bacteria 8056155041 8056158749 133
414 iso_pu_bacteria 8056166840 8056170341 133
415 3300005288 Ga0065714_10002357 Ga0065714_1000235726 134
416 3300005289 Ga0065704_10070617 Ga0065704_100706171 134
417 3300009011 Ga0105251_10000400 Ga0105251_1000040022 134
418 3300009036 Ga0105244_10017095 Ga0105244_100170954 134
419 3300009148 Ga0105243_10113506 Ga0105243_101135062 134
420 3300021388 Ga0213875_10275436 Ga0213875_102754362 134
421 3300025728 Ga0207655_1000014 Ga0207655_100001420 134
422 3300025735 Ga0207713_1001991 Ga0207713_10019915 134
423 3300031824 Ga0307413_10003987 Ga0307413_100039871 134
424 3300038443 Ga0395901_0000104 Ga0395901_0000104_85325_85894 134
425 3300039437 Ga0436365_0722690 Ga0436365_0722690_2160_2594 134
426 3300042000 Ga0439437_033836 Ga0439437_033836_44_454 134
427 3300005347 Ga0070668_100143273 Ga0070668_1001432732 135
428 3300005353 Ga0070669_100293682 Ga0070669_1002936822 135
429 3300005356 Ga0070674_100151358 Ga0070674_1001513582 135
430 3300005364 Ga0070673_100533701 Ga0070673_1005337012 135
431 3300005367 Ga0070667_100076790 Ga0070667_1000767902 135
432 3300005455 Ga0070663_100136478 Ga0070663_1001364782 135
433 3300006051 Ga0075364_10043351 Ga0075364_100433513 135
434 3300006946 Ga0079104_1000580 Ga0079104_100058021 135
435 3300006948 Ga0099826_10003389 Ga0099826_100033892 135
436 3300009092 Ga0105250_10099084 Ga0105250_100990842 135
437 3300009148 Ga0105243_10228153 Ga0105243_102281532 135
438 3300009174 Ga0105241_11308807 Ga0105241_113088072 135
439 3300009176 Ga0105242_11218609 Ga0105242_112186091 135
440 3300009177 Ga0105248_10003881 Ga0105248_100038814 135
441 3300009551 Ga0105238_10969377 Ga0105238_109693772 135
442 3300011119 Ga0105246_11053400 Ga0105246_110534001 135
443 3300013296 Ga0157374_10754818 Ga0157374_107548182 135
444 3300013297 Ga0157378_10773875 Ga0157378_107738752 135
445 3300013306 Ga0163162_10007954 Ga0163162_100079548 135
446 3300013308 Ga0157375_10001163 Ga0157375_1000116314 135
447 3300014325 Ga0163163_11878591 Ga0163163_118785911 135
448 3300014968 Ga0157379_11548530 Ga0157379_115485301 135
449 3300017792 Ga0163161_10025875 Ga0163161_100258754 135
450 3300025903 Ga0207680_10142542 Ga0207680_101425422 135
451 3300025923 Ga0207681_10998270 Ga0207681_109982701 135
452 3300025924 Ga0207694_10664415 Ga0207694_106644152 135
453 3300025927 Ga0207687_10451196 Ga0207687_104511961 135
454 3300025933 Ga0207706_10736066 Ga0207706_107360661 135
455 3300025935 Ga0207709_10142204 Ga0207709_101422042 135
456 3300025937 Ga0207669_10261762 Ga0207669_102617622 135
457 3300025941 Ga0207711_10025731 Ga0207711_100257312 135
458 3300025960 Ga0207651_10471496 Ga0207651_104714962 135
459 3300025972 Ga0207668_10579152 Ga0207668_105791522 135
460 3300025986 Ga0207658_10226620 Ga0207658_102266201 135
461 3300026067 Ga0207678_10463169 Ga0207678_104631691 135
462 3300027111 Ga0209281_1000033 Ga0209281_100003321 135
463 3300046455 Ga0495603_0197221 Ga0495603_0197221_123_536 135
464 3300046460 Ga0495638_0002915 Ga0495638_0002915_5525_5938 135
465 3300046474 Ga0495605_0003506 Ga0495605_0003506_3000_3413 135
466 3300046492 Ga0495585_0032252 Ga0495585_0032252_1972_2385 135
467 3300046501 Ga0495607_0411387 Ga0495607_0411387_62_475 135
