F477670
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 726 | 340 | 720 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300006048|Ga0075363_100114095|Ga0075363_1001140951 |
| Length | 218 |
| Sequence | MKTINIRTTQVAPVCGNPPNAGAARANMGVPLISTYQERAMDSINANQPEHNHQDLIGEDAVKKIKDFVDNTSGCFFCTNDADGGPGDARPMTALQVDDMGNIWFISASDSLKNQELAVDPSATLYFQGSAHSEFMHIEGVATVLRDRAKLKELWSFTMKTWFTEGEDDPRITLIKFAPTYGYYWDTKHGRAVAGVKMLIGAVIGKTLDDSIEGRLDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 2 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 3 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 4 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 5 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 131 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 228 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 229 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 230 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 231 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 235 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 238 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 308 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 309 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 312 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 313 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 321 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 322 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 326 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 327 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 328 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 331 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 332 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 333 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 335 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 337 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 338 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0.96 |
| Isolates | 0.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.44 |
| Nodule | 0.28 |
| Rhizoplane | 0.96 |
| Rhizosphere | 85.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002490 | 3300001979 | Bacteria | 8328 |
| 2 | JGI24737J22298_10012954 | 3300001990 | Bacteria | 2717 |
| 3 | JGI24744J21845_10037876 | 3300002077 | Unclassified | 908 |
| 4 | JGI25162J39368_1002026 | 3300002737 | Bacteria | 8939 |
| 5 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 6 | JGI25157J39369_1004662 | 3300002741 | Bacteria | 2421 |
| 7 | JGI25157J39369_1010603 | 3300002741 | Bacteria | 1210 |
| 8 | JGI25165J46597_1002705 | 3300003214 | Bacteria | 5271 |
| 9 | JGI25153J46596_10006708 | 3300003215 | Bacteria | 5784 |
| 10 | rootH1_10027867 | 3300003316 | Bacteria | 2904 |
| 11 | rootH2_10058135 | 3300003320 | Bacteria | 3584 |
| 12 | rootL2_10018465 | 3300003322 | Bacteria | 4931 |
| 13 | rootL2_10254815 | 3300003322 | Bacteria | 1081 |
| 14 | rootL2_10297884 | 3300003322 | Bacteria | 3998 |
| 15 | rootL2_10315931 | 3300003322 | Bacteria | 2042 |
| 16 | rootH1_10010194 | 3300003323 | Bacteria | 43591 |
| 17 | rootH1_10165335 | 3300003323 | Bacteria | 5689 |
| 18 | rootH1_10329849 | 3300003323 | Bacteria | 1016 |
| 19 | JGI25160J50197_1000502 | 3300003354 | Bacteria | 23268 |
| 20 | JGI25160J50197_1031094 | 3300003354 | Bacteria | 1380 |
| 21 | Ga0007410J51695_1017575 | 3300003574 | Bacteria | 640 |
| 22 | Ga0007409J51694_1047815 | 3300003575 | Bacteria | 735 |
| 23 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 24 | Ga0055529_1000565 | 3300003763 | Bacteria | 30558 |
| 25 | Ga0055526_1002819 | 3300003771 | Bacteria | 11505 |
| 26 | Ga0055528_1000198 | 3300003790 | Bacteria | 51108 |
| 27 | Ga0055530_10001095 | 3300003791 | Bacteria | 21241 |
| 28 | Ga0055531_10000066 | 3300003794 | Bacteria | 115693 |
| 29 | Ga0065165_1000182 | 3300005262 | Bacteria | 110108 |
| 30 | Ga0065165_1015676 | 3300005262 | Unclassified | 2880 |
| 31 | Ga0065712_10225353 | 3300005290 | Bacteria | 1028 |
| 32 | Ga0070658_10006081 | 3300005327 | Bacteria | 9788 |
| 33 | Ga0070658_10081937 | 3300005327 | Bacteria | 2651 |
| 34 | Ga0070658_10131064 | 3300005327 | Bacteria | 2090 |
| 35 | Ga0070658_10154095 | 3300005327 | Bacteria | 1925 |
| 36 | Ga0070658_10563734 | 3300005327 | Unclassified | 986 |
| 37 | Ga0070676_10047522 | 3300005328 | Bacteria | 2506 |
| 38 | Ga0070676_10122021 | 3300005328 | Bacteria | 1637 |
| 39 | Ga0070676_10828537 | 3300005328 | Bacteria | 684 |
| 40 | Ga0070683_100248547 | 3300005329 | Unclassified | 1691 |
| 41 | Ga0070683_101470947 | 3300005329 | Bacteria | 655 |
| 42 | Ga0070690_100006305 | 3300005330 | Bacteria | 6726 |
| 43 | Ga0070690_100075349 | 3300005330 | Bacteria | 2199 |
| 44 | Ga0070670_100022809 | 3300005331 | Bacteria | 5386 |
| 45 | Ga0070670_100061704 | 3300005331 | Bacteria | 3218 |
| 46 | Ga0070670_100242702 | 3300005331 | Bacteria | 1568 |
| 47 | Ga0070670_100329253 | 3300005331 | Bacteria | 1339 |
| 48 | Ga0070670_100357323 | 3300005331 | Bacteria | 1284 |
| 49 | Ga0070677_10104260 | 3300005333 | Bacteria | 1256 |
| 50 | Ga0070677_10182920 | 3300005333 | Unclassified | 999 |
| 51 | Ga0068869_100008593 | 3300005334 | Bacteria | 6594 |
| 52 | Ga0068869_100046334 | 3300005334 | Unclassified | 3135 |
| 53 | Ga0068869_100565438 | 3300005334 | Unclassified | 957 |
| 54 | Ga0070666_10029713 | 3300005335 | Bacteria | 3595 |
| 55 | Ga0070666_10073391 | 3300005335 | Bacteria | 2330 |
| 56 | Ga0070666_10231929 | 3300005335 | Bacteria | 1304 |
| 57 | Ga0070666_10300118 | 3300005335 | Unclassified | 1144 |
| 58 | Ga0070680_100112488 | 3300005336 | Bacteria | 2267 |
| 59 | Ga0070680_100718947 | 3300005336 | Bacteria | 859 |
| 60 | Ga0068868_100172208 | 3300005338 | Bacteria | 1792 |
| 61 | Ga0068868_100795985 | 3300005338 | Bacteria | 853 |
| 62 | Ga0068868_100806646 | 3300005338 | Unclassified | 847 |
| 63 | Ga0070660_100077013 | 3300005339 | Bacteria | 2612 |
| 64 | Ga0070660_100233792 | 3300005339 | Bacteria | 1496 |
| 65 | Ga0070660_100452314 | 3300005339 | Bacteria | 1065 |
| 66 | Ga0070660_100711953 | 3300005339 | Bacteria | 842 |
| 67 | Ga0070689_100386895 | 3300005340 | Bacteria | 1180 |
| 68 | Ga0070689_100745588 | 3300005340 | Bacteria | 858 |
| 69 | Ga0070689_100849889 | 3300005340 | Bacteria | 805 |
| 70 | Ga0070687_100059898 | 3300005343 | Bacteria | 2006 |
| 71 | Ga0070687_100535028 | 3300005343 | Bacteria | 795 |
| 72 | Ga0070661_100336434 | 3300005344 | Bacteria | 1182 |
| 73 | Ga0070661_101069854 | 3300005344 | Bacteria | 671 |
| 74 | Ga0070692_10067099 | 3300005345 | Bacteria | 1904 |
| 75 | Ga0070668_100017133 | 3300005347 | Bacteria | 5422 |
| 76 | Ga0070668_100078333 | 3300005347 | Bacteria | 2585 |
| 77 | Ga0070669_100006476 | 3300005353 | Bacteria | 8430 |
| 78 | Ga0070669_100032016 | 3300005353 | Bacteria | 3798 |
| 79 | Ga0070669_100305439 | 3300005353 | Bacteria | 1281 |
| 80 | Ga0070675_100007775 | 3300005354 | Bacteria | 8302 |
| 81 | Ga0070675_100031307 | 3300005354 | Bacteria | 4300 |
| 82 | Ga0070675_100087551 | 3300005354 | Bacteria | 2604 |
| 83 | Ga0070675_100242007 | 3300005354 | Bacteria | 1577 |
| 84 | Ga0070675_100258942 | 3300005354 | Bacteria | 1524 |
| 85 | Ga0070675_100299983 | 3300005354 | Bacteria | 1415 |
| 86 | Ga0070675_100432026 | 3300005354 | Bacteria | 1179 |
| 87 | Ga0070675_100476966 | 3300005354 | Bacteria | 1121 |
| 88 | Ga0070671_100036407 | 3300005355 | Bacteria | 4081 |
| 89 | Ga0070674_100019422 | 3300005356 | Bacteria | 4316 |
| 90 | Ga0070674_100033911 | 3300005356 | Bacteria | 3403 |
| 91 | Ga0070674_100082322 | 3300005356 | Bacteria | 2302 |
| 92 | Ga0070674_100152763 | 3300005356 | Bacteria | 1743 |
| 93 | Ga0070673_100014221 | 3300005364 | Bacteria | 5533 |
| 94 | Ga0070673_100026035 | 3300005364 | Bacteria | 4314 |
| 95 | Ga0070673_100039035 | 3300005364 | Bacteria | 3630 |
| 96 | Ga0070673_100559003 | 3300005364 | Bacteria | 1040 |
| 97 | Ga0070673_100581498 | 3300005364 | Bacteria | 1020 |
| 98 | Ga0070688_100143325 | 3300005365 | Unclassified | 1625 |
| 99 | Ga0070659_100014736 | 3300005366 | Bacteria | 5848 |
| 100 | Ga0070659_100037941 | 3300005366 | Bacteria | 3756 |
| 101 | Ga0070659_100272733 | 3300005366 | Bacteria | 1406 |
| 102 | Ga0070659_100605785 | 3300005366 | Bacteria | 942 |
| 103 | Ga0070667_100006292 | 3300005367 | Bacteria | 9867 |
| 104 | Ga0070667_100014368 | 3300005367 | Bacteria | 6542 |
| 105 | Ga0070667_100414646 | 3300005367 | Bacteria | 1227 |
| 106 | Ga0070667_100415022 | 3300005367 | Bacteria | 1226 |
| 107 | Ga0070701_10016364 | 3300005438 | Bacteria | 3447 |
| 108 | Ga0070701_10023188 | 3300005438 | Bacteria | 2986 |
| 109 | Ga0070700_100120751 | 3300005441 | Bacteria | 1755 |
| 110 | Ga0070700_100411096 | 3300005441 | Bacteria | 1020 |
| 111 | Ga0070700_100531734 | 3300005441 | Bacteria | 910 |
| 112 | Ga0070694_100054383 | 3300005444 | Unclassified | 2712 |
| 113 | Ga0070663_100055066 | 3300005455 | Bacteria | 2845 |
| 114 | Ga0070678_100130357 | 3300005456 | Bacteria | 1997 |
| 115 | Ga0070678_100211342 | 3300005456 | Bacteria | 1608 |
| 116 | Ga0070678_100319322 | 3300005456 | Bacteria | 1326 |
| 117 | Ga0070662_100110586 | 3300005457 | Bacteria | 2093 |
| 118 | Ga0070662_100297286 | 3300005457 | Bacteria | 1311 |
| 119 | Ga0070662_100556169 | 3300005457 | Unclassified | 962 |
| 120 | Ga0070662_100594775 | 3300005457 | Unclassified | 930 |
| 121 | Ga0068867_100014009 | 3300005459 | Bacteria | 5678 |
| 122 | Ga0068867_100248629 | 3300005459 | Bacteria | 1445 |
| 123 | Ga0070685_10078891 | 3300005466 | Bacteria | 1969 |
| 124 | Ga0070685_10083339 | 3300005466 | Bacteria | 1921 |
| 125 | Ga0070698_100087369 | 3300005471 | Bacteria | 3104 |
| 126 | Ga0070684_100038370 | 3300005535 | Unclassified | 4114 |
| 127 | Ga0070684_100172102 | 3300005535 | Bacteria | 1967 |
| 128 | Ga0068853_100038142 | 3300005539 | Unclassified | 4091 |
| 129 | Ga0070672_100007590 | 3300005543 | Bacteria | 7373 |
| 130 | Ga0070672_100028864 | 3300005543 | Bacteria | 4154 |
| 131 | Ga0070672_100039105 | 3300005543 | Bacteria | 3631 |
| 132 | Ga0070672_100046777 | 3300005543 | Bacteria | 3354 |
| 133 | Ga0070672_100055912 | 3300005543 | Bacteria | 3093 |
| 134 | Ga0070672_100152131 | 3300005543 | Bacteria | 1914 |
| 135 | Ga0070672_100259014 | 3300005543 | Bacteria | 1466 |
| 136 | Ga0070686_100174196 | 3300005544 | Bacteria | 1524 |
| 137 | Ga0070665_100000072 | 3300005548 | Bacteria | 198575 |
| 138 | Ga0070665_100164153 | 3300005548 | Bacteria | 2224 |
| 139 | Ga0070704_100024434 | 3300005549 | Bacteria | 3965 |
| 140 | Ga0070704_100668436 | 3300005549 | Bacteria | 918 |
| 141 | Ga0068855_100062790 | 3300005563 | Bacteria | 4336 |
| 142 | Ga0068855_100131060 | 3300005563 | Bacteria | 2863 |
| 143 | Ga0068855_100149305 | 3300005563 | Bacteria | 2658 |
| 144 | Ga0068855_100239358 | 3300005563 | Bacteria | 2029 |
| 145 | Ga0068855_100750905 | 3300005563 | Bacteria | 1040 |
| 146 | Ga0068855_100758252 | 3300005563 | Bacteria | 1034 |
| 147 | Ga0070664_100083618 | 3300005564 | Bacteria | 2754 |
| 148 | Ga0070664_100141269 | 3300005564 | Unclassified | 2120 |
| 149 | Ga0070664_100184969 | 3300005564 | Bacteria | 1854 |
| 150 | Ga0070664_100644387 | 3300005564 | Bacteria | 984 |
| 151 | Ga0070664_101170256 | 3300005564 | Bacteria | 725 |
| 152 | Ga0068857_100015636 | 3300005577 | Bacteria | 6633 |
| 153 | Ga0068857_100431080 | 3300005577 | Bacteria | 1230 |
| 154 | Ga0068854_100400983 | 3300005578 | Bacteria | 1135 |
| 155 | Ga0068856_100198886 | 3300005614 | Bacteria | 2019 |
| 156 | Ga0068856_100235083 | 3300005614 | Bacteria | 1848 |
| 157 | Ga0070702_100019351 | 3300005615 | Bacteria | 3549 |
| 158 | Ga0068852_100082915 | 3300005616 | Bacteria | 2850 |
| 159 | Ga0068852_100118376 | 3300005616 | Bacteria | 2420 |
| 160 | Ga0068852_100268799 | 3300005616 | Bacteria | 1640 |
| 161 | Ga0068852_101068404 | 3300005616 | Bacteria | 827 |
| 162 | Ga0068852_101374920 | 3300005616 | Bacteria | 728 |
| 163 | Ga0068859_100142010 | 3300005617 | Bacteria | 2475 |
| 164 | Ga0068859_100878809 | 3300005617 | Bacteria | 982 |
| 165 | Ga0068864_100023586 | 3300005618 | Bacteria | 5168 |
| 166 | Ga0068866_10015069 | 3300005718 | Bacteria | 3428 |
| 167 | Ga0068861_100004049 | 3300005719 | Bacteria | 9815 |
| 168 | Ga0068861_100167451 | 3300005719 | Bacteria | 1818 |
| 169 | Ga0068861_100174837 | 3300005719 | Bacteria | 1782 |
| 170 | Ga0068861_101439500 | 3300005719 | Bacteria | 674 |