468 3300046507 Ga0495606_0328021 Ga0495606_0328021_304_717 135
469 3300046542 Ga0495597_0141116 Ga0495597_0141116_189_602 135
470 3300046660 Ga0495625_0419737 Ga0495625_0419737_215_628 135
471 3300046691 Ga0495670_0090287 Ga0495670_0090287_149_562 135
472 3300046810 Ga0495660_0048036 Ga0495660_0048036_1865_2278 135
473 3300047318 Ga0495636_0044635 Ga0495636_0044635_1294_1707 135
474 3300047447 Ga0495685_070349 Ga0495685_070349_145_558 135
475 3300047470 Ga0495681_0083492 Ga0495681_0083492_481_894 135
476 3300048905 Ga0496102_0015332 Ga0496102_0015332_3630_4043 135
477 3300048907 Ga0496104_0265523 Ga0496104_0265523_169_582 135
478 3300048908 Ga0496105_0175587 Ga0496105_0175587_920_1333 135
479 3300048909 Ga0496106_0162397 Ga0496106_0162397_792_1205 135
480 3300048910 Ga0496107_0521854 Ga0496107_0521854_31_444 135
481 3300032004 Ga0307414_10063624 Ga0307414_100636242 136
482 3300041411 Ga0439466_0071565 Ga0439466_0071565_189_602 136
483 3300042009 Ga0439451_043929 Ga0439451_043929_291_704 136
484 3300042010 Ga0439452_005880 Ga0439452_005880_2344_2757 136
485 3300042124 Ga0450922_005326 Ga0450922_005326_37_450 136
486 3300042530 Ga0450916_008376 Ga0450916_008376_403_828 136
487 3300046522 Ga0495643_0371837 Ga0495643_0371837_188_601 136
488 3300046557 Ga0495622_0383772 Ga0495622_0383772_50_463 136
489 3300047320 Ga0495672_0004346 Ga0495672_0004346_9116_9529 136
490 2124908027 MRS2a_Contig_727 MRS2a_00584610 137
491 3300005288 Ga0065714_10000168 Ga0065714_100001685 137
492 3300005288 Ga0065714_10503449 Ga0065714_105034491 137
493 3300005289 Ga0065704_10258281 Ga0065704_102582812 137
494 3300005290 Ga0065712_10008795 Ga0065712_100087952 137
495 3300005293 Ga0065715_10024237 Ga0065715_100242371 137
496 3300006042 Ga0075368_10304288 Ga0075368_103042882 137
497 3300006051 Ga0075364_10725105 Ga0075364_107251051 137
498 3300006914 Ga0075436_100302451 Ga0075436_1003024512 137
499 3300006946 Ga0079104_1010442 Ga0079104_10104422 137
500 3300009011 Ga0105251_10164698 Ga0105251_101646982 137
501 3300009036 Ga0105244_10025821 Ga0105244_100258213 137
502 3300009036 Ga0105244_10220533 Ga0105244_102205332 137
503 3300009098 Ga0105245_10276311 Ga0105245_102763112 137
504 3300009176 Ga0105242_10159756 Ga0105242_101597562 137
505 3300012498 Ga0157345_1027256 Ga0157345_10272562 137
506 3300013100 Ga0157373_10000305 Ga0157373_1000030517 137
507 3300013100 Ga0157373_10012441 Ga0157373_100124416 137
508 3300013100 Ga0157373_10033274 Ga0157373_100332742 137
509 3300013104 Ga0157370_10005104 Ga0157370_1000510414 137
510 3300013104 Ga0157370_10055914 Ga0157370_100559142 137
511 3300013104 Ga0157370_10061179 Ga0157370_100611793 137
512 3300013105 Ga0157369_10001225 Ga0157369_100012253 137
513 3300013105 Ga0157369_10004980 Ga0157369_100049806 137
514 3300013105 Ga0157369_10091235 Ga0157369_100912352 137
515 3300013306 Ga0163162_10067177 Ga0163162_100671773 137
516 3300013308 Ga0157375_10234817 Ga0157375_102348172 137
517 3300014497 Ga0182008_10019749 Ga0182008_100197493 137
518 3300015261 Ga0182006_1001648 Ga0182006_100164811 137
519 3300015261 Ga0182006_1001723 Ga0182006_100172311 137
520 3300015261 Ga0182006_1021586 Ga0182006_10215861 137
521 3300015261 Ga0182006_1060333 Ga0182006_10603332 137
522 3300015262 Ga0182007_10000375 Ga0182007_100003753 137
523 3300015265 Ga0182005_1001375 Ga0182005_10013753 137
524 3300015265 Ga0182005_1265821 Ga0182005_12658212 137
525 3300017792 Ga0163161_10491405 Ga0163161_104914052 137
526 3300021384 Ga0213876_10426534 Ga0213876_104265342 137
527 3300025292 Ga0209676_1000426 Ga0209676_100042641 137
528 3300025711 Ga0207696_1075538 Ga0207696_10755382 137
529 3300025728 Ga0207655_1003033 Ga0207655_100303312 137
530 3300025728 Ga0207655_1005774 Ga0207655_10057742 137
531 3300025728 Ga0207655_1017777 Ga0207655_10177772 137
532 3300025735 Ga0207713_1018289 Ga0207713_10182892 137
533 3300025934 Ga0207686_10073608 Ga0207686_100736082 137
534 3300025935 Ga0207709_10096013 Ga0207709_100960132 137
535 3300027111 Ga0209281_1005381 Ga0209281_10053812 137
536 3300027665 Ga0209983_1018121 Ga0209983_10181212 137
537 3300027866 Ga0209813_10220940 Ga0209813_102209402 137
538 3300027907 Ga0207428_10024625 Ga0207428_100246252 137
539 3300027907 Ga0207428_10388827 Ga0207428_103888272 137
540 3300028786 Ga0307517_10088988 Ga0307517_100889882 137
541 3300030734 Ga0316179_1050601 Ga0316179_10506012 137
542 3300030735 Ga0316178_1092012 Ga0316178_109201226 137
543 3300031548 Ga0307408_100497761 Ga0307408_1004977611 137
544 3300031903 Ga0307407_10125928 Ga0307407_101259282 137
545 3300031903 Ga0307407_10826770 Ga0307407_108267702 137
546 3300031911 Ga0307412_10069557 Ga0307412_100695572 137
547 3300031911 Ga0307412_10437167 Ga0307412_104371672 137
548 3300031911 Ga0307412_11674299 Ga0307412_116742992 137
549 3300031995 Ga0307409_100016056 Ga0307409_1000160563 137
550 3300032004 Ga0307414_10670352 Ga0307414_106703522 137
551 3300032005 Ga0307411_10035304 Ga0307411_100353043 137
552 3300032005 Ga0307411_10069651 Ga0307411_100696512 137
553 3300032005 Ga0307411_11602616 Ga0307411_116026162 137
554 3300039437 Ga0436365_0849926 Ga0436365_0849926_31958_32428 137
555 3300039450 Ga0436363_0386876 Ga0436363_0386876_1368_1838 137
556 3300041405 Ga0439438_001139 Ga0439438_001139_8702_9115 137
557 3300041405 Ga0439438_002917 Ga0439438_002917_409_822 137
558 3300041405 Ga0439438_003496 Ga0439438_003496_4053_4466 137
559 3300041405 Ga0439438_004112 Ga0439438_004112_3101_3514 137
560 3300041407 Ga0439447_001552 Ga0439447_001552_3273_3686 137
561 3300041407 Ga0439447_040188 Ga0439447_040188_123_536 137
562 3300041411 Ga0439466_0000583 Ga0439466_0000583_44_457 137
563 3300041411 Ga0439466_0026609 Ga0439466_0026609_393_806 137
564 3300041411 Ga0439466_0027776 Ga0439466_0027776_295_708 137
565 3300041413 Ga0439465_0027238 Ga0439465_0027238_1276_1689 137
566 3300041997 Ga0439431_0010901 Ga0439431_0010901_1458_1871 137
567 3300042004 Ga0439445_0014600 Ga0439445_0014600_311_724 137
568 3300042006 Ga0439432_000348 Ga0439432_000348_3933_4346 137
569 3300042006 Ga0439432_001422 Ga0439432_001422_6136_6549 137
570 3300042006 Ga0439432_009369 Ga0439432_009369_680_1093 137
571 3300042006 Ga0439432_010453 Ga0439432_010453_2626_3039 137
572 3300042006 Ga0439432_013098 Ga0439432_013098_1569_1982 137
573 3300042009 Ga0439451_000192 Ga0439451_000192_266_679 137
574 3300042009 Ga0439451_006417 Ga0439451_006417_1748_2161 137
575 3300042010 Ga0439452_000305 Ga0439452_000305_2558_2971 137
576 3300042010 Ga0439452_005591 Ga0439452_005591_177_590 137