| 171 | Ga0068870_10118377 | 3300005840 | Bacteria | 1522 |
| 172 | Ga0068870_10380223 | 3300005840 | Bacteria | 914 |
| 173 | Ga0068863_100016559 | 3300005841 | Bacteria | 7074 |
| 174 | Ga0068863_100881237 | 3300005841 | Bacteria | 895 |
| 175 | Ga0068858_100004355 | 3300005842 | Bacteria | 13888 |
| 176 | Ga0068858_100208856 | 3300005842 | Bacteria | 1847 |
| 177 | Ga0068860_100006985 | 3300005843 | Bacteria | 11311 |
| 178 | Ga0068862_100021261 | 3300005844 | Bacteria | 5422 |
| 179 | Ga0068862_100023221 | 3300005844 | Bacteria | 5195 |
| 180 | Ga0068862_100266114 | 3300005844 | Bacteria | 1566 |
| 181 | Ga0081539_10014767 | 3300005985 | Bacteria | 5742 |
| 182 | Ga0070717_10540073 | 3300006028 | Bacteria | 1055 |
| 183 | Ga0070717_11178015 | 3300006028 | Bacteria | 697 |
| 184 | Ga0075363_100114095 | 3300006048 | Bacteria | 1504 |
| 185 | Ga0075362_10103097 | 3300006177 | Bacteria | 1336 |
| 186 | Ga0075362_10271580 | 3300006177 | Bacteria | 837 |
| 187 | Ga0075366_10020915 | 3300006195 | Bacteria | 3801 |
| 188 | Ga0097621_100294117 | 3300006237 | Bacteria | 1433 |
| 189 | Ga0097621_100502382 | 3300006237 | Bacteria | 1098 |
| 190 | Ga0097621_100649095 | 3300006237 | Bacteria | 968 |
| 191 | Ga0097621_101172875 | 3300006237 | Unclassified | 723 |
| 192 | Ga0068871_100309030 | 3300006358 | Bacteria | 1389 |
| 193 | Ga0068871_100896637 | 3300006358 | Bacteria | 822 |
| 194 | Ga0075434_100556879 | 3300006871 | Unclassified | 1166 |
| 195 | Ga0075429_100001972 | 3300006880 | Bacteria | 17070 |
| 196 | Ga0068865_100036633 | 3300006881 | Bacteria | 3308 |
| 197 | Ga0068865_100055260 | 3300006881 | Bacteria | 2761 |
| 198 | Ga0068865_100184920 | 3300006881 | Bacteria | 1607 |
| 199 | Ga0068865_101045816 | 3300006881 | Bacteria | 717 |
| 200 | Ga0097620_100142013 | 3300006931 | Bacteria | 2475 |
| 201 | Ga0097620_100878768 | 3300006931 | Bacteria | 982 |
| 202 | Ga0079104_1012978 | 3300006946 | Bacteria | 2590 |
| 203 | Ga0105244_10012232 | 3300009036 | Bacteria | 5084 |
| 204 | Ga0105244_10211440 | 3300009036 | Bacteria | 912 |
| 205 | Ga0105240_10000706 | 3300009093 | Bacteria | 61234 |
| 206 | Ga0105240_10012165 | 3300009093 | Bacteria | 11914 |
| 207 | Ga0105240_10118786 | 3300009093 | Bacteria | 3186 |
| 208 | Ga0105240_10909320 | 3300009093 | Bacteria | 946 |
| 209 | Ga0111539_10067626 | 3300009094 | Bacteria | 4219 |
| 210 | Ga0111539_10477062 | 3300009094 | Bacteria | 1453 |
| 211 | Ga0111539_10917825 | 3300009094 | Unclassified | 1018 |
| 212 | Ga0111539_11136833 | 3300009094 | Bacteria | 907 |
| 213 | Ga0111539_11856748 | 3300009094 | Bacteria | 699 |
| 214 | Ga0105245_10207429 | 3300009098 | Bacteria | 1884 |
| 215 | Ga0105245_10308744 | 3300009098 | Bacteria | 1555 |
| 216 | Ga0105245_10690970 | 3300009098 | Unclassified | 1053 |
| 217 | Ga0105245_11645249 | 3300009098 | Bacteria | 694 |
| 218 | Ga0114129_10008756 | 3300009147 | Bacteria | 14432 |
| 219 | Ga0105243_10058898 | 3300009148 | Bacteria | 3063 |
| 220 | Ga0105243_10272217 | 3300009148 | Bacteria | 1521 |
| 221 | Ga0105243_10323310 | 3300009148 | Bacteria | 1407 |
| 222 | Ga0105241_10075560 | 3300009174 | Bacteria | 2625 |
| 223 | Ga0105241_10342179 | 3300009174 | Bacteria | 1296 |
| 224 | Ga0105241_11102432 | 3300009174 | Unclassified | 748 |
| 225 | Ga0105242_10113197 | 3300009176 | Bacteria | 2317 |
| 226 | Ga0105242_10181182 | 3300009176 | Bacteria | 1859 |
| 227 | Ga0105242_10305918 | 3300009176 | Unclassified | 1453 |
| 228 | Ga0105242_11010046 | 3300009176 | Unclassified | 840 |
| 229 | Ga0105248_10364264 | 3300009177 | Bacteria | 1627 |
| 230 | Ga0105248_10539677 | 3300009177 | Bacteria | 1315 |
| 231 | Ga0105237_10004544 | 3300009545 | Bacteria | 16031 |
| 232 | Ga0105237_10013372 | 3300009545 | Bacteria | 8609 |
| 233 | Ga0105237_10226593 | 3300009545 | Bacteria | 1869 |
| 234 | Ga0105249_10026578 | 3300009553 | Bacteria | 5218 |
| 235 | Ga0105249_10040482 | 3300009553 | Bacteria | 4233 |
| 236 | Ga0105249_10854052 | 3300009553 | Bacteria | 976 |
| 237 | Ga0105239_10000039 | 3300010375 | Bacteria | 203537 |
| 238 | Ga0105239_10283915 | 3300010375 | Bacteria | 1864 |
| 239 | Ga0105239_10458484 | 3300010375 | Bacteria | 1447 |
| 240 | Ga0157373_10002214 | 3300013100 | Bacteria | 14711 |
| 241 | Ga0157371_10000263 | 3300013102 | Bacteria | 71557 |
| 242 | Ga0157371_10086714 | 3300013102 | Bacteria | 2217 |
| 243 | Ga0157371_10186255 | 3300013102 | Bacteria | 1485 |
| 244 | Ga0157371_10433575 | 3300013102 | Bacteria | 965 |
| 245 | Ga0157370_10087207 | 3300013104 | Bacteria | 2932 |
| 246 | Ga0157370_10254646 | 3300013104 | Unclassified | 1623 |
| 247 | Ga0157369_11870551 | 3300013105 | Bacteria | 609 |
| 248 | Ga0157374_10008921 | 3300013296 | Bacteria | 8593 |
| 249 | Ga0157374_10038943 | 3300013296 | Bacteria | 4372 |
| 250 | Ga0157374_10228118 | 3300013296 | Bacteria | 1829 |
| 251 | Ga0157374_10510314 | 3300013296 | Bacteria | 1207 |
| 252 | Ga0157378_10003189 | 3300013297 | Bacteria | 14572 |
| 253 | Ga0157378_10315185 | 3300013297 | Bacteria | 1518 |
| 254 | Ga0157378_10405309 | 3300013297 | Bacteria | 1345 |
| 255 | Ga0157378_10467842 | 3300013297 | Bacteria | 1254 |
| 256 | Ga0163162_10000010 | 3300013306 | Bacteria | 302032 |
| 257 | Ga0163162_10015161 | 3300013306 | Bacteria | 7527 |
| 258 | Ga0163162_10030422 | 3300013306 | Bacteria | 5350 |
| 259 | Ga0163162_10146804 | 3300013306 | Bacteria | 2475 |
| 260 | Ga0163162_10182220 | 3300013306 | Bacteria | 2226 |
| 261 | Ga0163162_10286793 | 3300013306 | Unclassified | 1778 |
| 262 | Ga0163162_11365194 | 3300013306 | Bacteria | 806 |
| 263 | Ga0157372_10000266 | 3300013307 | Bacteria | 57783 |
| 264 | Ga0157372_10017724 | 3300013307 | Bacteria | 7646 |
| 265 | Ga0157372_10390463 | 3300013307 | Bacteria | 1622 |
| 266 | Ga0157372_11189962 | 3300013307 | Bacteria | 881 |
| 267 | Ga0157372_11503583 | 3300013307 | Unclassified | 776 |
| 268 | Ga0157375_10005490 | 3300013308 | Bacteria | 11026 |
| 269 | Ga0157375_10006022 | 3300013308 | Bacteria | 10577 |
| 270 | Ga0157375_10227431 | 3300013308 | Bacteria | 2024 |
| 271 | Ga0157375_10575227 | 3300013308 | Bacteria | 1287 |
| 272 | Ga0163163_10119700 | 3300014325 | Unclassified | 2666 |
| 273 | Ga0163163_10206266 | 3300014325 | Bacteria | 2014 |
| 274 | Ga0157380_10001590 | 3300014326 | Bacteria | 14970 |
| 275 | Ga0157380_10015585 | 3300014326 | Bacteria | 5588 |
| 276 | Ga0157380_10081663 | 3300014326 | Bacteria | 2645 |
| 277 | Ga0157380_10085913 | 3300014326 | Bacteria | 2584 |
| 278 | Ga0157380_10105588 | 3300014326 | Bacteria | 2355 |
| 279 | Ga0157377_10035022 | 3300014745 | Bacteria | 2751 |
| 280 | Ga0157377_10129451 | 3300014745 | Bacteria | 1540 |
| 281 | Ga0157379_10010838 | 3300014968 | Bacteria | 7950 |
| 282 | Ga0157379_10498934 | 3300014968 | Bacteria | 1128 |
| 283 | Ga0157376_10369969 | 3300014969 | Bacteria | 1377 |
| 284 | Ga0157376_10804823 | 3300014969 | Bacteria | 953 |
| 285 | Ga0157376_11442255 | 3300014969 | Bacteria | 721 |
| 286 | Ga0157376_11494715 | 3300014969 | Bacteria | 708 |
| 287 | Ga0182006_1000070 | 3300015261 | Bacteria | 137793 |
| 288 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 289 | Ga0163161_10032549 | 3300017792 | Bacteria | 3723 |
| 290 | Ga0163161_10565044 | 3300017792 | Bacteria | 934 |
| 291 | Ga0197907_10049391 | 3300020069 | Bacteria | 703 |
| 292 | Ga0154015_1290094 | 3300020610 | Bacteria | 1283 |
| 293 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 294 | Ga0209563_116249 | 3300025230 | Bacteria | 918 |
| 295 | Ga0207427_100172 | 3300025231 | Bacteria | 71550 |
| 296 | Ga0209437_100034 | 3300025233 | Bacteria | 494007 |
| 297 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 298 | Ga0209026_1000097 | 3300025250 | Bacteria | 163212 |
| 299 | Ga0209026_1001446 | 3300025250 | Bacteria | 10492 |
| 300 | Ga0209677_110274 | 3300025253 | Bacteria | 1575 |
| 301 | Ga0209129_1018604 | 3300025258 | Bacteria | 1330 |
| 302 | Ga0209233_1000038 | 3300025261 | Bacteria | 548972 |
| 303 | Ga0209233_1022403 | 3300025261 | Unclassified | 1618 |
| 304 | Ga0209455_1000063 | 3300025272 | Bacteria | 333019 |
| 305 | Ga0209673_1000226 | 3300025273 | Bacteria | 111427 |
| 306 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 307 | Ga0209564_1002364 | 3300025295 | Bacteria | 15176 |
| 308 | Ga0209050_1000125 | 3300025298 | Bacteria | 189641 |
| 309 | Ga0207426_1000261 | 3300025302 | Bacteria | 112697 |
| 310 | Ga0207426_1000898 | 3300025302 | Bacteria | 30067 |
| 311 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 312 | Ga0209257_1003617 | 3300025304 | Bacteria | 13021 |
| 313 | Ga0207697_10020450 | 3300025315 | Bacteria | 2710 |
| 314 | Ga0207656_10102190 | 3300025321 | Bacteria | 1315 |
| 315 | Ga0207655_1003374 | 3300025728 | Bacteria | 11935 |
| 316 | Ga0207655_1019553 | 3300025728 | Bacteria | 3531 |
| 317 | Ga0207653_10063423 | 3300025885 | Bacteria | 1251 |
| 318 | Ga0207682_10017920 | 3300025893 | Bacteria | 2765 |
| 319 | Ga0207682_10024021 | 3300025893 | Bacteria | 2411 |
| 320 | Ga0207642_10040786 | 3300025899 | Bacteria | 2028 |
| 321 | Ga0207688_10131067 | 3300025901 | Unclassified | 1470 |
| 322 | Ga0207680_10017322 | 3300025903 | Bacteria | 3805 |
| 323 | Ga0207680_10073731 | 3300025903 | Unclassified | 2123 |
| 324 | Ga0207680_10136585 | 3300025903 | Unclassified | 1621 |
| 325 | Ga0207647_10000662 | 3300025904 | Bacteria | 26925 |
| 326 | Ga0207647_10172898 | 3300025904 | Unclassified | 1257 |
| 327 | Ga0207647_10220447 | 3300025904 | Bacteria | 1093 |
| 328 | Ga0207645_10011322 | 3300025907 | Bacteria | 6096 |
| 329 | Ga0207645_10028782 | 3300025907 | Bacteria | 3584 |
| 330 | Ga0207643_10166547 | 3300025908 | Bacteria | 1328 |
| 331 | Ga0207705_10064176 | 3300025909 | Bacteria | 2654 |
| 332 | Ga0207705_10207776 | 3300025909 | Unclassified | 1485 |
| 333 | Ga0207654_10016340 | 3300025911 | Bacteria | 3864 |
| 334 | Ga0207695_10004844 | 3300025913 | Bacteria | 18169 |
| 335 | Ga0207695_10012457 | 3300025913 | Bacteria | 10211 |
| 336 | Ga0207695_10104269 | 3300025913 | Bacteria | 2825 |
| 337 | Ga0207695_10186648 | 3300025913 | Bacteria | 1992 |
| 338 | Ga0207695_10582723 | 3300025913 | Bacteria | 1000 |
| 339 | Ga0207695_11054493 | 3300025913 | Bacteria | 693 |
| 340 | Ga0207671_10009023 | 3300025914 | Bacteria | 8389 |
| 341 | Ga0207671_10011406 | 3300025914 | Bacteria | 7239 |
| 342 | Ga0207671_10027835 | 3300025914 | Bacteria | 4225 |
| 343 | Ga0207671_10069713 | 3300025914 | Bacteria | 2620 |
| 344 | Ga0207671_10147834 | 3300025914 | Bacteria | 1814 |
| 345 | Ga0207660_10257178 | 3300025917 | Bacteria | 1380 |
| 346 | Ga0207660_10435269 | 3300025917 | Bacteria | 1059 |
| 347 | Ga0207662_10023917 | 3300025918 | Bacteria | 3513 |
| 348 | Ga0207657_10004452 | 3300025919 | Bacteria | 14820 |
| 349 | Ga0207657_10709583 | 3300025919 | Bacteria | 781 |
| 350 | Ga0207649_10248512 | 3300025920 | Bacteria | 1280 |
| 351 | Ga0207649_10336893 | 3300025920 | Bacteria | 1113 |
| 352 | Ga0207649_10925622 | 3300025920 | Bacteria | 684 |
| 353 | Ga0207652_10152518 | 3300025921 | Bacteria | 2069 |
| 354 | Ga0207681_10000326 | 3300025923 | Bacteria | 34311 |
| 355 | Ga0207681_10200460 | 3300025923 | Bacteria | 1532 |
| 356 | Ga0207681_10379391 | 3300025923 | Bacteria | 1138 |
| 357 | Ga0207681_10859066 | 3300025923 | Bacteria | 759 |
| 358 | Ga0207694_10121056 | 3300025924 | Bacteria | 2090 |
| 359 | Ga0207694_10430384 | 3300025924 | Bacteria | 1100 |
| 360 | Ga0207650_10004536 | 3300025925 | Bacteria | 9496 |
| 361 | Ga0207650_10078473 | 3300025925 | Bacteria | 2498 |
| 362 | Ga0207650_10297828 | 3300025925 | Bacteria | 1316 |
| 363 | Ga0207659_10006659 | 3300025926 | Bacteria | 7099 |
| 364 | Ga0207659_10011221 | 3300025926 | Bacteria | 5655 |
| 365 | Ga0207659_10099788 | 3300025926 | Bacteria | 2186 |
| 366 | Ga0207659_10286865 | 3300025926 | Bacteria | 1348 |
| 367 | Ga0207659_10865003 | 3300025926 | Bacteria | 777 |
| 368 | Ga0207687_10438689 | 3300025927 | Bacteria | 1081 |
| 369 | Ga0207644_10103722 | 3300025931 | Bacteria | 2140 |
| 370 | Ga0207690_10008888 | 3300025932 | Bacteria | 5963 |
| 371 | Ga0207690_10045089 | 3300025932 | Bacteria | 2911 |
| 372 | Ga0207690_10064005 | 3300025932 | Bacteria | 2509 |
| 373 | Ga0207706_10022343 | 3300025933 | Bacteria | 5676 |
| 374 | Ga0207706_10045314 | 3300025933 | Bacteria | 3897 |
| 375 | Ga0207706_10280298 | 3300025933 | Bacteria | 1454 |
| 376 | Ga0207706_10398265 | 3300025933 | Bacteria | 1194 |