577 3300042010 Ga0439452_016975 Ga0439452_016975_482_895 137
578 3300042010 Ga0439452_036581 Ga0439452_036581_168_581 137
579 3300042013 Ga0439456_000432 Ga0439456_000432_8403_8816 137
580 3300042013 Ga0439456_005222 Ga0439456_005222_990_1403 137
581 3300042016 Ga0439463_001213 Ga0439463_001213_4098_4511 137
582 3300042016 Ga0439463_090512 Ga0439463_090512_14_427 137
583 3300042115 Ga0450911_000337 Ga0450911_000337_2184_2597 137
584 3300042115 Ga0450911_003294 Ga0450911_003294_651_1064 137
585 3300042115 Ga0450911_016176 Ga0450911_016176_36_449 137
586 3300042121 Ga0450919_000223 Ga0450919_000223_4814_5227 137
587 3300042127 Ga0450890_000369 Ga0450890_000369_3614_4027 137
588 3300042129 Ga0450891_008222 Ga0450891_008222_529_942 137
589 3300042137 Ga0450902_004446 Ga0450902_004446_1597_2010 137
590 3300042138 Ga0450903_000573 Ga0450903_000573_2906_3319 137
591 3300042138 Ga0450903_025703 Ga0450903_025703_61_474 137
592 3300042138 Ga0450903_030546 Ga0450903_030546_198_638 137
593 3300042145 Ga0450906_000124 Ga0450906_000124_2301_2714 137
594 3300042145 Ga0450906_000338 Ga0450906_000338_5412_5825 137
595 3300042146 Ga0450907_000023 Ga0450907_000023_28074_28487 137
596 3300042146 Ga0450907_000787 Ga0450907_000787_5236_5649 137
597 3300042156 Ga0439446_0004604 Ga0439446_0004604_1174_1587 137
598 3300042156 Ga0439446_0008441 Ga0439446_0008441_145_558 137
599 3300042184 Ga0450908_001020 Ga0450908_001020_1432_1845 137
600 3300042185 Ga0450909_001505 Ga0450909_001505_919_1332 137
601 3300042435 Ga0439434_0000273 Ga0439434_0000273_12570_12983 137
602 3300042439 Ga0439464_0146472 Ga0439464_0146472_36_449 137
603 3300042461 Ga0439460_0000614 Ga0439460_0000614_4176_4589 137
604 3300042461 Ga0439460_0001105 Ga0439460_0001105_1505_1918 137
605 3300042531 Ga0450918_003244 Ga0450918_003244_856_1269 137
606 3300042532 Ga0450893_0003300 Ga0450893_0003300_1874_2287 137
607 3300042993 Ga0439440_0000050 Ga0439440_0000050_3282_3695 137
608 3300042993 Ga0439440_0005371 Ga0439440_0005371_740_1153 137
609 3300046452 Ga0495617_000371 Ga0495617_000371_23301_23714 137
610 3300046452 Ga0495617_026399 Ga0495617_026399_301_714 137
611 3300046452 Ga0495617_067533 Ga0495617_067533_32_445 137
612 3300046455 Ga0495603_0009093 Ga0495603_0009093_2396_2809 137
613 3300046455 Ga0495603_0044482 Ga0495603_0044482_416_829 137
614 3300046457 Ga0495590_0001079 Ga0495590_0001079_4520_4933 137
615 3300046460 Ga0495638_0052289 Ga0495638_0052289_210_623 137
616 3300046460 Ga0495638_0084307 Ga0495638_0084307_271_687 137
617 3300046460 Ga0495638_0092042 Ga0495638_0092042_520_933 137
618 3300046471 Ga0495650_0015898 Ga0495650_0015898_2953_3366 137
619 3300046474 Ga0495605_0005872 Ga0495605_0005872_3152_3565 137
620 3300046474 Ga0495605_0026626 Ga0495605_0026626_1583_1996 137
621 3300046474 Ga0495605_0033403 Ga0495605_0033403_624_1037 137
622 3300046475 Ga0495639_0000045 Ga0495639_0000045_43633_44046 137
623 3300046475 Ga0495639_0105608 Ga0495639_0105608_41_454 137
624 3300046491 Ga0495584_0001998 Ga0495584_0001998_10614_11027 137
625 3300046491 Ga0495584_0003975 Ga0495584_0003975_6595_7008 137
626 3300046491 Ga0495584_0006645 Ga0495584_0006645_3292_3705 137
627 3300046491 Ga0495584_0007777 Ga0495584_0007777_2408_2821 137
628 3300046491 Ga0495584_0021527 Ga0495584_0021527_1674_2087 137
629 3300046499 Ga0495594_0025858 Ga0495594_0025858_1181_1594 137
630 3300046499 Ga0495594_0055182 Ga0495594_0055182_574_987 137
631 3300046501 Ga0495607_0000273 Ga0495607_0000273_12316_12729 137
632 3300046501 Ga0495607_0001088 Ga0495607_0001088_23334_23747 137
633 3300046501 Ga0495607_0068632 Ga0495607_0068632_1556_1969 137
634 3300046501 Ga0495607_0100942 Ga0495607_0100942_469_882 137
635 3300046501 Ga0495607_0140437 Ga0495607_0140437_249_662 137
636 3300046506 Ga0495583_0000683 Ga0495583_0000683_18723_19136 137
637 3300046506 Ga0495583_0023624 Ga0495583_0023624_1677_2090 137
638 3300046512 Ga0495610_0093603 Ga0495610_0093603_929_1342 137
639 3300046513 Ga0495616_0001582 Ga0495616_0001582_13021_13434 137
640 3300046513 Ga0495616_0002190 Ga0495616_0002190_10781_11194 137
641 3300046513 Ga0495616_0011118 Ga0495616_0011118_74_487 137
642 3300046518 Ga0495631_0088451 Ga0495631_0088451_501_914 137
643 3300046518 Ga0495631_0213587 Ga0495631_0213587_391_804 137
644 3300046519 Ga0495632_0000408 Ga0495632_0000408_17942_18355 137
645 3300046519 Ga0495632_0002087 Ga0495632_0002087_12934_13347 137
646 3300046520 Ga0495637_0001573 Ga0495637_0001573_10593_11006 137
647 3300046520 Ga0495637_0008137 Ga0495637_0008137_2472_2885 137
648 3300046522 Ga0495643_0020971 Ga0495643_0020971_2593_3006 137
649 3300046522 Ga0495643_0163039 Ga0495643_0163039_24_437 137
650 3300046524 Ga0495648_0028290 Ga0495648_0028290_1196_1609 137
651 3300046524 Ga0495648_0168199 Ga0495648_0168199_543_956 137
652 3300046528 Ga0495642_0000051 Ga0495642_0000051_25828_26241 137
653 3300046528 Ga0495642_0064991 Ga0495642_0064991_165_578 137
654 3300046530 Ga0495654_0002203 Ga0495654_0002203_10147_10560 137
655 3300046530 Ga0495654_0023690 Ga0495654_0023690_2317_2730 137
656 3300046530 Ga0495654_0025879 Ga0495654_0025879_175_588 137
657 3300046538 Ga0495609_0000469 Ga0495609_0000469_27180_27593 137
658 3300046538 Ga0495609_0002380 Ga0495609_0002380_10015_10428 137
659 3300046542 Ga0495597_0005584 Ga0495597_0005584_2261_2674 137
660 3300046542 Ga0495597_0031403 Ga0495597_0031403_545_958 137
661 3300046557 Ga0495622_0000501 Ga0495622_0000501_6384_6797 137
662 3300046557 Ga0495622_0002067 Ga0495622_0002067_2124_2537 137
663 3300046557 Ga0495622_0010144 Ga0495622_0010144_2049_2462 137
664 3300046558 Ga0495633_0025551 Ga0495633_0025551_2203_2616 137
665 3300046615 Ga0495656_0206660 Ga0495656_0206660_85_498 137
666 3300046648 Ga0495611_0130712 Ga0495611_0130712_696_1109 137
667 3300046648 Ga0495611_0185232 Ga0495611_0185232_416_829 137
668 3300046660 Ga0495625_0034662 Ga0495625_0034662_2042_2455 137
669 3300046660 Ga0495625_0057705 Ga0495625_0057705_1520_1933 137
670 3300046664 Ga0495659_0000509 Ga0495659_0000509_3631_4044 137
671 3300046664 Ga0495659_0006077 Ga0495659_0006077_1647_2060 137
672 3300046664 Ga0495659_0047930 Ga0495659_0047930_319_732 137
673 3300046665 Ga0495661_0040249 Ga0495661_0040249_914_1327 137
674 3300046665 Ga0495661_0297219 Ga0495661_0297219_23_436 137
675 3300046674 Ga0495588_0097152 Ga0495588_0097152_52_465 137
676 3300046674 Ga0495588_0359982 Ga0495588_0359982_226_639 137
677 3300046674 Ga0495588_0392847 Ga0495588_0392847_11_424 137