| 377 | Ga0207686_10138733 | 3300025934 | Bacteria | 1678 |
| 378 | Ga0207709_10048851 | 3300025935 | Bacteria | 2580 |
| 379 | Ga0207709_10268343 | 3300025935 | Bacteria | 1255 |
| 380 | Ga0207670_10582123 | 3300025936 | Bacteria | 917 |
| 381 | Ga0207669_10030025 | 3300025937 | Bacteria | 3015 |
| 382 | Ga0207669_10100034 | 3300025937 | Bacteria | 1914 |
| 383 | Ga0207669_10110015 | 3300025937 | Bacteria | 1844 |
| 384 | Ga0207669_10794194 | 3300025937 | Bacteria | 784 |
| 385 | Ga0207669_11381908 | 3300025937 | Bacteria | 599 |
| 386 | Ga0207704_10005361 | 3300025938 | Bacteria | 5908 |
| 387 | Ga0207704_10048658 | 3300025938 | Bacteria | 2544 |
| 388 | Ga0207704_10260191 | 3300025938 | Unclassified | 1308 |
| 389 | Ga0207704_10848821 | 3300025938 | Bacteria | 765 |
| 390 | Ga0207691_10014600 | 3300025940 | Bacteria | 7486 |
| 391 | Ga0207691_10023107 | 3300025940 | Bacteria | 5856 |
| 392 | Ga0207691_10050802 | 3300025940 | Bacteria | 3794 |
| 393 | Ga0207691_10060131 | 3300025940 | Bacteria | 3453 |
| 394 | Ga0207691_10066154 | 3300025940 | Bacteria | 3271 |
| 395 | Ga0207691_10082662 | 3300025940 | Bacteria | 2884 |
| 396 | Ga0207691_10211369 | 3300025940 | Bacteria | 1685 |
| 397 | Ga0207691_10352983 | 3300025940 | Bacteria | 1258 |
| 398 | Ga0207711_10094114 | 3300025941 | Bacteria | 2640 |
| 399 | Ga0207711_10249989 | 3300025941 | Bacteria | 1628 |
| 400 | Ga0207689_10004982 | 3300025942 | Bacteria | 11962 |
| 401 | Ga0207689_10031602 | 3300025942 | Bacteria | 4406 |
| 402 | Ga0207689_10152997 | 3300025942 | Bacteria | 1901 |
| 403 | Ga0207689_10364685 | 3300025942 | Bacteria | 1201 |
| 404 | Ga0207661_10079128 | 3300025944 | Unclassified | 2709 |
| 405 | Ga0207661_10173369 | 3300025944 | Bacteria | 1879 |
| 406 | Ga0207679_10032039 | 3300025945 | Bacteria | 3685 |
| 407 | Ga0207679_10142990 | 3300025945 | Bacteria | 1936 |
| 408 | Ga0207679_10802714 | 3300025945 | Bacteria | 858 |
| 409 | Ga0207667_10201043 | 3300025949 | Bacteria | 2044 |
| 410 | Ga0207667_10456601 | 3300025949 | Bacteria | 1298 |
| 411 | Ga0207667_10658801 | 3300025949 | Bacteria | 1052 |
| 412 | Ga0207667_11565428 | 3300025949 | Unclassified | 629 |
| 413 | Ga0207651_10262702 | 3300025960 | Bacteria | 1418 |
| 414 | Ga0207651_10363308 | 3300025960 | Bacteria | 1222 |
| 415 | Ga0207651_10429652 | 3300025960 | Bacteria | 1129 |
| 416 | Ga0207651_10842587 | 3300025960 | Bacteria | 814 |
| 417 | Ga0207651_11141895 | 3300025960 | Bacteria | 699 |
| 418 | Ga0207712_10040571 | 3300025961 | Bacteria | 3196 |
| 419 | Ga0207712_10079316 | 3300025961 | Bacteria | 2385 |
| 420 | Ga0207668_10102815 | 3300025972 | Bacteria | 2126 |
| 421 | Ga0207668_10263355 | 3300025972 | Bacteria | 1406 |
| 422 | Ga0207640_10735066 | 3300025981 | Bacteria | 849 |
| 423 | Ga0207658_10002120 | 3300025986 | Bacteria | 14748 |
| 424 | Ga0207658_10101506 | 3300025986 | Bacteria | 2254 |
| 425 | Ga0207658_10239187 | 3300025986 | Bacteria | 1537 |
| 426 | Ga0207677_10511390 | 3300026023 | Bacteria | 1040 |
| 427 | Ga0207677_10805667 | 3300026023 | Bacteria | 841 |
| 428 | Ga0207677_10835696 | 3300026023 | Bacteria | 827 |
| 429 | Ga0207703_10001042 | 3300026035 | Bacteria | 26535 |
| 430 | Ga0207639_10008764 | 3300026041 | Bacteria | 6950 |
| 431 | Ga0207639_10124312 | 3300026041 | Unclassified | 2125 |
| 432 | Ga0207678_10014659 | 3300026067 | Bacteria | 6898 |
| 433 | Ga0207678_10125991 | 3300026067 | Bacteria | 2185 |
| 434 | Ga0207678_10725688 | 3300026067 | Bacteria | 875 |
| 435 | Ga0207678_10971170 | 3300026067 | Bacteria | 752 |
| 436 | Ga0207708_10004039 | 3300026075 | Bacteria | 10790 |
| 437 | Ga0207708_10214778 | 3300026075 | Bacteria | 1539 |
| 438 | Ga0207708_10233392 | 3300026075 | Bacteria | 1478 |
| 439 | Ga0207702_10155484 | 3300026078 | Bacteria | 2084 |
| 440 | Ga0207702_10679113 | 3300026078 | Unclassified | 1014 |
| 441 | Ga0207641_10005975 | 3300026088 | Bacteria | 10314 |
| 442 | Ga0207648_10016034 | 3300026089 | Bacteria | 6865 |
| 443 | Ga0207648_10026491 | 3300026089 | Bacteria | 5151 |
| 444 | Ga0207648_10030734 | 3300026089 | Unclassified | 4754 |
| 445 | Ga0207648_10041365 | 3300026089 | Bacteria | 4047 |
| 446 | Ga0207648_10100924 | 3300026089 | Bacteria | 2529 |
| 447 | Ga0207648_10125386 | 3300026089 | Bacteria | 2259 |
| 448 | Ga0207648_10278139 | 3300026089 | Bacteria | 1496 |
| 449 | Ga0207676_10140378 | 3300026095 | Bacteria | 2067 |
| 450 | Ga0207674_10128615 | 3300026116 | Bacteria | 2497 |
| 451 | Ga0207674_10143691 | 3300026116 | Unclassified | 2345 |
| 452 | Ga0207675_100005687 | 3300026118 | Bacteria | 11928 |
| 453 | Ga0207675_100009505 | 3300026118 | Bacteria | 9099 |
| 454 | Ga0207675_100045900 | 3300026118 | Bacteria | 4081 |
| 455 | Ga0207675_100057826 | 3300026118 | Bacteria | 3618 |
| 456 | Ga0207675_100159726 | 3300026118 | Unclassified | 2149 |
| 457 | Ga0207675_100587648 | 3300026118 | Unclassified | 1115 |
| 458 | Ga0207675_100769629 | 3300026118 | Bacteria | 975 |
| 459 | Ga0207683_10009885 | 3300026121 | Bacteria | 8134 |
| 460 | Ga0207683_10052785 | 3300026121 | Bacteria | 3563 |
| 461 | Ga0207683_10057715 | 3300026121 | Bacteria | 3408 |
| 462 | Ga0207683_10249295 | 3300026121 | Bacteria | 1620 |
| 463 | Ga0207683_10364528 | 3300026121 | Bacteria | 1327 |
| 464 | Ga0207698_10049348 | 3300026142 | Bacteria | 3203 |
| 465 | Ga0207698_10174206 | 3300026142 | Bacteria | 1898 |
| 466 | Ga0209281_1024949 | 3300027111 | Bacteria | 1119 |
| 467 | Ga0207428_10676880 | 3300027907 | Bacteria | 739 |
| 468 | Ga0268266_10000089 | 3300028379 | Bacteria | 198566 |
| 469 | Ga0268266_10004476 | 3300028379 | Bacteria | 13361 |
| 470 | Ga0268266_10051758 | 3300028379 | Bacteria | 3526 |
| 471 | Ga0268266_10267474 | 3300028379 | Unclassified | 1586 |
| 472 | Ga0268266_10307819 | 3300028379 | Bacteria | 1480 |
| 473 | Ga0268266_10338075 | 3300028379 | Bacteria | 1413 |
| 474 | Ga0268265_10244138 | 3300028380 | Bacteria | 1586 |
| 475 | Ga0268265_10262108 | 3300028380 | Bacteria | 1537 |
| 476 | Ga0268264_10001548 | 3300028381 | Bacteria | 21322 |
| 477 | Ga0316181_1215377 | 3300030744 | Bacteria | 1764 |
| 478 | Ga0316182_1111809 | 3300030745 | Bacteria | 878 |
| 479 | Ga0316182_1444012 | 3300030745 | Bacteria | 1015 |
| 480 | Ga0307516_10771555 | 3300031730 | Bacteria | 622 |
| 481 | Ga0307406_10221387 | 3300031901 | Bacteria | 1407 |
| 482 | Ga0307409_102351618 | 3300031995 | Unclassified | 562 |
| 483 | Ga0307414_10025237 | 3300032004 | Bacteria | 3804 |
| 484 | Ga0307414_10120923 | 3300032004 | Unclassified | 2013 |
| 485 | Ga0307414_10185893 | 3300032004 | Bacteria | 1676 |
| 486 | Ga0307411_11225900 | 3300032005 | Unclassified | 681 |
| 487 | Ga0373931_0281197 | 3300035691 | Bacteria | 1022 |
| 488 | Ga0395899_0004327 | 3300037312 | Bacteria | 11087 |
| 489 | Ga0395899_0227739 | 3300037312 | Bacteria | 1288 |
| 490 | Ga0395900_0011119 | 3300037418 | Bacteria | 9198 |
| 491 | Ga0395900_0118609 | 3300037418 | Bacteria | 2715 |
| 492 | Ga0395900_0266100 | 3300037418 | Bacteria | 1710 |
| 493 | Ga0395900_0708058 | 3300037418 | Bacteria | 940 |
| 494 | Ga0395898_0040629 | 3300037466 | Bacteria | 4598 |
| 495 | Ga0395898_0315631 | 3300037466 | Bacteria | 1491 |
| 496 | Ga0395898_0383443 | 3300037466 | Bacteria | 1340 |
| 497 | Ga0395898_0664270 | 3300037466 | Bacteria | 984 |
| 498 | Ga0395905_0043241 | 3300037471 | Bacteria | 4226 |
| 499 | Ga0395905_0216238 | 3300037471 | Bacteria | 1794 |
| 500 | Ga0395905_0218941 | 3300037471 | Bacteria | 1782 |
| 501 | Ga0395901_0060473 | 3300038443 | Bacteria | 3942 |
| 502 | Ga0395901_0180469 | 3300038443 | Bacteria | 2214 |
| 503 | Ga0395901_0229568 | 3300038443 | Bacteria | 1938 |
| 504 | Ga0395901_0867619 | 3300038443 | Bacteria | 886 |
| 505 | Ga0439436_0001868 | 3300041404 | Bacteria | 6221 |
| 506 | Ga0439436_0131802 | 3300041404 | Bacteria | 701 |
| 507 | Ga0439439_0025805 | 3300041406 | Unclassified | 1480 |
| 508 | Ga0451789_1155240 | 3300041443 | Bacteria | 800 |
| 509 | Ga0451800_0019211 | 3300041459 | Bacteria | 1123 |
| 510 | Ga0451807_1987758 | 3300041486 | Bacteria | 1890 |
| 511 | Ga0451851_0419090 | 3300041507 | Bacteria | 836 |
| 512 | Ga0451843_0382176 | 3300041509 | Bacteria | 922 |
| 513 | Ga0451853_2116684 | 3300041512 | Bacteria | 1815 |
| 514 | Ga0451853_2843714 | 3300041512 | Unclassified | 680 |
| 515 | Ga0451853_3651035 | 3300041512 | Bacteria | 3356 |
| 516 | Ga0439448_0011764 | 3300042005 | Bacteria | 2610 |
| 517 | Ga0439449_0154825 | 3300042007 | Bacteria | 855 |
| 518 | Ga0439457_000051 | 3300042014 | Bacteria | 24309 |
| 519 | Ga0439462_0008914 | 3300042015 | Bacteria | 2537 |
| 520 | Ga0450911_013748 | 3300042115 | Bacteria | 1080 |
| 521 | Ga0450904_000205 | 3300042139 | Bacteria | 12831 |
| 522 | Ga0439458_0008570 | 3300042157 | Bacteria | 2278 |
| 523 | Ga0466969_0140533 | 3300044656 | Bacteria | 1116 |
| 524 | Ga0466972_0006553 | 3300044658 | Bacteria | 5851 |
| 525 | Ga0466965_0026529 | 3300044683 | Bacteria | 2808 |
| 526 | Ga0466965_0029393 | 3300044683 | Bacteria | 2674 |
| 527 | Ga0466965_0061824 | 3300044683 | Bacteria | 1872 |
| 528 | Ga0466965_0108536 | 3300044683 | Unclassified | 1425 |
| 529 | Ga0466966_0165873 | 3300044684 | Bacteria | 1343 |
| 530 | Ga0466966_0210034 | 3300044684 | Bacteria | 1176 |
| 531 | Ga0466966_0351808 | 3300044684 | Bacteria | 885 |
| 532 | Ga0466961_0177653 | 3300044693 | Bacteria | 1322 |
| 533 | Ga0466961_0411151 | 3300044693 | Bacteria | 820 |
| 534 | Ga0466961_0550525 | 3300044693 | Bacteria | 695 |
| 535 | Ga0466964_0006233 | 3300044706 | Bacteria | 4445 |
| 536 | Ga0466971_0159725 | 3300044719 | Bacteria | 1055 |
| 537 | Ga0466968_0001045 | 3300044735 | Bacteria | 9798 |
| 538 | Ga0466970_0403186 | 3300044765 | Bacteria | 780 |
| 539 | Ga0466957_0000826 | 3300044842 | Bacteria | 15810 |
| 540 | Ga0466957_0065542 | 3300044842 | Bacteria | 2237 |
| 541 | Ga0466960_0113856 | 3300044901 | Bacteria | 1409 |
| 542 | Ga0466959_0165467 | 3300045049 | Bacteria | 1553 |
| 543 | Ga0466958_0198188 | 3300045836 | Bacteria | 1277 |
| 544 | Ga0466958_0584575 | 3300045836 | Bacteria | 726 |
| 545 | Ga0466967_0794093 | 3300045976 | Bacteria | 940 |
| 546 | Ga0495617_000048 | 3300046452 | Bacteria | 113357 |
| 547 | Ga0495627_000046 | 3300046453 | Bacteria | 176186 |
| 548 | Ga0495590_0032795 | 3300046457 | Bacteria | 1816 |
| 549 | Ga0495638_0016471 | 3300046460 | Bacteria | 4951 |
| 550 | Ga0495638_0056354 | 3300046460 | Bacteria | 2439 |
| 551 | Ga0495638_0088713 | 3300046460 | Bacteria | 1867 |
| 552 | Ga0495638_0250318 | 3300046460 | Unclassified | 977 |
| 553 | Ga0495653_0000018 | 3300046463 | Bacteria | 185787 |
| 554 | Ga0495650_0000173 | 3300046471 | Bacteria | 142734 |
| 555 | Ga0495650_0000227 | 3300046471 | Bacteria | 114662 |
| 556 | Ga0495650_0000712 | 3300046471 | Bacteria | 42514 |
| 557 | Ga0495650_0009894 | 3300046471 | Bacteria | 5375 |
| 558 | Ga0495605_0000332 | 3300046474 | Bacteria | 47384 |
| 559 | Ga0495605_0003120 | 3300046474 | Bacteria | 9985 |
| 560 | Ga0495605_0012320 | 3300046474 | Bacteria | 4746 |
| 561 | Ga0495584_0000159 | 3300046491 | Bacteria | 47242 |
| 562 | Ga0495584_0009198 | 3300046491 | Bacteria | 5095 |
| 563 | Ga0495585_0009818 | 3300046492 | Bacteria | 5726 |
| 564 | Ga0495585_0411527 | 3300046492 | Bacteria | 650 |
| 565 | Ga0495594_0200207 | 3300046499 | Bacteria | 1138 |
| 566 | Ga0495607_0005780 | 3300046501 | Bacteria | 8798 |
| 567 | Ga0495607_0018386 | 3300046501 | Bacteria | 4456 |
| 568 | Ga0495607_0031601 | 3300046501 | Bacteria | 3239 |
| 569 | Ga0495606_0001344 | 3300046507 | Bacteria | 33466 |
| 570 | Ga0495606_0002941 | 3300046507 | Bacteria | 18816 |
| 571 | Ga0495606_0023593 | 3300046507 | Bacteria | 4450 |
| 572 | Ga0495606_0107104 | 3300046507 | Bacteria | 1691 |
| 573 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 574 | Ga0495610_0004255 | 3300046512 | Bacteria | 10653 |
| 575 | Ga0495616_0026833 | 3300046513 | Bacteria | 3060 |
| 576 | Ga0495632_0000093 | 3300046519 | Bacteria | 91309 |
| 577 | Ga0495632_0032543 | 3300046519 | Bacteria | 2685 |
| 578 | Ga0495637_0002248 | 3300046520 | Bacteria | 10724 |
| 579 | Ga0495637_0005241 | 3300046520 | Bacteria | 6634 |
| 580 | Ga0495643_0011460 | 3300046522 | Bacteria | 5400 |
| 581 | Ga0495643_0107505 | 3300046522 | Bacteria | 1422 |
| 582 | Ga0495643_0162639 | 3300046522 | Bacteria | 1097 |
| 583 | Ga0495644_0090935 | 3300046523 | Bacteria | 1152 |
| 584 | Ga0495648_0003527 | 3300046524 | Bacteria | 13706 |
| 585 | Ga0495648_0037037 | 3300046524 | Bacteria | 3139 |
| 586 | Ga0495648_0038741 | 3300046524 | Bacteria | 3043 |
| 587 | Ga0495648_0045237 | 3300046524 | Bacteria | 2740 |
| 588 | Ga0495648_0069765 | 3300046524 | Bacteria | 2044 |
| 589 | Ga0495642_0000111 | 3300046528 | Bacteria | 46419 |
| 590 | Ga0495642_0016911 | 3300046528 | Bacteria | 2846 |
| 591 | Ga0495642_0073599 | 3300046528 | Bacteria | 1432 |
| 592 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 593 | Ga0495654_0007915 | 3300046530 | Bacteria | 5910 |
| 594 | Ga0495654_0037784 | 3300046530 | Bacteria | 2418 |
| 595 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 596 | Ga0495609_0001266 | 3300046538 | Bacteria | 17276 |
| 597 | Ga0495597_0004948 | 3300046542 | Bacteria | 7162 |
| 598 | Ga0495633_0000409 | 3300046558 | Bacteria | 44723 |
| 599 | Ga0495633_0008816 | 3300046558 | Bacteria | 5634 |
| 600 | Ga0495633_0011544 | 3300046558 | Bacteria | 4755 |
| 601 | Ga0495633_0126775 | 3300046558 | Bacteria | 1181 |
| 602 | Ga0495633_0185295 | 3300046558 | Bacteria | 958 |
| 603 | Ga0495656_0073064 | 3300046615 | Bacteria | 1528 |
| 604 | Ga0495656_0093464 | 3300046615 | Bacteria | 1379 |
| 605 | Ga0495668_0002762 | 3300046616 | Bacteria | 14038 |
| 606 | Ga0495668_0002817 | 3300046616 | Bacteria | 13834 |
| 607 | Ga0495625_0006244 | 3300046660 | Bacteria | 10672 |
| 608 | Ga0495625_0022645 | 3300046660 | Bacteria | 4814 |
| 609 | Ga0495625_0028546 | 3300046660 | Bacteria | 4184 |
| 610 | Ga0495625_0075789 | 3300046660 | Bacteria | 2353 |
| 611 | Ga0495661_0000295 | 3300046665 | Bacteria | 56555 |
| 612 | Ga0495661_0013898 | 3300046665 | Bacteria | 5400 |
| 613 | Ga0495661_0021505 | 3300046665 | Bacteria | 4205 |
| 614 | Ga0495661_0046029 | 3300046665 | Bacteria | 2665 |
| 615 | Ga0495588_0139361 | 3300046674 | Bacteria | 1281 |
| 616 | Ga0495670_0019070 | 3300046691 | Bacteria | 3380 |
| 617 | Ga0495670_0048754 | 3300046691 | Bacteria | 2118 |
| 618 | Ga0495670_0104150 | 3300046691 | Bacteria | 1464 |
| 619 | Ga0495671_0046835 | 3300046692 | Bacteria | 2161 |
| 620 | Ga0495671_0065748 | 3300046692 | Bacteria | 1785 |
| 621 | Ga0495671_0274660 | 3300046692 | Bacteria | 812 |
| 622 | Ga0495649_0003804 | 3300046694 | Bacteria | 9986 |
| 623 | Ga0495649_0012162 | 3300046694 | Bacteria | 5021 |
| 624 | Ga0495649_0022145 | 3300046694 | Bacteria | 3555 |
| 625 | Ga0495589_0000097 | 3300046794 | Bacteria | 84037 |
| 626 | Ga0495589_0000226 | 3300046794 | Bacteria | 47688 |
| 627 | Ga0495660_0000230 | 3300046810 | Bacteria | 55115 |
| 628 | Ga0495660_0005422 | 3300046810 | Bacteria | 7636 |
| 629 | Ga0495660_0005578 | 3300046810 | Bacteria | 7531 |
| 630 | Ga0495660_0012252 | 3300046810 | Bacteria | 4974 |
| 631 | Ga0495660_0131459 | 3300046810 | Bacteria | 1255 |
| 632 | Ga0495672_0000410 | 3300047320 | Bacteria | 51954 |
| 633 | Ga0495672_0005276 | 3300047320 | Bacteria | 10284 |
| 634 | Ga0495672_0141684 | 3300047320 | Bacteria | 1255 |
| 635 | Ga0495683_0013352 | 3300047323 | Bacteria | 4297 |
| 636 | Ga0495683_0039838 | 3300047323 | Bacteria | 2374 |
| 637 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 638 | Ga0495687_000949 | 3300047443 | Bacteria | 29869 |
| 639 | Ga0495687_001538 | 3300047443 | Bacteria | 20986 |
| 640 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 641 | Ga0495677_0000078 | 3300047445 | Bacteria | 49500 |
| 642 | Ga0495677_0003740 | 3300047445 | Bacteria | 5887 |
| 643 | Ga0495677_0066472 | 3300047445 | Bacteria | 1341 |
| 644 | Ga0495679_039944 | 3300047446 | Bacteria | 1461 |
| 645 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 646 | Ga0495673_0000034 | 3300047469 | Bacteria | 326920 |
| 647 | Ga0495673_0000150 | 3300047469 | Bacteria | 122768 |
| 648 | Ga0495686_0303388 | 3300047472 | Bacteria | 880 |
| 649 | Ga0495626_0000121 | 3300048091 | Bacteria | 102193 |
| 650 | Ga0495626_0004773 | 3300048091 | Bacteria | 8185 |
| 651 | Ga0495626_0044065 | 3300048091 | Bacteria | 2090 |
| 652 | Ga0496107_0628803 | 3300048910 | Bacteria | 792 |
| 653 | Ga0496109_0701276 | 3300048912 | Bacteria | 950 |
| 654 | Ga0496110_0385472 | 3300048913 | Bacteria | 1277 |
| 655 | Ga0496111_0151698 | 3300048914 | Bacteria | 1719 |
| 656 | Ga0496118_0243720 | 3300048921 | Bacteria | 1027 |
| 657 | Ga0496121_0027907 | 3300048924 | Bacteria | 5272 |
| 658 | Ga0496121_0613464 | 3300048924 | Bacteria | 669 |
| 659 | Ga0496122_0007022 | 3300048925 | Bacteria | 12660 |
| 660 | Ga0496122_0142923 | 3300048925 | Bacteria | 1493 |
| 661 | Ga0496123_0003043 | 3300048926 | Bacteria | 19312 |
| 662 | Ga0496123_0008423 | 3300048926 | Bacteria | 9474 |
| 663 | Ga0496124_0034257 | 3300048927 | Bacteria | 4459 |
| 664 | Ga0496124_0057939 | 3300048927 | Bacteria | 3261 |
| 665 | Ga0496124_0170800 | 3300048927 | Bacteria | 1684 |
| 666 | Ga0496125_0000006 | 3300048928 | Bacteria | 759385 |
| 667 | Ga0496125_0081021 | 3300048928 | Bacteria | 2482 |
| 668 | Ga0496126_0060699 | 3300048929 | Bacteria | 3399 |
| 669 | Ga0496126_0082691 | 3300048929 | Bacteria | 2836 |
| 670 | Ga0501306_035214 | 3300049127 | Bacteria | 759 |
| 671 | Ga0495678_000076 | 3300049459 | Bacteria | 125077 |
| 672 | Ga0495678_000780 | 3300049459 | Bacteria | 28573 |
| 673 | Ga0495678_026104 | 3300049459 | Bacteria | 2499 |
| 674 | Ga0501298_009226 | 3300049521 | Unclassified | 1674 |
| 675 | Ga0501034_0001219 | 3300049571 | Bacteria | 35187 |
| 676 | Ga0501034_0271376 | 3300049571 | Unclassified | 1637 |
| 677 | Ga0501073_0340950 | 3300049589 | Bacteria | 1034 |
| 678 | Ga0501076_0517444 | 3300049592 | Bacteria | 984 |
| 679 | Ga0501198_029454 | 3300049649 | Bacteria | 910 |
| 680 | Ga0501202_000293 | 3300049652 | Bacteria | 6851 |
| 681 | Ga0501209_162664 | 3300049656 | Bacteria | 676 |
| 682 | Ga0501217_021425 | 3300049661 | Bacteria | 1526 |
| 683 | Ga0501228_011713 | 3300049666 | Bacteria | 892 |
| 684 | Ga0501235_045234 | 3300049669 | Bacteria | 1012 |
| 685 | Ga0501249_006054 | 3300049679 | Bacteria | 2483 |
| 686 | Ga0501261_001605 | 3300049690 | Bacteria | 2772 |
| 687 | Ga0501221_000588 | 3300049704 | Bacteria | 5798 |
| 688 | Ga0501225_0000272 | 3300049705 | Bacteria | 16350 |
| 689 | Ga0501245_039540 | 3300049708 | Bacteria | 807 |
| 690 | Ga0501081_0892067 | 3300049743 | Unclassified | 670 |
| 691 | Ga0501241_001599 | 3300049758 | Bacteria | 4551 |
| 692 | Ga0501241_026330 | 3300049758 | Bacteria | 1084 |
| 693 | Ga0501269_000253 | 3300049766 | Bacteria | 15243 |
| 694 | Ga0501045_0862984 | 3300049824 | Bacteria | 666 |
| 695 | nmdc:mga03683_480919_c1 | 3300050489 | Bacteria | 600 |
| 696 | nmdc:mga03683_73693_c1 | 3300050489 | Bacteria | 1464 |
| 697 | nmdc:mga03n38_15942_c1 | 3300050490 | Bacteria | 2913 |
| 698 | nmdc:mga0k408_60597_c1 | 3300050493 | Bacteria | 2199 |
| 699 | nmdc:mga05p37_188220_c1 | 3300050507 | Bacteria | 2508 |
| 700 | nmdc:mga09592_282029_c1 | 3300050508 | Bacteria | 1441 |
| 701 | nmdc:mga08y16_357918_c1 | 3300050511 | Bacteria | 1498 |
| 702 | nmdc:mga08y16_434262_c1 | 3300050511 | Bacteria | 1341 |
| 703 | Ga0500583_0000504 | 3300053092 | Bacteria | 12002 |
| 704 | Ga0500594_0015910 | 3300053118 | Bacteria | 1821 |
| 705 | Ga0500594_0050566 | 3300053118 | Bacteria | 1169 |
| 706 | Ga0500642_0116964 | 3300053130 | Bacteria | 1246 |
| 707 | Ga0500655_058411 | 3300053133 | Unclassified | 775 |
| 708 | Ga0500559_0052121 | 3300053136 | Bacteria | 1808 |
| 709 | Ga0500586_005434 | 3300053145 | Bacteria | 3222 |
| 710 | Ga0500586_048917 | 3300053145 | Bacteria | 1454 |
| 711 | Ga0500589_008980 | 3300053147 | Bacteria | 4207 |
| 712 | Ga0500622_0000103 | 3300053156 | Bacteria | 86203 |
| 713 | Ga0500622_0036821 | 3300053156 | Bacteria | 2557 |
| 714 | Ga0500636_0085449 | 3300053177 | Bacteria | 1813 |
| 715 | Ga0500611_000044 | 3300053727 | Bacteria | 57726 |
| 716 | Ga0500645_072949 | 3300053730 | Bacteria | 984 |
| 717 | Ga0500587_026770 | 3300053739 | Bacteria | 775 |
| 718 | Ga0500661_010674 | 3300055283 | Bacteria | 1671 |
| 719 | Ga0587068_011007 | 3300059641 | Bacteria | 1358 |
| 720 | Ga0587072_073391 | 3300059643 | Bacteria | 727 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2857553236 | 2857555057 | 173 |
| 2 | iso_pu_bacteria | 2919476304 | 2919481262 | 173 |
| 3 | iso_pu_bacteria | 2929239360 | 2929245203 | 174 |
| 4 | iso_pu_bacteria | 2929921140 | 2929927432 | 174 |
| 5 | iso_pu_bacteria | 8003151029 | 8003151287 | 174 |
| 6 | 3300006946 | Ga0079104_1012978 | Ga0079104_10129782 | 176 |
| 7 | 3300015261 | Ga0182006_1000070 | Ga0182006_100007076 | 176 |
| 8 | 3300015265 | Ga0182005_1000003 | Ga0182005_100000377 | 176 |
| 9 | 3300027111 | Ga0209281_1024949 | Ga0209281_10249491 | 176 |
| 10 | 3300059643 | Ga0587072_073391 | Ga0587072_073391_49_579 | 176 |
| 11 | 3300002077 | JGI24744J21845_10037876 | JGI24744J21845_100378761 | 177 |
| 12 | 3300003763 | Ga0055529_1000565 | Ga0055529_100056523 | 177 |
| 13 | 3300005331 | Ga0070670_100357323 | Ga0070670_1003573232 | 177 |
| 14 | 3300005344 | Ga0070661_101069854 | Ga0070661_1010698541 | 177 |
| 15 | 3300005347 | Ga0070668_100078333 | Ga0070668_1000783332 | 177 |
| 16 | 3300005353 | Ga0070669_100032016 | Ga0070669_1000320163 | 177 |
| 17 | 3300005356 | Ga0070674_100019422 | Ga0070674_1000194222 | 177 |
| 18 | 3300005366 | Ga0070659_100272733 | Ga0070659_1002727332 | 177 |
| 19 | 3300005441 | Ga0070700_100120751 | Ga0070700_1001207512 | 177 |
| 20 | 3300005441 | Ga0070700_100411096 | Ga0070700_1004110962 | 177 |
| 21 | 3300005457 | Ga0070662_100297286 | Ga0070662_1002972861 | 177 |
| 22 | 3300005466 | Ga0070685_10083339 | Ga0070685_100833392 | 177 |
| 23 | 3300005543 | Ga0070672_100055912 | Ga0070672_1000559122 | 177 |
| 24 | 3300005719 | Ga0068861_100167451 | Ga0068861_1001674512 | 177 |
| 25 | 3300005844 | Ga0068862_100266114 | Ga0068862_1002661142 | 177 |
| 26 | 3300006881 | Ga0068865_100036633 | Ga0068865_1000366332 | 177 |
| 27 | 3300009093 | Ga0105240_10118786 | Ga0105240_101187863 | 177 |
| 28 | 3300009148 | Ga0105243_10272217 | Ga0105243_102722172 | 177 |
| 29 | 3300009553 | Ga0105249_10040482 | Ga0105249_100404824 | 177 |
| 30 | 3300013306 | Ga0163162_10030422 | Ga0163162_100304224 | 177 |
| 31 | 3300013306 | Ga0163162_10146804 | Ga0163162_101468042 | 177 |
| 32 | 3300014326 | Ga0157380_10081663 | Ga0157380_100816632 | 177 |
| 33 | 3300025272 | Ga0209455_1000063 | Ga0209455_1000063244 | 177 |
| 34 | 3300025913 | Ga0207695_10104269 | Ga0207695_101042693 | 177 |
| 35 | 3300025920 | Ga0207649_10925622 | Ga0207649_109256221 | 177 |
| 36 | 3300025925 | Ga0207650_10078473 | Ga0207650_100784734 | 177 |
| 37 | 3300025933 | Ga0207706_10045314 | Ga0207706_100453142 | 177 |
| 38 | 3300025935 | Ga0207709_10268343 | Ga0207709_102683432 | 177 |
| 39 | 3300025937 | Ga0207669_10100034 | Ga0207669_101000342 | 177 |
| 40 | 3300025938 | Ga0207704_10048658 | Ga0207704_100486582 | 177 |
| 41 | 3300025940 | Ga0207691_10050802 | Ga0207691_100508022 | 177 |
| 42 | 3300025961 | Ga0207712_10079316 | Ga0207712_100793162 | 177 |
| 43 | 3300026023 | Ga0207677_10835696 | Ga0207677_108356962 | 177 |
| 44 | 3300026075 | Ga0207708_10233392 | Ga0207708_102333922 | 177 |
| 45 | 3300026089 | Ga0207648_10100924 | Ga0207648_101009242 | 177 |
| 46 | 3300026118 | Ga0207675_100045900 | Ga0207675_1000459004 | 177 |
| 47 | 3300026142 | Ga0207698_10049348 | Ga0207698_100493483 | 177 |
| 48 | 3300028380 | Ga0268265_10244138 | Ga0268265_102441382 | 177 |
| 49 | 3300030745 | Ga0316182_1444012 | Ga0316182_14440121 | 177 |
| 50 | 3300046453 | Ga0495627_000046 | Ga0495627_000046_95462_95995 | 177 |
| 51 | 3300046522 | Ga0495643_0162639 | Ga0495643_0162639_69_602 | 177 |
| 52 | 3300046538 | Ga0495609_0001266 | Ga0495609_0001266_6882_7415 | 177 |
| 53 | 3300046810 | Ga0495660_0005422 | Ga0495660_0005422_281_814 | 177 |
| 54 | 3300046810 | Ga0495660_0012252 | Ga0495660_0012252_928_1461 | 177 |
| 55 | 3300047446 | Ga0495679_039944 | Ga0495679_039944_166_699 | 177 |
| 56 | 3300048927 | Ga0496124_0170800 | Ga0496124_0170800_184_717 | 177 |
| 57 | 3300049459 | Ga0495678_000076 | Ga0495678_000076_31124_31657 | 177 |
| 58 | 3300053177 | Ga0500636_0085449 | Ga0500636_0085449_221_754 | 177 |
| 59 | 3300001979 | JGI24740J21852_10002490 | JGI24740J21852_100024905 | 178 |
| 60 | 3300001990 | JGI24737J22298_10012954 | JGI24737J22298_100129543 | 178 |
| 61 | 3300002737 | JGI25162J39368_1002026 | JGI25162J39368_10020269 | 178 |
| 62 | 3300002738 | JGI25154J39366_1000004 | JGI25154J39366_1000004178 | 178 |