678 3300046691 Ga0495670_0000711 Ga0495670_0000711_13357_13770 137
679 3300046691 Ga0495670_0028001 Ga0495670_0028001_1222_1635 137
680 3300046691 Ga0495670_0057440 Ga0495670_0057440_232_645 137
681 3300046692 Ga0495671_0001196 Ga0495671_0001196_15046_15459 137
682 3300046692 Ga0495671_0004836 Ga0495671_0004836_1798_2211 137
683 3300046692 Ga0495671_0030582 Ga0495671_0030582_604_1017 137
684 3300046694 Ga0495649_0000280 Ga0495649_0000280_23356_23769 137
685 3300046694 Ga0495649_0005636 Ga0495649_0005636_5759_6172 137
686 3300046794 Ga0495589_0000348 Ga0495589_0000348_26058_26471 137
687 3300046794 Ga0495589_0066218 Ga0495589_0066218_693_1106 137
688 3300046810 Ga0495660_0030729 Ga0495660_0030729_469_882 137
689 3300046810 Ga0495660_0080791 Ga0495660_0080791_11_424 137
690 3300047315 Ga0495581_0068503 Ga0495581_0068503_1598_2011 137
691 3300047318 Ga0495636_0002822 Ga0495636_0002822_3638_4051 137
692 3300047320 Ga0495672_0003116 Ga0495672_0003116_3754_4167 137
693 3300047320 Ga0495672_0004114 Ga0495672_0004114_10046_10459 137
694 3300047320 Ga0495672_0067356 Ga0495672_0067356_1583_1996 137
695 3300047323 Ga0495683_0000542 Ga0495683_0000542_2216_2629 137
696 3300047323 Ga0495683_0041062 Ga0495683_0041062_693_1106 137
697 3300047443 Ga0495687_000721 Ga0495687_000721_12563_12976 137
698 3300047443 Ga0495687_009090 Ga0495687_009090_3387_3800 137
699 3300047445 Ga0495677_0001398 Ga0495677_0001398_5487_5900 137
700 3300047446 Ga0495679_030984 Ga0495679_030984_41_454 137
701 3300047447 Ga0495685_168788 Ga0495685_168788_216_629 137
702 3300047469 Ga0495673_0001540 Ga0495673_0001540_15567_15980 137
703 3300047469 Ga0495673_0001969 Ga0495673_0001969_2339_2752 137
704 3300047469 Ga0495673_0029929 Ga0495673_0029929_1097_1510 137
705 3300047470 Ga0495681_0000171 Ga0495681_0000171_38832_39245 137
706 3300047470 Ga0495681_0004947 Ga0495681_0004947_407_820 137
707 3300047470 Ga0495681_0248804 Ga0495681_0248804_246_659 137
708 3300047673 Ga0495593_0024700 Ga0495593_0024700_1344_1757 137
709 3300048091 Ga0495626_0002512 Ga0495626_0002512_10105_10518 137
710 3300048091 Ga0495626_0018502 Ga0495626_0018502_2818_3231 137
711 3300048091 Ga0495626_0040051 Ga0495626_0040051_1251_1664 137
712 3300048091 Ga0495626_0057883 Ga0495626_0057883_1347_1760 137
713 3300048914 Ga0496111_0821883 Ga0496111_0821883_243_656 137
714 3300048919 Ga0496116_0001034 Ga0496116_0001034_15881_16294 137
715 3300048920 Ga0496117_0079192 Ga0496117_0079192_1687_2100 137
716 3300048924 Ga0496121_0075092 Ga0496121_0075092_464_877 137
717 3300048925 Ga0496122_0006952 Ga0496122_0006952_10239_10652 137
718 3300048927 Ga0496124_0149566 Ga0496124_0149566_1094_1507 137
719 3300048928 Ga0496125_0043972 Ga0496125_0043972_2352_2765 137
720 3300048928 Ga0496125_0060020 Ga0496125_0060020_131_544 137
721 3300049459 Ga0495678_000979 Ga0495678_000979_1045_1458 137
722 3300049459 Ga0495678_015533 Ga0495678_015533_2302_2715 137
723 3300049459 Ga0495678_068239 Ga0495678_068239_373_786 137
724 3300049460 Ga0495682_0029161 Ga0495682_0029161_1503_1916 137
725 3300049460 Ga0495682_0186156 Ga0495682_0186156_212_625 137
726 3300049758 Ga0501241_005235 Ga0501241_005235_143_556 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