| 63 | 3300002741 | JGI25157J39369_1004662 | JGI25157J39369_10046622 | 178 |
| 64 | 3300002741 | JGI25157J39369_1010603 | JGI25157J39369_10106032 | 178 |
| 65 | 3300003214 | JGI25165J46597_1002705 | JGI25165J46597_10027052 | 178 |
| 66 | 3300003215 | JGI25153J46596_10006708 | JGI25153J46596_100067083 | 178 |
| 67 | 3300003316 | rootH1_10027867 | rootH1_100278673 | 178 |
| 68 | 3300003320 | rootH2_10058135 | rootH2_100581354 | 178 |
| 69 | 3300003322 | rootL2_10018465 | rootL2_100184654 | 178 |
| 70 | 3300003322 | rootL2_10254815 | rootL2_102548152 | 178 |
| 71 | 3300003322 | rootL2_10297884 | rootL2_102978842 | 178 |
| 72 | 3300003322 | rootL2_10315931 | rootL2_103159312 | 178 |
| 73 | 3300003323 | rootH1_10010194 | rootH1_100101943 | 178 |
| 74 | 3300003323 | rootH1_10165335 | rootH1_101653354 | 178 |
| 75 | 3300003323 | rootH1_10329849 | rootH1_103298492 | 178 |
| 76 | 3300003354 | JGI25160J50197_1000502 | JGI25160J50197_100050218 | 178 |
| 77 | 3300003354 | JGI25160J50197_1031094 | JGI25160J50197_10310942 | 178 |
| 78 | 3300003574 | Ga0007410J51695_1017575 | Ga0007410J51695_10175751 | 178 |
| 79 | 3300003575 | Ga0007409J51694_1047815 | Ga0007409J51694_10478151 | 178 |
| 80 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001692 | 178 |
| 81 | 3300003771 | Ga0055526_1002819 | Ga0055526_10028198 | 178 |
| 82 | 3300003790 | Ga0055528_1000198 | Ga0055528_100019828 | 178 |
| 83 | 3300003791 | Ga0055530_10001095 | Ga0055530_100010953 | 178 |
| 84 | 3300003794 | Ga0055531_10000066 | Ga0055531_1000006661 | 178 |
| 85 | 3300005262 | Ga0065165_1000182 | Ga0065165_100018218 | 178 |
| 86 | 3300005262 | Ga0065165_1015676 | Ga0065165_10156763 | 178 |
| 87 | 3300005290 | Ga0065712_10225353 | Ga0065712_102253531 | 178 |
| 88 | 3300005327 | Ga0070658_10006081 | Ga0070658_100060814 | 178 |
| 89 | 3300005327 | Ga0070658_10081937 | Ga0070658_100819373 | 178 |
| 90 | 3300005327 | Ga0070658_10131064 | Ga0070658_101310642 | 178 |
| 91 | 3300005327 | Ga0070658_10154095 | Ga0070658_101540952 | 178 |
| 92 | 3300005327 | Ga0070658_10563734 | Ga0070658_105637342 | 178 |
| 93 | 3300005328 | Ga0070676_10047522 | Ga0070676_100475222 | 178 |
| 94 | 3300005328 | Ga0070676_10122021 | Ga0070676_101220212 | 178 |
| 95 | 3300005328 | Ga0070676_10828537 | Ga0070676_108285371 | 178 |
| 96 | 3300005329 | Ga0070683_100248547 | Ga0070683_1002485472 | 178 |
| 97 | 3300005329 | Ga0070683_101470947 | Ga0070683_1014709471 | 178 |
| 98 | 3300005330 | Ga0070690_100006305 | Ga0070690_1000063051 | 178 |
| 99 | 3300005330 | Ga0070690_100075349 | Ga0070690_1000753492 | 178 |
| 100 | 3300005331 | Ga0070670_100022809 | Ga0070670_1000228094 | 178 |
| 101 | 3300005331 | Ga0070670_100061704 | Ga0070670_1000617043 | 178 |
| 102 | 3300005331 | Ga0070670_100242702 | Ga0070670_1002427021 | 178 |
| 103 | 3300005331 | Ga0070670_100329253 | Ga0070670_1003292532 | 178 |
| 104 | 3300005333 | Ga0070677_10104260 | Ga0070677_101042602 | 178 |
| 105 | 3300005333 | Ga0070677_10182920 | Ga0070677_101829202 | 178 |
| 106 | 3300005334 | Ga0068869_100008593 | Ga0068869_1000085932 | 178 |
| 107 | 3300005334 | Ga0068869_100046334 | Ga0068869_1000463342 | 178 |
| 108 | 3300005334 | Ga0068869_100565438 | Ga0068869_1005654381 | 178 |
| 109 | 3300005335 | Ga0070666_10029713 | Ga0070666_100297133 | 178 |
| 110 | 3300005335 | Ga0070666_10073391 | Ga0070666_100733912 | 178 |
| 111 | 3300005335 | Ga0070666_10231929 | Ga0070666_102319292 | 178 |
| 112 | 3300005335 | Ga0070666_10300118 | Ga0070666_103001181 | 178 |
| 113 | 3300005336 | Ga0070680_100112488 | Ga0070680_1001124883 | 178 |
| 114 | 3300005336 | Ga0070680_100718947 | Ga0070680_1007189472 | 178 |
| 115 | 3300005338 | Ga0068868_100172208 | Ga0068868_1001722082 | 178 |
| 116 | 3300005338 | Ga0068868_100795985 | Ga0068868_1007959851 | 178 |
| 117 | 3300005338 | Ga0068868_100806646 | Ga0068868_1008066461 | 178 |
| 118 | 3300005339 | Ga0070660_100077013 | Ga0070660_1000770132 | 178 |
| 119 | 3300005339 | Ga0070660_100233792 | Ga0070660_1002337922 | 178 |
| 120 | 3300005339 | Ga0070660_100452314 | Ga0070660_1004523142 | 178 |
| 121 | 3300005339 | Ga0070660_100711953 | Ga0070660_1007119531 | 178 |
| 122 | 3300005340 | Ga0070689_100386895 | Ga0070689_1003868951 | 178 |
| 123 | 3300005340 | Ga0070689_100745588 | Ga0070689_1007455881 | 178 |
| 124 | 3300005340 | Ga0070689_100849889 | Ga0070689_1008498891 | 178 |
| 125 | 3300005343 | Ga0070687_100059898 | Ga0070687_1000598982 | 178 |
| 126 | 3300005343 | Ga0070687_100535028 | Ga0070687_1005350282 | 178 |
| 127 | 3300005344 | Ga0070661_100336434 | Ga0070661_1003364342 | 178 |
| 128 | 3300005345 | Ga0070692_10067099 | Ga0070692_100670992 | 178 |
| 129 | 3300005347 | Ga0070668_100017133 | Ga0070668_1000171335 | 178 |
| 130 | 3300005353 | Ga0070669_100006476 | Ga0070669_1000064762 | 178 |
| 131 | 3300005353 | Ga0070669_100305439 | Ga0070669_1003054392 | 178 |
| 132 | 3300005354 | Ga0070675_100007775 | Ga0070675_1000077753 | 178 |
| 133 | 3300005354 | Ga0070675_100031307 | Ga0070675_1000313072 | 178 |
| 134 | 3300005354 | Ga0070675_100087551 | Ga0070675_1000875514 | 178 |
| 135 | 3300005354 | Ga0070675_100242007 | Ga0070675_1002420072 | 178 |
| 136 | 3300005354 | Ga0070675_100258942 | Ga0070675_1002589422 | 178 |
| 137 | 3300005354 | Ga0070675_100299983 | Ga0070675_1002999833 | 178 |
| 138 | 3300005354 | Ga0070675_100432026 | Ga0070675_1004320262 | 178 |
| 139 | 3300005354 | Ga0070675_100476966 | Ga0070675_1004769661 | 178 |
| 140 | 3300005355 | Ga0070671_100036407 | Ga0070671_1000364075 | 178 |
| 141 | 3300005356 | Ga0070674_100033911 | Ga0070674_1000339113 | 178 |
| 142 | 3300005356 | Ga0070674_100082322 | Ga0070674_1000823222 | 178 |
| 143 | 3300005356 | Ga0070674_100152763 | Ga0070674_1001527631 | 178 |
| 144 | 3300005364 | Ga0070673_100014221 | Ga0070673_1000142215 | 178 |
| 145 | 3300005364 | Ga0070673_100026035 | Ga0070673_1000260355 | 178 |
| 146 | 3300005364 | Ga0070673_100039035 | Ga0070673_1000390354 | 178 |
| 147 | 3300005364 | Ga0070673_100559003 | Ga0070673_1005590032 | 178 |
| 148 | 3300005364 | Ga0070673_100581498 | Ga0070673_1005814982 | 178 |
| 149 | 3300005365 | Ga0070688_100143325 | Ga0070688_1001433252 | 178 |
| 150 | 3300005366 | Ga0070659_100014736 | Ga0070659_1000147367 | 178 |
| 151 | 3300005366 | Ga0070659_100037941 | Ga0070659_1000379414 | 178 |
| 152 | 3300005366 | Ga0070659_100605785 | Ga0070659_1006057852 | 178 |
| 153 | 3300005367 | Ga0070667_100006292 | Ga0070667_1000062925 | 178 |
| 154 | 3300005367 | Ga0070667_100014368 | Ga0070667_1000143682 | 178 |
| 155 | 3300005367 | Ga0070667_100414646 | Ga0070667_1004146462 | 178 |
| 156 | 3300005367 | Ga0070667_100415022 | Ga0070667_1004150222 | 178 |
| 157 | 3300005438 | Ga0070701_10016364 | Ga0070701_100163642 | 178 |
| 158 | 3300005438 | Ga0070701_10023188 | Ga0070701_100231883 | 178 |
| 159 | 3300005441 | Ga0070700_100531734 | Ga0070700_1005317341 | 178 |
| 160 | 3300005444 | Ga0070694_100054383 | Ga0070694_1000543832 | 178 |
| 161 | 3300005455 | Ga0070663_100055066 | Ga0070663_1000550662 | 178 |
| 162 | 3300005456 | Ga0070678_100130357 | Ga0070678_1001303572 | 178 |
| 163 | 3300005456 | Ga0070678_100211342 | Ga0070678_1002113422 | 178 |
| 164 | 3300005456 | Ga0070678_100319322 | Ga0070678_1003193222 | 178 |
| 165 | 3300005457 | Ga0070662_100110586 | Ga0070662_1001105862 | 178 |
| 166 | 3300005457 | Ga0070662_100556169 | Ga0070662_1005561692 | 178 |
| 167 | 3300005457 | Ga0070662_100594775 | Ga0070662_1005947751 | 178 |
| 168 | 3300005459 | Ga0068867_100014009 | Ga0068867_1000140092 | 178 |
| 169 | 3300005459 | Ga0068867_100248629 | Ga0068867_1002486292 | 178 |
| 170 | 3300005466 | Ga0070685_10078891 | Ga0070685_100788912 | 178 |
| 171 | 3300005471 | Ga0070698_100087369 | Ga0070698_1000873692 | 178 |
| 172 | 3300005535 | Ga0070684_100038370 | Ga0070684_1000383702 | 178 |
| 173 | 3300005535 | Ga0070684_100172102 | Ga0070684_1001721022 | 178 |
| 174 | 3300005539 | Ga0068853_100038142 | Ga0068853_1000381422 | 178 |
| 175 | 3300005543 | Ga0070672_100007590 | Ga0070672_1000075904 | 178 |
| 176 | 3300005543 | Ga0070672_100028864 | Ga0070672_1000288644 | 178 |
| 177 | 3300005543 | Ga0070672_100039105 | Ga0070672_1000391054 | 178 |
| 178 | 3300005543 | Ga0070672_100046777 | Ga0070672_1000467773 | 178 |
| 179 | 3300005543 | Ga0070672_100152131 | Ga0070672_1001521312 | 178 |
| 180 | 3300005543 | Ga0070672_100259014 | Ga0070672_1002590141 | 178 |
| 181 | 3300005544 | Ga0070686_100174196 | Ga0070686_1001741962 | 178 |
| 182 | 3300005548 | Ga0070665_100000072 | Ga0070665_10000007265 | 178 |
| 183 | 3300005548 | Ga0070665_100164153 | Ga0070665_1001641531 | 178 |
| 184 | 3300005549 | Ga0070704_100024434 | Ga0070704_1000244342 | 178 |
| 185 | 3300005549 | Ga0070704_100668436 | Ga0070704_1006684361 | 178 |
| 186 | 3300005563 | Ga0068855_100062790 | Ga0068855_1000627903 | 178 |
| 187 | 3300005563 | Ga0068855_100131060 | Ga0068855_1001310604 | 178 |
| 188 | 3300005563 | Ga0068855_100149305 | Ga0068855_1001493052 | 178 |
| 189 | 3300005563 | Ga0068855_100239358 | Ga0068855_1002393583 | 178 |
| 190 | 3300005563 | Ga0068855_100750905 | Ga0068855_1007509051 | 178 |
| 191 | 3300005563 | Ga0068855_100758252 | Ga0068855_1007582522 | 178 |
| 192 | 3300005564 | Ga0070664_100083618 | Ga0070664_1000836182 | 178 |
| 193 | 3300005564 | Ga0070664_100141269 | Ga0070664_1001412692 | 178 |
| 194 | 3300005564 | Ga0070664_100184969 | Ga0070664_1001849692 | 178 |
| 195 | 3300005564 | Ga0070664_100644387 | Ga0070664_1006443872 | 178 |
| 196 | 3300005564 | Ga0070664_101170256 | Ga0070664_1011702561 | 178 |
| 197 | 3300005577 | Ga0068857_100015636 | Ga0068857_1000156365 | 178 |
| 198 | 3300005577 | Ga0068857_100431080 | Ga0068857_1004310803 | 178 |
| 199 | 3300005578 | Ga0068854_100400983 | Ga0068854_1004009833 | 178 |
| 200 | 3300005614 | Ga0068856_100198886 | Ga0068856_1001988862 | 178 |
| 201 | 3300005614 | Ga0068856_100235083 | Ga0068856_1002350832 | 178 |
| 202 | 3300005615 | Ga0070702_100019351 | Ga0070702_1000193512 | 178 |
| 203 | 3300005616 | Ga0068852_100082915 | Ga0068852_1000829154 | 178 |
| 204 | 3300005616 | Ga0068852_100118376 | Ga0068852_1001183763 | 178 |
| 205 | 3300005616 | Ga0068852_100268799 | Ga0068852_1002687992 | 178 |
| 206 | 3300005616 | Ga0068852_101068404 | Ga0068852_1010684042 | 178 |
| 207 | 3300005616 | Ga0068852_101374920 | Ga0068852_1013749201 | 178 |
| 208 | 3300005617 | Ga0068859_100142010 | Ga0068859_1001420103 | 178 |
| 209 | 3300005617 | Ga0068859_100878809 | Ga0068859_1008788092 | 178 |
| 210 | 3300005618 | Ga0068864_100023586 | Ga0068864_1000235862 | 178 |
| 211 | 3300005718 | Ga0068866_10015069 | Ga0068866_100150694 | 178 |
| 212 | 3300005719 | Ga0068861_100004049 | Ga0068861_1000040495 | 178 |
| 213 | 3300005719 | Ga0068861_100174837 | Ga0068861_1001748372 | 178 |
| 214 | 3300005719 | Ga0068861_101439500 | Ga0068861_1014395001 | 178 |
| 215 | 3300005840 | Ga0068870_10118377 | Ga0068870_101183772 | 178 |
| 216 | 3300005840 | Ga0068870_10380223 | Ga0068870_103802231 | 178 |
| 217 | 3300005841 | Ga0068863_100016559 | Ga0068863_1000165593 | 178 |
| 218 | 3300005841 | Ga0068863_100881237 | Ga0068863_1008812372 | 178 |
| 219 | 3300005842 | Ga0068858_100004355 | Ga0068858_1000043556 | 178 |
| 220 | 3300005842 | Ga0068858_100208856 | Ga0068858_1002088561 | 178 |
| 221 | 3300005843 | Ga0068860_100006985 | Ga0068860_1000069858 | 178 |
| 222 | 3300005844 | Ga0068862_100021261 | Ga0068862_1000212612 | 178 |
| 223 | 3300005844 | Ga0068862_100023221 | Ga0068862_1000232212 | 178 |
| 224 | 3300005985 | Ga0081539_10014767 | Ga0081539_100147676 | 178 |
| 225 | 3300006028 | Ga0070717_10540073 | Ga0070717_105400732 | 178 |
| 226 | 3300006028 | Ga0070717_11178015 | Ga0070717_111780152 | 178 |
| 227 | 3300006048 | Ga0075363_100114095 | Ga0075363_1001140951 | 178 |
| 228 | 3300006177 | Ga0075362_10103097 | Ga0075362_101030972 | 178 |
| 229 | 3300006177 | Ga0075362_10271580 | Ga0075362_102715801 | 178 |
| 230 | 3300006195 | Ga0075366_10020915 | Ga0075366_100209152 | 178 |
| 231 | 3300006237 | Ga0097621_100294117 | Ga0097621_1002941172 | 178 |
| 232 | 3300006237 | Ga0097621_100502382 | Ga0097621_1005023821 | 178 |
| 233 | 3300006237 | Ga0097621_100649095 | Ga0097621_1006490951 | 178 |
| 234 | 3300006237 | Ga0097621_101172875 | Ga0097621_1011728751 | 178 |
| 235 | 3300006358 | Ga0068871_100309030 | Ga0068871_1003090302 | 178 |
| 236 | 3300006358 | Ga0068871_100896637 | Ga0068871_1008966371 | 178 |
| 237 | 3300006871 | Ga0075434_100556879 | Ga0075434_1005568791 | 178 |
| 238 | 3300006880 | Ga0075429_100001972 | Ga0075429_1000019722 | 178 |
| 239 | 3300006881 | Ga0068865_100055260 | Ga0068865_1000552602 | 178 |
| 240 | 3300006881 | Ga0068865_100184920 | Ga0068865_1001849202 | 178 |
| 241 | 3300006881 | Ga0068865_101045816 | Ga0068865_1010458161 | 178 |
| 242 | 3300006931 | Ga0097620_100142013 | Ga0097620_1001420132 | 178 |
| 243 | 3300006931 | Ga0097620_100878768 | Ga0097620_1008787682 | 178 |
| 244 | 3300009036 | Ga0105244_10012232 | Ga0105244_100122325 | 178 |
| 245 | 3300009036 | Ga0105244_10211440 | Ga0105244_102114401 | 178 |
| 246 | 3300009093 | Ga0105240_10000706 | Ga0105240_1000070633 | 178 |
| 247 | 3300009093 | Ga0105240_10012165 | Ga0105240_100121653 | 178 |
| 248 | 3300009093 | Ga0105240_10909320 | Ga0105240_109093201 | 178 |
| 249 | 3300009094 | Ga0111539_10067626 | Ga0111539_100676262 | 178 |
| 250 | 3300009094 | Ga0111539_10477062 | Ga0111539_104770622 | 178 |
| 251 | 3300009094 | Ga0111539_10917825 | Ga0111539_109178252 | 178 |
| 252 | 3300009094 | Ga0111539_11136833 | Ga0111539_111368332 | 178 |
| 253 | 3300009094 | Ga0111539_11856748 | Ga0111539_118567481 | 178 |
| 254 | 3300009098 | Ga0105245_10207429 | Ga0105245_102074292 | 178 |
| 255 | 3300009098 | Ga0105245_10308744 | Ga0105245_103087442 | 178 |
| 256 | 3300009098 | Ga0105245_10690970 | Ga0105245_106909702 | 178 |
| 257 | 3300009098 | Ga0105245_11645249 | Ga0105245_116452491 | 178 |
| 258 | 3300009147 | Ga0114129_10008756 | Ga0114129_100087568 | 178 |
| 259 | 3300009148 | Ga0105243_10058898 | Ga0105243_100588982 | 178 |
| 260 | 3300009148 | Ga0105243_10323310 | Ga0105243_103233102 | 178 |
| 261 | 3300009174 | Ga0105241_10075560 | Ga0105241_100755603 | 178 |
| 262 | 3300009174 | Ga0105241_10342179 | Ga0105241_103421791 | 178 |
| 263 | 3300009174 | Ga0105241_11102432 | Ga0105241_111024321 | 178 |
| 264 | 3300009176 | Ga0105242_10113197 | Ga0105242_101131973 | 178 |
| 265 | 3300009176 | Ga0105242_10181182 | Ga0105242_101811822 | 178 |
| 266 | 3300009176 | Ga0105242_10305918 | Ga0105242_103059182 | 178 |
| 267 | 3300009176 | Ga0105242_11010046 | Ga0105242_110100461 | 178 |
| 268 | 3300009177 | Ga0105248_10364264 | Ga0105248_103642642 | 178 |
| 269 | 3300009177 | Ga0105248_10539677 | Ga0105248_105396772 | 178 |
| 270 | 3300009545 | Ga0105237_10004544 | Ga0105237_1000454410 | 178 |
| 271 | 3300009545 | Ga0105237_10013372 | Ga0105237_100133724 | 178 |
| 272 | 3300009545 | Ga0105237_10226593 | Ga0105237_102265931 | 178 |
| 273 | 3300009553 | Ga0105249_10026578 | Ga0105249_100265782 | 178 |
| 274 | 3300009553 | Ga0105249_10854052 | Ga0105249_108540522 | 178 |
| 275 | 3300010375 | Ga0105239_10000039 | Ga0105239_10000039140 | 178 |
| 276 | 3300010375 | Ga0105239_10283915 | Ga0105239_102839152 | 178 |
| 277 | 3300010375 | Ga0105239_10458484 | Ga0105239_104584842 | 178 |
| 278 | 3300013100 | Ga0157373_10002214 | Ga0157373_1000221414 | 178 |
| 279 | 3300013102 | Ga0157371_10000263 | Ga0157371_100002638 | 178 |
| 280 | 3300013102 | Ga0157371_10086714 | Ga0157371_100867142 | 178 |
| 281 | 3300013102 | Ga0157371_10186255 | Ga0157371_101862553 | 178 |
| 282 | 3300013102 | Ga0157371_10433575 | Ga0157371_104335752 | 178 |
| 283 | 3300013104 | Ga0157370_10087207 | Ga0157370_100872073 | 178 |
| 284 | 3300013104 | Ga0157370_10254646 | Ga0157370_102546462 | 178 |
| 285 | 3300013105 | Ga0157369_11870551 | Ga0157369_118705511 | 178 |
| 286 | 3300013296 | Ga0157374_10008921 | Ga0157374_100089218 | 178 |
| 287 | 3300013296 | Ga0157374_10038943 | Ga0157374_100389433 | 178 |
| 288 | 3300013296 | Ga0157374_10228118 | Ga0157374_102281181 | 178 |
| 289 | 3300013296 | Ga0157374_10510314 | Ga0157374_105103142 | 178 |
| 290 | 3300013297 | Ga0157378_10003189 | Ga0157378_100031893 | 178 |
| 291 | 3300013297 | Ga0157378_10315185 | Ga0157378_103151851 | 178 |
| 292 | 3300013297 | Ga0157378_10405309 | Ga0157378_104053092 | 178 |
| 293 | 3300013297 | Ga0157378_10467842 | Ga0157378_104678421 | 178 |
| 294 | 3300013306 | Ga0163162_10000010 | Ga0163162_1000001063 | 178 |
| 295 | 3300013306 | Ga0163162_10015161 | Ga0163162_100151616 | 178 |
| 296 | 3300013306 | Ga0163162_10182220 | Ga0163162_101822201 | 178 |
| 297 | 3300013306 | Ga0163162_10286793 | Ga0163162_102867932 | 178 |
| 298 | 3300013306 | Ga0163162_11365194 | Ga0163162_113651941 | 178 |
| 299 | 3300013307 | Ga0157372_10000266 | Ga0157372_1000026641 | 178 |
| 300 | 3300013307 | Ga0157372_10017724 | Ga0157372_1001772410 | 178 |
| 301 | 3300013307 | Ga0157372_10390463 | Ga0157372_103904632 | 178 |
| 302 | 3300013307 | Ga0157372_11189962 | Ga0157372_111899621 | 178 |
| 303 | 3300013307 | Ga0157372_11503583 | Ga0157372_115035831 | 178 |
| 304 | 3300013308 | Ga0157375_10005490 | Ga0157375_100054905 | 178 |
| 305 | 3300013308 | Ga0157375_10006022 | Ga0157375_100060223 | 178 |
| 306 | 3300013308 | Ga0157375_10227431 | Ga0157375_102274312 | 178 |
| 307 | 3300013308 | Ga0157375_10575227 | Ga0157375_105752271 | 178 |
| 308 | 3300014325 | Ga0163163_10119700 | Ga0163163_101197002 | 178 |
| 309 | 3300014325 | Ga0163163_10206266 | Ga0163163_102062662 | 178 |
| 310 | 3300014326 | Ga0157380_10001590 | Ga0157380_100015906 | 178 |
| 311 | 3300014326 | Ga0157380_10015585 | Ga0157380_100155852 | 178 |
| 312 | 3300014326 | Ga0157380_10085913 | Ga0157380_100859132 | 178 |
| 313 | 3300014326 | Ga0157380_10105588 | Ga0157380_101055882 | 178 |
| 314 | 3300014745 | Ga0157377_10035022 | Ga0157377_100350222 | 178 |
| 315 | 3300014745 | Ga0157377_10129451 | Ga0157377_101294512 | 178 |
| 316 | 3300014968 | Ga0157379_10010838 | Ga0157379_100108386 | 178 |
| 317 | 3300014968 | Ga0157379_10498934 | Ga0157379_104989343 | 178 |
| 318 | 3300014969 | Ga0157376_10369969 | Ga0157376_103699692 | 178 |
| 319 | 3300014969 | Ga0157376_10804823 | Ga0157376_108048231 | 178 |
| 320 | 3300014969 | Ga0157376_11442255 | Ga0157376_114422551 | 178 |
| 321 | 3300014969 | Ga0157376_11494715 | Ga0157376_114947151 | 178 |
| 322 | 3300017792 | Ga0163161_10032549 | Ga0163161_100325494 | 178 |
| 323 | 3300017792 | Ga0163161_10565044 | Ga0163161_105650442 | 178 |
| 324 | 3300020069 | Ga0197907_10049391 | Ga0197907_100493911 | 178 |
| 325 | 3300020610 | Ga0154015_1290094 | Ga0154015_12900942 | 178 |
| 326 | 3300025230 | Ga0209563_100007 | Ga0209563_100007407 | 178 |
| 327 | 3300025230 | Ga0209563_116249 | Ga0209563_1162492 | 178 |
| 328 | 3300025231 | Ga0207427_100172 | Ga0207427_10017265 | 178 |
| 329 | 3300025233 | Ga0209437_100034 | Ga0209437_100034170 | 178 |
| 330 | 3300025246 | Ga0209646_1000025 | Ga0209646_1000025159 | 178 |
| 331 | 3300025250 | Ga0209026_1000097 | Ga0209026_10000977 | 178 |
| 332 | 3300025250 | Ga0209026_1001446 | Ga0209026_10014463 | 178 |
| 333 | 3300025253 | Ga0209677_110274 | Ga0209677_1102742 | 178 |
| 334 | 3300025258 | Ga0209129_1018604 | Ga0209129_10186041 | 178 |
| 335 | 3300025261 | Ga0209233_1000038 | Ga0209233_1000038170 | 178 |
| 336 | 3300025261 | Ga0209233_1022403 | Ga0209233_10224032 | 178 |
| 337 | 3300025273 | Ga0209673_1000226 | Ga0209673_100022614 | 178 |
| 338 | 3300025295 | Ga0209564_1000006 | Ga0209564_1000006932 | 178 |
| 339 | 3300025295 | Ga0209564_1002364 | Ga0209564_10023647 | 178 |
| 340 | 3300025298 | Ga0209050_1000125 | Ga0209050_1000125181 | 178 |
| 341 | 3300025302 | Ga0207426_1000261 | Ga0207426_100026139 | 178 |
| 342 | 3300025302 | Ga0207426_1000898 | Ga0207426_100089818 | 178 |
| 343 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041405 | 178 |
| 344 | 3300025304 | Ga0209257_1003617 | Ga0209257_100361714 | 178 |
| 345 | 3300025315 | Ga0207697_10020450 | Ga0207697_100204502 | 178 |
| 346 | 3300025321 | Ga0207656_10102190 | Ga0207656_101021902 | 178 |
| 347 | 3300025728 | Ga0207655_1003374 | Ga0207655_10033743 | 178 |
| 348 | 3300025728 | Ga0207655_1019553 | Ga0207655_10195534 | 178 |
| 349 | 3300025885 | Ga0207653_10063423 | Ga0207653_100634232 | 178 |
| 350 | 3300025893 | Ga0207682_10017920 | Ga0207682_100179202 | 178 |
| 351 | 3300025893 | Ga0207682_10024021 | Ga0207682_100240213 | 178 |
| 352 | 3300025899 | Ga0207642_10040786 | Ga0207642_100407862 | 178 |
| 353 | 3300025901 | Ga0207688_10131067 | Ga0207688_101310672 | 178 |
| 354 | 3300025903 | Ga0207680_10017322 | Ga0207680_100173222 | 178 |
| 355 | 3300025903 | Ga0207680_10073731 | Ga0207680_100737312 | 178 |
| 356 | 3300025903 | Ga0207680_10136585 | Ga0207680_101365853 | 178 |
| 357 | 3300025904 | Ga0207647_10000662 | Ga0207647_1000066224 | 178 |
| 358 | 3300025904 | Ga0207647_10172898 | Ga0207647_101728982 | 178 |
| 359 | 3300025904 | Ga0207647_10220447 | Ga0207647_102204472 | 178 |
| 360 | 3300025907 | Ga0207645_10011322 | Ga0207645_100113222 | 178 |
| 361 | 3300025907 | Ga0207645_10028782 | Ga0207645_100287824 | 178 |
| 362 | 3300025908 | Ga0207643_10166547 | Ga0207643_101665472 | 178 |
| 363 | 3300025909 | Ga0207705_10064176 | Ga0207705_100641763 | 178 |
| 364 | 3300025909 | Ga0207705_10207776 | Ga0207705_102077761 | 178 |
| 365 | 3300025911 | Ga0207654_10016340 | Ga0207654_100163402 | 178 |
| 366 | 3300025913 | Ga0207695_10004844 | Ga0207695_1000484416 | 178 |
| 367 | 3300025913 | Ga0207695_10012457 | Ga0207695_100124576 | 178 |
| 368 | 3300025913 | Ga0207695_10186648 | Ga0207695_101866482 | 178 |
| 369 | 3300025913 | Ga0207695_10582723 | Ga0207695_105827232 | 178 |
| 370 | 3300025913 | Ga0207695_11054493 | Ga0207695_110544931 | 178 |
| 371 | 3300025914 | Ga0207671_10009023 | Ga0207671_100090233 | 178 |
| 372 | 3300025914 | Ga0207671_10011406 | Ga0207671_100114068 | 178 |
| 373 | 3300025914 | Ga0207671_10027835 | Ga0207671_100278351 | 178 |
| 374 | 3300025914 | Ga0207671_10069713 | Ga0207671_100697131 | 178 |
| 375 | 3300025914 | Ga0207671_10147834 | Ga0207671_101478342 | 178 |
| 376 | 3300025917 | Ga0207660_10257178 | Ga0207660_102571782 | 178 |
| 377 | 3300025917 | Ga0207660_10435269 | Ga0207660_104352691 | 178 |
| 378 | 3300025918 | Ga0207662_10023917 | Ga0207662_100239174 | 178 |
| 379 | 3300025919 | Ga0207657_10004452 | Ga0207657_1000445212 | 178 |
| 380 | 3300025919 | Ga0207657_10709583 | Ga0207657_107095832 | 178 |
| 381 | 3300025920 | Ga0207649_10248512 | Ga0207649_102485122 | 178 |
| 382 | 3300025920 | Ga0207649_10336893 | Ga0207649_103368932 | 178 |
| 383 | 3300025921 | Ga0207652_10152518 | Ga0207652_101525182 | 178 |
| 384 | 3300025923 | Ga0207681_10000326 | Ga0207681_1000032614 | 178 |
| 385 | 3300025923 | Ga0207681_10200460 | Ga0207681_102004602 | 178 |
| 386 | 3300025923 | Ga0207681_10379391 | Ga0207681_103793911 | 178 |
| 387 | 3300025923 | Ga0207681_10859066 | Ga0207681_108590662 | 178 |
| 388 | 3300025924 | Ga0207694_10121056 | Ga0207694_101210564 | 178 |
| 389 | 3300025924 | Ga0207694_10430384 | Ga0207694_104303841 | 178 |
| 390 | 3300025925 | Ga0207650_10004536 | Ga0207650_100045364 | 178 |
| 391 | 3300025925 | Ga0207650_10297828 | Ga0207650_102978282 | 178 |
| 392 | 3300025926 | Ga0207659_10006659 | Ga0207659_100066597 | 178 |
| 393 | 3300025926 | Ga0207659_10011221 | Ga0207659_100112215 | 178 |
| 394 | 3300025926 | Ga0207659_10099788 | Ga0207659_100997882 | 178 |
| 395 | 3300025926 | Ga0207659_10286865 | Ga0207659_102868652 | 178 |
| 396 | 3300025926 | Ga0207659_10865003 | Ga0207659_108650031 | 178 |
| 397 | 3300025927 | Ga0207687_10438689 | Ga0207687_104386891 | 178 |
| 398 | 3300025931 | Ga0207644_10103722 | Ga0207644_101037221 | 178 |
| 399 | 3300025932 | Ga0207690_10008888 | Ga0207690_100088887 | 178 |
| 400 | 3300025932 | Ga0207690_10045089 | Ga0207690_100450893 | 178 |
| 401 | 3300025932 | Ga0207690_10064005 | Ga0207690_100640053 | 178 |
| 402 | 3300025933 | Ga0207706_10022343 | Ga0207706_100223432 | 178 |
| 403 | 3300025933 | Ga0207706_10280298 | Ga0207706_102802982 | 178 |
| 404 | 3300025933 | Ga0207706_10398265 | Ga0207706_103982652 | 178 |
| 405 | 3300025934 | Ga0207686_10138733 | Ga0207686_101387331 | 178 |
| 406 | 3300025935 | Ga0207709_10048851 | Ga0207709_100488511 | 178 |
| 407 | 3300025936 | Ga0207670_10582123 | Ga0207670_105821231 | 178 |
| 408 | 3300025937 | Ga0207669_10030025 | Ga0207669_100300253 | 178 |
| 409 | 3300025937 | Ga0207669_10110015 | Ga0207669_101100151 | 178 |
| 410 | 3300025937 | Ga0207669_10794194 | Ga0207669_107941942 | 178 |
| 411 | 3300025937 | Ga0207669_11381908 | Ga0207669_113819081 | 178 |
| 412 | 3300025938 | Ga0207704_10005361 | Ga0207704_100053615 | 178 |
| 413 | 3300025938 | Ga0207704_10260191 | Ga0207704_102601912 | 178 |
| 414 | 3300025938 | Ga0207704_10848821 | Ga0207704_108488212 | 178 |