25

62

0.99

PF09278

MerR-DNA-bind

MerR, DNA binding

67

131

0.97

PF13411

MerR_1

MerR HTH family regulatory protein

24

92

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jni-assembly2.cif.gz_D crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.9479 1 127
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.9471 1 68
6jyw-assembly1.cif.gz_B crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna 0.9468 1 129
6jyw-assembly1.cif.gz_A crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna 0.9468 1 129
6jgx-assembly1.cif.gz_B crystal structure of the transcriptional regulator cadr from p. putida in complex with cadmium(ii) and dna 0.9433 1 127
ID Description Score Start End Superfamily
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9406 1 68 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9255 1 68 1.10.1660.10
4wlwA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9239 2 131 1.10.1660.10
4r4eA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9228 1 72 1.10.1660.10
af_P0ACS5_1_128_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9201 1 123 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A3M4CLW0-F1-model_v4 deleted 0.9818 1 112
AF-A0A013WWI6-F1-model_v4 MerR family transcriptional regulator 0.9752 1 129 GO:0003677
GO:0003700
GO:0005507
GO:0005737
GO:0045893
AF-A0A3M4CLW0-F1-model_v4 deleted 0.9733 1 112
AF-A0A158M7L9-F1-model_v4 Cu(I)-responsive transcriptional regulator 0.9726 1 127 GO:0003677
GO:0003700
GO:0005507
GO:0005737
GO:0045893
AF-A0A2S8GVA1-F1-model_v4 deleted 0.9723 1 128

Feature Viewer

pLDDT pTM Quality
88.12 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map