| 415 | 3300025940 | Ga0207691_10014600 | Ga0207691_100146003 | 178 |
| 416 | 3300025940 | Ga0207691_10023107 | Ga0207691_100231074 | 178 |
| 417 | 3300025940 | Ga0207691_10060131 | Ga0207691_100601315 | 178 |
| 418 | 3300025940 | Ga0207691_10066154 | Ga0207691_100661543 | 178 |
| 419 | 3300025940 | Ga0207691_10082662 | Ga0207691_100826622 | 178 |
| 420 | 3300025940 | Ga0207691_10211369 | Ga0207691_102113692 | 178 |
| 421 | 3300025940 | Ga0207691_10352983 | Ga0207691_103529832 | 178 |
| 422 | 3300025941 | Ga0207711_10094114 | Ga0207711_100941143 | 178 |
| 423 | 3300025941 | Ga0207711_10249989 | Ga0207711_102499892 | 178 |
| 424 | 3300025942 | Ga0207689_10004982 | Ga0207689_100049827 | 178 |
| 425 | 3300025942 | Ga0207689_10031602 | Ga0207689_100316023 | 178 |
| 426 | 3300025942 | Ga0207689_10152997 | Ga0207689_101529972 | 178 |
| 427 | 3300025942 | Ga0207689_10364685 | Ga0207689_103646852 | 178 |
| 428 | 3300025944 | Ga0207661_10079128 | Ga0207661_100791282 | 178 |
| 429 | 3300025944 | Ga0207661_10173369 | Ga0207661_101733692 | 178 |
| 430 | 3300025945 | Ga0207679_10032039 | Ga0207679_100320392 | 178 |
| 431 | 3300025945 | Ga0207679_10142990 | Ga0207679_101429902 | 178 |
| 432 | 3300025945 | Ga0207679_10802714 | Ga0207679_108027142 | 178 |
| 433 | 3300025949 | Ga0207667_10201043 | Ga0207667_102010433 | 178 |
| 434 | 3300025949 | Ga0207667_10456601 | Ga0207667_104566012 | 178 |
| 435 | 3300025949 | Ga0207667_10658801 | Ga0207667_106588012 | 178 |
| 436 | 3300025949 | Ga0207667_11565428 | Ga0207667_115654281 | 178 |
| 437 | 3300025960 | Ga0207651_10262702 | Ga0207651_102627022 | 178 |
| 438 | 3300025960 | Ga0207651_10363308 | Ga0207651_103633081 | 178 |
| 439 | 3300025960 | Ga0207651_10429652 | Ga0207651_104296522 | 178 |
| 440 | 3300025960 | Ga0207651_10842587 | Ga0207651_108425871 | 178 |
| 441 | 3300025960 | Ga0207651_11141895 | Ga0207651_111418951 | 178 |
| 442 | 3300025961 | Ga0207712_10040571 | Ga0207712_100405713 | 178 |
| 443 | 3300025972 | Ga0207668_10102815 | Ga0207668_101028152 | 178 |
| 444 | 3300025972 | Ga0207668_10263355 | Ga0207668_102633552 | 178 |
| 445 | 3300025981 | Ga0207640_10735066 | Ga0207640_107350662 | 178 |
| 446 | 3300025986 | Ga0207658_10002120 | Ga0207658_100021207 | 178 |
| 447 | 3300025986 | Ga0207658_10101506 | Ga0207658_101015063 | 178 |
| 448 | 3300025986 | Ga0207658_10239187 | Ga0207658_102391872 | 178 |
| 449 | 3300026023 | Ga0207677_10511390 | Ga0207677_105113901 | 178 |
| 450 | 3300026023 | Ga0207677_10805667 | Ga0207677_108056671 | 178 |
| 451 | 3300026035 | Ga0207703_10001042 | Ga0207703_1000104224 | 178 |
| 452 | 3300026041 | Ga0207639_10008764 | Ga0207639_100087643 | 178 |
| 453 | 3300026041 | Ga0207639_10124312 | Ga0207639_101243122 | 178 |
| 454 | 3300026067 | Ga0207678_10014659 | Ga0207678_100146593 | 178 |
| 455 | 3300026067 | Ga0207678_10125991 | Ga0207678_101259912 | 178 |
| 456 | 3300026067 | Ga0207678_10725688 | Ga0207678_107256881 | 178 |
| 457 | 3300026067 | Ga0207678_10971170 | Ga0207678_109711701 | 178 |
| 458 | 3300026075 | Ga0207708_10004039 | Ga0207708_100040394 | 178 |
| 459 | 3300026075 | Ga0207708_10214778 | Ga0207708_102147781 | 178 |
| 460 | 3300026078 | Ga0207702_10155484 | Ga0207702_101554842 | 178 |
| 461 | 3300026078 | Ga0207702_10679113 | Ga0207702_106791132 | 178 |
| 462 | 3300026088 | Ga0207641_10005975 | Ga0207641_1000597510 | 178 |
| 463 | 3300026089 | Ga0207648_10016034 | Ga0207648_100160342 | 178 |
| 464 | 3300026089 | Ga0207648_10026491 | Ga0207648_100264912 | 178 |
| 465 | 3300026089 | Ga0207648_10030734 | Ga0207648_100307346 | 178 |
| 466 | 3300026089 | Ga0207648_10041365 | Ga0207648_100413654 | 178 |
| 467 | 3300026089 | Ga0207648_10125386 | Ga0207648_101253862 | 178 |
| 468 | 3300026089 | Ga0207648_10278139 | Ga0207648_102781392 | 178 |
| 469 | 3300026095 | Ga0207676_10140378 | Ga0207676_101403782 | 178 |
| 470 | 3300026116 | Ga0207674_10128615 | Ga0207674_101286152 | 178 |
| 471 | 3300026116 | Ga0207674_10143691 | Ga0207674_101436912 | 178 |
| 472 | 3300026118 | Ga0207675_100005687 | Ga0207675_1000056876 | 178 |
| 473 | 3300026118 | Ga0207675_100009505 | Ga0207675_1000095054 | 178 |
| 474 | 3300026118 | Ga0207675_100057826 | Ga0207675_1000578265 | 178 |
| 475 | 3300026118 | Ga0207675_100159726 | Ga0207675_1001597261 | 178 |
| 476 | 3300026118 | Ga0207675_100587648 | Ga0207675_1005876481 | 178 |
| 477 | 3300026118 | Ga0207675_100769629 | Ga0207675_1007696292 | 178 |
| 478 | 3300026121 | Ga0207683_10009885 | Ga0207683_100098853 | 178 |
| 479 | 3300026121 | Ga0207683_10052785 | Ga0207683_100527852 | 178 |
| 480 | 3300026121 | Ga0207683_10057715 | Ga0207683_100577152 | 178 |
| 481 | 3300026121 | Ga0207683_10249295 | Ga0207683_102492952 | 178 |
| 482 | 3300026121 | Ga0207683_10364528 | Ga0207683_103645282 | 178 |
| 483 | 3300026142 | Ga0207698_10174206 | Ga0207698_101742061 | 178 |
| 484 | 3300027907 | Ga0207428_10676880 | Ga0207428_106768801 | 178 |
| 485 | 3300028379 | Ga0268266_10000089 | Ga0268266_1000008964 | 178 |
| 486 | 3300028379 | Ga0268266_10004476 | Ga0268266_100044767 | 178 |
| 487 | 3300028379 | Ga0268266_10051758 | Ga0268266_100517583 | 178 |
| 488 | 3300028379 | Ga0268266_10267474 | Ga0268266_102674742 | 178 |
| 489 | 3300028379 | Ga0268266_10307819 | Ga0268266_103078192 | 178 |
| 490 | 3300028379 | Ga0268266_10338075 | Ga0268266_103380752 | 178 |
| 491 | 3300028380 | Ga0268265_10262108 | Ga0268265_102621082 | 178 |
| 492 | 3300028381 | Ga0268264_10001548 | Ga0268264_1000154813 | 178 |
| 493 | 3300030744 | Ga0316181_1215377 | Ga0316181_12153772 | 178 |
| 494 | 3300030745 | Ga0316182_1111809 | Ga0316182_11118092 | 178 |
| 495 | 3300031730 | Ga0307516_10771555 | Ga0307516_107715551 | 178 |
| 496 | 3300031901 | Ga0307406_10221387 | Ga0307406_102213872 | 178 |
| 497 | 3300031995 | Ga0307409_102351618 | Ga0307409_1023516181 | 178 |
| 498 | 3300032004 | Ga0307414_10025237 | Ga0307414_100252373 | 178 |
| 499 | 3300032004 | Ga0307414_10120923 | Ga0307414_101209231 | 178 |
| 500 | 3300032004 | Ga0307414_10185893 | Ga0307414_101858933 | 178 |
| 501 | 3300032005 | Ga0307411_11225900 | Ga0307411_112259002 | 178 |
| 502 | 3300035691 | Ga0373931_0281197 | Ga0373931_0281197_182_718 | 178 |
| 503 | 3300037312 | Ga0395899_0004327 | Ga0395899_0004327_8147_8683 | 178 |
| 504 | 3300037312 | Ga0395899_0227739 | Ga0395899_0227739_39_575 | 178 |
| 505 | 3300037418 | Ga0395900_0011119 | Ga0395900_0011119_6993_7529 | 178 |
| 506 | 3300037418 | Ga0395900_0118609 | Ga0395900_0118609_1692_2267 | 178 |
| 507 | 3300037418 | Ga0395900_0266100 | Ga0395900_0266100_408_944 | 178 |
| 508 | 3300037418 | Ga0395900_0708058 | Ga0395900_0708058_45_587 | 178 |
| 509 | 3300037466 | Ga0395898_0040629 | Ga0395898_0040629_2361_2897 | 178 |
| 510 | 3300037466 | Ga0395898_0315631 | Ga0395898_0315631_407_943 | 178 |
| 511 | 3300037466 | Ga0395898_0383443 | Ga0395898_0383443_205_741 | 178 |
| 512 | 3300037466 | Ga0395898_0664270 | Ga0395898_0664270_395_970 | 178 |
| 513 | 3300037471 | Ga0395905_0043241 | Ga0395905_0043241_1859_2395 | 178 |
| 514 | 3300037471 | Ga0395905_0216238 | Ga0395905_0216238_608_1144 | 178 |
| 515 | 3300037471 | Ga0395905_0218941 | Ga0395905_0218941_143_679 | 178 |
| 516 | 3300038443 | Ga0395901_0060473 | Ga0395901_0060473_3103_3639 | 178 |
| 517 | 3300038443 | Ga0395901_0180469 | Ga0395901_0180469_406_942 | 178 |
| 518 | 3300038443 | Ga0395901_0229568 | Ga0395901_0229568_902_1438 | 178 |
| 519 | 3300038443 | Ga0395901_0867619 | Ga0395901_0867619_190_726 | 178 |
| 520 | 3300041404 | Ga0439436_0001868 | Ga0439436_0001868_1104_1640 | 178 |
| 521 | 3300041404 | Ga0439436_0131802 | Ga0439436_0131802_71_607 | 178 |
| 522 | 3300041406 | Ga0439439_0025805 | Ga0439439_0025805_330_866 | 178 |
| 523 | 3300041443 | Ga0451789_1155240 | Ga0451789_1155240_128_664 | 178 |
| 524 | 3300041459 | Ga0451800_0019211 | Ga0451800_0019211_54_590 | 178 |
| 525 | 3300041486 | Ga0451807_1987758 | Ga0451807_1987758_1220_1756 | 178 |
| 526 | 3300041507 | Ga0451851_0419090 | Ga0451851_0419090_158_694 | 178 |
| 527 | 3300041509 | Ga0451843_0382176 | Ga0451843_0382176_151_687 | 178 |
| 528 | 3300041512 | Ga0451853_2116684 | Ga0451853_2116684_672_1208 | 178 |
| 529 | 3300041512 | Ga0451853_2843714 | Ga0451853_2843714_12_551 | 178 |
| 530 | 3300041512 | Ga0451853_3651035 | Ga0451853_3651035_142_678 | 178 |
| 531 | 3300042005 | Ga0439448_0011764 | Ga0439448_0011764_2034_2570 | 178 |
| 532 | 3300042007 | Ga0439449_0154825 | Ga0439449_0154825_76_612 | 178 |
| 533 | 3300042014 | Ga0439457_000051 | Ga0439457_000051_23697_24233 | 178 |
| 534 | 3300042015 | Ga0439462_0008914 | Ga0439462_0008914_1587_2123 | 178 |
| 535 | 3300042115 | Ga0450911_013748 | Ga0450911_013748_199_735 | 178 |
| 536 | 3300042139 | Ga0450904_000205 | Ga0450904_000205_10090_10626 | 178 |
| 537 | 3300042157 | Ga0439458_0008570 | Ga0439458_0008570_1028_1576 | 178 |
| 538 | 3300044656 | Ga0466969_0140533 | Ga0466969_0140533_556_1092 | 178 |
| 539 | 3300044658 | Ga0466972_0006553 | Ga0466972_0006553_5108_5644 | 178 |
| 540 | 3300044683 | Ga0466965_0026529 | Ga0466965_0026529_2246_2782 | 178 |
| 541 | 3300044683 | Ga0466965_0029393 | Ga0466965_0029393_1572_2108 | 178 |
| 542 | 3300044683 | Ga0466965_0061824 | Ga0466965_0061824_811_1347 | 178 |
| 543 | 3300044683 | Ga0466965_0108536 | Ga0466965_0108536_91_627 | 178 |
| 544 | 3300044684 | Ga0466966_0165873 | Ga0466966_0165873_569_1105 | 178 |
| 545 | 3300044684 | Ga0466966_0210034 | Ga0466966_0210034_308_844 | 178 |
| 546 | 3300044684 | Ga0466966_0351808 | Ga0466966_0351808_50_628 | 178 |
| 547 | 3300044693 | Ga0466961_0177653 | Ga0466961_0177653_500_1075 | 178 |
| 548 | 3300044693 | Ga0466961_0411151 | Ga0466961_0411151_216_752 | 178 |
| 549 | 3300044693 | Ga0466961_0550525 | Ga0466961_0550525_148_684 | 178 |
| 550 | 3300044706 | Ga0466964_0006233 | Ga0466964_0006233_272_808 | 178 |
| 551 | 3300044719 | Ga0466971_0159725 | Ga0466971_0159725_222_758 | 178 |
| 552 | 3300044735 | Ga0466968_0001045 | Ga0466968_0001045_1151_1687 | 178 |
| 553 | 3300044765 | Ga0466970_0403186 | Ga0466970_0403186_16_552 | 178 |
| 554 | 3300044842 | Ga0466957_0000826 | Ga0466957_0000826_11514_12050 | 178 |
| 555 | 3300044842 | Ga0466957_0065542 | Ga0466957_0065542_1275_1811 | 178 |
| 556 | 3300044901 | Ga0466960_0113856 | Ga0466960_0113856_449_985 | 178 |
| 557 | 3300045049 | Ga0466959_0165467 | Ga0466959_0165467_266_802 | 178 |
| 558 | 3300045836 | Ga0466958_0198188 | Ga0466958_0198188_664_1200 | 178 |
| 559 | 3300045836 | Ga0466958_0584575 | Ga0466958_0584575_70_645 | 178 |
| 560 | 3300045976 | Ga0466967_0794093 | Ga0466967_0794093_224_760 | 178 |
| 561 | 3300046452 | Ga0495617_000048 | Ga0495617_000048_79181_79717 | 178 |
| 562 | 3300046457 | Ga0495590_0032795 | Ga0495590_0032795_348_884 | 178 |
| 563 | 3300046460 | Ga0495638_0016471 | Ga0495638_0016471_2487_3023 | 178 |
| 564 | 3300046460 | Ga0495638_0056354 | Ga0495638_0056354_702_1238 | 178 |
| 565 | 3300046460 | Ga0495638_0088713 | Ga0495638_0088713_505_1041 | 178 |
| 566 | 3300046460 | Ga0495638_0250318 | Ga0495638_0250318_257_793 | 178 |
| 567 | 3300046463 | Ga0495653_0000018 | Ga0495653_0000018_12256_12792 | 178 |
| 568 | 3300046471 | Ga0495650_0000173 | Ga0495650_0000173_12991_13527 | 178 |
| 569 | 3300046471 | Ga0495650_0000227 | Ga0495650_0000227_80265_80801 | 178 |
| 570 | 3300046471 | Ga0495650_0000712 | Ga0495650_0000712_33272_33808 | 178 |
| 571 | 3300046471 | Ga0495650_0009894 | Ga0495650_0009894_2466_3002 | 178 |
| 572 | 3300046474 | Ga0495605_0000332 | Ga0495605_0000332_985_1521 | 178 |
| 573 | 3300046474 | Ga0495605_0003120 | Ga0495605_0003120_4043_4579 | 178 |
| 574 | 3300046474 | Ga0495605_0012320 | Ga0495605_0012320_1209_1826 | 178 |
| 575 | 3300046491 | Ga0495584_0000159 | Ga0495584_0000159_28883_29458 | 178 |
| 576 | 3300046491 | Ga0495584_0009198 | Ga0495584_0009198_4020_4637 | 178 |
| 577 | 3300046492 | Ga0495585_0009818 | Ga0495585_0009818_1879_2415 | 178 |
| 578 | 3300046492 | Ga0495585_0411527 | Ga0495585_0411527_74_610 | 178 |
| 579 | 3300046499 | Ga0495594_0200207 | Ga0495594_0200207_155_691 | 178 |
| 580 | 3300046501 | Ga0495607_0005780 | Ga0495607_0005780_2355_2972 | 178 |
| 581 | 3300046501 | Ga0495607_0018386 | Ga0495607_0018386_998_1534 | 178 |
| 582 | 3300046501 | Ga0495607_0031601 | Ga0495607_0031601_857_1393 | 178 |
| 583 | 3300046507 | Ga0495606_0001344 | Ga0495606_0001344_1055_1591 | 178 |
| 584 | 3300046507 | Ga0495606_0002941 | Ga0495606_0002941_9281_9817 | 178 |
| 585 | 3300046507 | Ga0495606_0023593 | Ga0495606_0023593_2159_2695 | 178 |
| 586 | 3300046507 | Ga0495606_0107104 | Ga0495606_0107104_949_1524 | 178 |
| 587 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_86389_86925 | 178 |
| 588 | 3300046512 | Ga0495610_0004255 | Ga0495610_0004255_9851_10387 | 178 |
| 589 | 3300046513 | Ga0495616_0026833 | Ga0495616_0026833_474_1013 | 178 |
| 590 | 3300046519 | Ga0495632_0000093 | Ga0495632_0000093_38376_38912 | 178 |
| 591 | 3300046519 | Ga0495632_0032543 | Ga0495632_0032543_1488_2024 | 178 |
| 592 | 3300046520 | Ga0495637_0002248 | Ga0495637_0002248_348_884 | 178 |
| 593 | 3300046520 | Ga0495637_0005241 | Ga0495637_0005241_2142_2678 | 178 |
| 594 | 3300046522 | Ga0495643_0011460 | Ga0495643_0011460_3880_4416 | 178 |
| 595 | 3300046522 | Ga0495643_0107505 | Ga0495643_0107505_246_782 | 178 |
| 596 | 3300046523 | Ga0495644_0090935 | Ga0495644_0090935_126_662 | 178 |
| 597 | 3300046524 | Ga0495648_0003527 | Ga0495648_0003527_8129_8665 | 178 |
| 598 | 3300046524 | Ga0495648_0037037 | Ga0495648_0037037_2326_2862 | 178 |
| 599 | 3300046524 | Ga0495648_0038741 | Ga0495648_0038741_853_1389 | 178 |
| 600 | 3300046524 | Ga0495648_0045237 | Ga0495648_0045237_1938_2474 | 178 |
| 601 | 3300046524 | Ga0495648_0069765 | Ga0495648_0069765_132_668 | 178 |
| 602 | 3300046528 | Ga0495642_0000111 | Ga0495642_0000111_7508_8044 | 178 |
| 603 | 3300046528 | Ga0495642_0016911 | Ga0495642_0016911_922_1458 | 178 |
| 604 | 3300046528 | Ga0495642_0073599 | Ga0495642_0073599_312_848 | 178 |
| 605 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_72382_72918 | 178 |
| 606 | 3300046530 | Ga0495654_0007915 | Ga0495654_0007915_1401_1937 | 178 |
| 607 | 3300046530 | Ga0495654_0037784 | Ga0495654_0037784_749_1285 | 178 |
| 608 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_8865_9482 | 178 |
| 609 | 3300046542 | Ga0495597_0004948 | Ga0495597_0004948_5293_5829 | 178 |
| 610 | 3300046558 | Ga0495633_0000409 | Ga0495633_0000409_10125_10661 | 178 |
| 611 | 3300046558 | Ga0495633_0008816 | Ga0495633_0008816_548_1084 | 178 |
| 612 | 3300046558 | Ga0495633_0011544 | Ga0495633_0011544_2459_2995 | 178 |
| 613 | 3300046558 | Ga0495633_0126775 | Ga0495633_0126775_348_884 | 178 |
| 614 | 3300046558 | Ga0495633_0185295 | Ga0495633_0185295_252_788 | 178 |
| 615 | 3300046615 | Ga0495656_0073064 | Ga0495656_0073064_679_1296 | 178 |
| 616 | 3300046615 | Ga0495656_0093464 | Ga0495656_0093464_382_918 | 178 |
| 617 | 3300046616 | Ga0495668_0002762 | Ga0495668_0002762_4318_4854 | 178 |
| 618 | 3300046616 | Ga0495668_0002817 | Ga0495668_0002817_8376_8912 | 178 |
| 619 | 3300046660 | Ga0495625_0006244 | Ga0495625_0006244_4044_4580 | 178 |
| 620 | 3300046660 | Ga0495625_0022645 | Ga0495625_0022645_2226_2762 | 178 |
| 621 | 3300046660 | Ga0495625_0028546 | Ga0495625_0028546_135_671 | 178 |
| 622 | 3300046660 | Ga0495625_0075789 | Ga0495625_0075789_1617_2153 | 178 |
| 623 | 3300046665 | Ga0495661_0000295 | Ga0495661_0000295_47074_47691 | 178 |
| 624 | 3300046665 | Ga0495661_0013898 | Ga0495661_0013898_985_1521 | 178 |
| 625 | 3300046665 | Ga0495661_0021505 | Ga0495661_0021505_1007_1543 | 178 |
| 626 | 3300046665 | Ga0495661_0046029 | Ga0495661_0046029_486_1022 | 178 |
| 627 | 3300046674 | Ga0495588_0139361 | Ga0495588_0139361_434_970 | 178 |
| 628 | 3300046691 | Ga0495670_0019070 | Ga0495670_0019070_2352_2888 | 178 |
| 629 | 3300046691 | Ga0495670_0048754 | Ga0495670_0048754_883_1419 | 178 |
| 630 | 3300046691 | Ga0495670_0104150 | Ga0495670_0104150_401_937 | 178 |
| 631 | 3300046692 | Ga0495671_0046835 | Ga0495671_0046835_756_1292 | 178 |
| 632 | 3300046692 | Ga0495671_0065748 | Ga0495671_0065748_949_1485 | 178 |
| 633 | 3300046692 | Ga0495671_0274660 | Ga0495671_0274660_45_581 | 178 |
| 634 | 3300046694 | Ga0495649_0003804 | Ga0495649_0003804_4691_5227 | 178 |
| 635 | 3300046694 | Ga0495649_0012162 | Ga0495649_0012162_3700_4236 | 178 |
| 636 | 3300046694 | Ga0495649_0022145 | Ga0495649_0022145_378_914 | 178 |
| 637 | 3300046794 | Ga0495589_0000097 | Ga0495589_0000097_74556_75173 | 178 |
| 638 | 3300046794 | Ga0495589_0000226 | Ga0495589_0000226_985_1521 | 178 |
| 639 | 3300046810 | Ga0495660_0000230 | Ga0495660_0000230_985_1521 | 178 |
| 640 | 3300046810 | Ga0495660_0005578 | Ga0495660_0005578_3598_4134 | 178 |
| 641 | 3300046810 | Ga0495660_0131459 | Ga0495660_0131459_312_848 | 178 |
| 642 | 3300047320 | Ga0495672_0000410 | Ga0495672_0000410_41200_41736 | 178 |
| 643 | 3300047320 | Ga0495672_0005276 | Ga0495672_0005276_9648_10184 | 178 |
| 644 | 3300047320 | Ga0495672_0141684 | Ga0495672_0141684_603_1139 | 178 |
| 645 | 3300047323 | Ga0495683_0013352 | Ga0495683_0013352_2786_3322 | 178 |
| 646 | 3300047323 | Ga0495683_0039838 | Ga0495683_0039838_1188_1724 | 178 |
| 647 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_8865_9482 | 178 |
| 648 | 3300047443 | Ga0495687_000949 | Ga0495687_000949_980_1516 | 178 |
| 649 | 3300047443 | Ga0495687_001538 | Ga0495687_001538_1201_1776 | 178 |
| 650 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_189749_190366 | 178 |
| 651 | 3300047445 | Ga0495677_0000078 | Ga0495677_0000078_21474_22010 | 178 |
| 652 | 3300047445 | Ga0495677_0003740 | Ga0495677_0003740_763_1299 | 178 |
| 653 | 3300047445 | Ga0495677_0066472 | Ga0495677_0066472_13_549 | 178 |
| 654 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_75877_76413 | 178 |
| 655 | 3300047469 | Ga0495673_0000034 | Ga0495673_0000034_245588_246124 | 178 |
| 656 | 3300047469 | Ga0495673_0000150 | Ga0495673_0000150_35348_35884 | 178 |
| 657 | 3300047472 | Ga0495686_0303388 | Ga0495686_0303388_14_550 | 178 |
| 658 | 3300048091 | Ga0495626_0000121 | Ga0495626_0000121_27283_27900 | 178 |
| 659 | 3300048091 | Ga0495626_0004773 | Ga0495626_0004773_757_1293 | 178 |
| 660 | 3300048091 | Ga0495626_0044065 | Ga0495626_0044065_396_932 | 178 |
| 661 | 3300048910 | Ga0496107_0628803 | Ga0496107_0628803_158_694 | 178 |
| 662 | 3300048912 | Ga0496109_0701276 | Ga0496109_0701276_51_587 | 178 |
| 663 | 3300048913 | Ga0496110_0385472 | Ga0496110_0385472_537_1073 | 178 |
| 664 | 3300048914 | Ga0496111_0151698 | Ga0496111_0151698_205_741 | 178 |
| 665 | 3300048921 | Ga0496118_0243720 | Ga0496118_0243720_167_703 | 178 |
| 666 | 3300048924 | Ga0496121_0027907 | Ga0496121_0027907_4640_5176 | 178 |
| 667 | 3300048924 | Ga0496121_0613464 | Ga0496121_0613464_117_653 | 178 |
| 668 | 3300048925 | Ga0496122_0007022 | Ga0496122_0007022_2757_3293 | 178 |
| 669 | 3300048925 | Ga0496122_0142923 | Ga0496122_0142923_742_1278 | 178 |
| 670 | 3300048926 | Ga0496123_0003043 | Ga0496123_0003043_12661_13197 | 178 |
| 671 | 3300048926 | Ga0496123_0008423 | Ga0496123_0008423_6562_7098 | 178 |
| 672 | 3300048927 | Ga0496124_0034257 | Ga0496124_0034257_2574_3110 | 178 |
| 673 | 3300048927 | Ga0496124_0057939 | Ga0496124_0057939_2583_3119 | 178 |
| 674 | 3300048928 | Ga0496125_0000006 | Ga0496125_0000006_552342_552884 | 178 |
| 675 | 3300048928 | Ga0496125_0081021 | Ga0496125_0081021_1217_1753 | 178 |
| 676 | 3300048929 | Ga0496126_0060699 | Ga0496126_0060699_145_681 | 178 |
| 677 | 3300048929 | Ga0496126_0082691 | Ga0496126_0082691_773_1309 | 178 |
| 678 | 3300049127 | Ga0501306_035214 | Ga0501306_035214_212_748 | 178 |
| 679 | 3300049459 | Ga0495678_000780 | Ga0495678_000780_8804_9340 | 178 |
| 680 | 3300049459 | Ga0495678_026104 | Ga0495678_026104_1945_2484 | 178 |
| 681 | 3300049521 | Ga0501298_009226 | Ga0501298_009226_144_680 | 178 |
| 682 | 3300049571 | Ga0501034_0001219 | Ga0501034_0001219_23652_24188 | 178 |
| 683 | 3300049571 | Ga0501034_0271376 | Ga0501034_0271376_55_591 | 178 |
| 684 | 3300049589 | Ga0501073_0340950 | Ga0501073_0340950_290_826 | 178 |
| 685 | 3300049592 | Ga0501076_0517444 | Ga0501076_0517444_122_658 | 178 |
| 686 | 3300049649 | Ga0501198_029454 | Ga0501198_029454_346_882 | 178 |
| 687 | 3300049652 | Ga0501202_000293 | Ga0501202_000293_419_955 | 178 |
| 688 | 3300049656 | Ga0501209_162664 | Ga0501209_162664_124_660 | 178 |
| 689 | 3300049661 | Ga0501217_021425 | Ga0501217_021425_906_1442 | 178 |
| 690 | 3300049666 | Ga0501228_011713 | Ga0501228_011713_73_609 | 178 |
| 691 | 3300049669 | Ga0501235_045234 | Ga0501235_045234_66_602 | 178 |
| 692 | 3300049679 | Ga0501249_006054 | Ga0501249_006054_653_1189 | 178 |
| 693 | 3300049690 | Ga0501261_001605 | Ga0501261_001605_1663_2199 | 178 |
| 694 | 3300049704 | Ga0501221_000588 | Ga0501221_000588_339_875 | 178 |
| 695 | 3300049705 | Ga0501225_0000272 | Ga0501225_0000272_14534_15070 | 178 |
| 696 | 3300049708 | Ga0501245_039540 | Ga0501245_039540_90_626 | 178 |
| 697 | 3300049743 | Ga0501081_0892067 | Ga0501081_0892067_106_645 | 178 |
| 698 | 3300049758 | Ga0501241_001599 | Ga0501241_001599_3852_4388 | 178 |
| 699 | 3300049758 | Ga0501241_026330 | Ga0501241_026330_255_803 | 178 |
| 700 | 3300049766 | Ga0501269_000253 | Ga0501269_000253_3558_4094 | 178 |
| 701 | 3300049824 | Ga0501045_0862984 | Ga0501045_0862984_31_567 | 178 |
| 702 | 3300050489 | nmdc:mga03683_480919_c1 | nmdc:mga03683_480919_c1_28_564 | 178 |
| 703 | 3300050489 | nmdc:mga03683_73693_c1 | nmdc:mga03683_73693_c1_183_758 | 178 |
| 704 | 3300050490 | nmdc:mga03n38_15942_c1 | nmdc:mga03n38_15942_c1_995_1570 | 178 |
| 705 | 3300050493 | nmdc:mga0k408_60597_c1 | nmdc:mga0k408_60597_c1_862_1398 | 178 |
| 706 | 3300050507 | nmdc:mga05p37_188220_c1 | nmdc:mga05p37_188220_c1_380_916 | 178 |
| 707 | 3300050508 | nmdc:mga09592_282029_c1 | nmdc:mga09592_282029_c1_389_925 | 178 |
| 708 | 3300050511 | nmdc:mga08y16_357918_c1 | nmdc:mga08y16_357918_c1_400_939 | 178 |
| 709 | 3300050511 | nmdc:mga08y16_434262_c1 | nmdc:mga08y16_434262_c1_429_965 | 178 |
| 710 | 3300053092 | Ga0500583_0000504 | Ga0500583_0000504_48_584 | 178 |
| 711 | 3300053118 | Ga0500594_0015910 | Ga0500594_0015910_634_1170 | 178 |
| 712 | 3300053118 | Ga0500594_0050566 | Ga0500594_0050566_570_1106 | 178 |
| 713 | 3300053130 | Ga0500642_0116964 | Ga0500642_0116964_236_772 | 178 |
| 714 | 3300053133 | Ga0500655_058411 | Ga0500655_058411_149_685 | 178 |
| 715 | 3300053136 | Ga0500559_0052121 | Ga0500559_0052121_147_683 | 178 |
| 716 | 3300053145 | Ga0500586_005434 | Ga0500586_005434_1966_2502 | 178 |
| 717 | 3300053145 | Ga0500586_048917 | Ga0500586_048917_327_863 | 178 |
| 718 | 3300053147 | Ga0500589_008980 | Ga0500589_008980_2859_3395 | 178 |
| 719 | 3300053156 | Ga0500622_0000103 | Ga0500622_0000103_32806_33342 | 178 |
| 720 | 3300053156 | Ga0500622_0036821 | Ga0500622_0036821_734_1270 | 178 |
| 721 | 3300053727 | Ga0500611_000044 | Ga0500611_000044_18031_18567 | 178 |
| 722 | 3300053730 | Ga0500645_072949 | Ga0500645_072949_156_692 | 178 |
| 723 | 3300053739 | Ga0500587_026770 | Ga0500587_026770_159_695 | 178 |
| 724 | 3300055283 | Ga0500661_010674 | Ga0500661_010674_857_1393 | 178 |
| 725 | 3300059641 | Ga0587068_011007 | Ga0587068_011007_72_608 | 178 |
| 726 | iso_pu_bacteria | 2896109856 | 2896114536 | 178 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fhq-assembly1.cif.gz_B | crystal structure of general stress protein from bacteroides thetaiotaomicron | 0.8881 | 21 | 144 |
| 3ec6-assembly1.cif.gz_A-2 | crystal structure of the general stress protein 26 from bacillus anthracis str. sterne | 0.8714 | 22 | 144 |
| 2re7-assembly1.cif.gz_A-2 | crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution | 0.8622 | 23 | 140 |
| 2i02-assembly1.cif.gz_B | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8608 | 19 | 151 |
| 2i02-assembly1.cif.gz_A | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.8488 | 20 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2fhqB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8887 | 22 | 144 | 2.30.110.10 |
| 2re7A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8588 | 23 | 140 | 2.30.110.10 |
| 2i02B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8566 | 19 | 151 | 2.30.110.10 |
| 3ec6A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8565 | 22 | 144 | 2.30.110.10 |
| 2qeaB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8351 | 20 | 178 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A254N2B7-F1-model_v4 | General stress protein | 0.987 | 13 | 178 |
|
| AF-A0A519HWY4-F1-model_v4 | General stress protein | 0.9782 | 23 | 178 |
|
| AF-A0A519HWY4-F1-model_v4 | General stress protein | 0.9654 | 23 | 178 |
|
| AF-A0A1H8INP5-F1-model_v4 | General stress protein 26 | 0.9644 | 12 | 178 |
|
| AF-A0A4Q3C170-F1-model_v4 | deleted | 0.9555 | 61 | 178 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar