F477670

General Info

Members Datasets Scaffolds Average Seq Length
726 340 720 179

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100114095|Ga0075363_1001140951
Length 218
Sequence MKTINIRTTQVAPVCGNPPNAGAARANMGVPLISTYQERAMDSINANQPEHNHQDLIGEDAVKKIKDFVDNTSGCFFCTNDADGGPGDARPMTALQVDDMGNIWFISASDSLKNQELAVDPSATLYFQGSAHSEFMHIEGVATVLRDRAKLKELWSFTMKTWFTEGEDDPRITLIKFAPTYGYYWDTKHGRAVAGVKMLIGAVIGKTLDDSIEGRLDL

Samples

Sample ID Description Type Environment
1 2857553236 Duganella sp. R-74557 Isolate Unclassified
2 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
3 2919476304 Duganella sp. 3397 Isolate Unclassified
4 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
5 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
130 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
219 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
220 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
228 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
229 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
230 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
238 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
259 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
260 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
261 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
267 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
275 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
276 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
286 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
300 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
307 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
308 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
309 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
310 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
311 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
312 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
317 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
321 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
322 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
323 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
326 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
327 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
328 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
331 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
332 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
333 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
334 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
335 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
336 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
337 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
338 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.96
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0.28
Rhizoplane 0.96
Rhizosphere 85.81
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002490 3300001979 Bacteria 8328
2 JGI24737J22298_10012954 3300001990 Bacteria 2717
3 JGI24744J21845_10037876 3300002077 Unclassified 908
4 JGI25162J39368_1002026 3300002737 Bacteria 8939
5 JGI25154J39366_1000004 3300002738 Bacteria 346460
6 JGI25157J39369_1004662 3300002741 Bacteria 2421
7 JGI25157J39369_1010603 3300002741 Bacteria 1210
8 JGI25165J46597_1002705 3300003214 Bacteria 5271
9 JGI25153J46596_10006708 3300003215 Bacteria 5784
10 rootH1_10027867 3300003316 Bacteria 2904
11 rootH2_10058135 3300003320 Bacteria 3584
12 rootL2_10018465 3300003322 Bacteria 4931
13 rootL2_10254815 3300003322 Bacteria 1081
14 rootL2_10297884 3300003322 Bacteria 3998
15 rootL2_10315931 3300003322 Bacteria 2042
16 rootH1_10010194 3300003323 Bacteria 43591
17 rootH1_10165335 3300003323 Bacteria 5689
18 rootH1_10329849 3300003323 Bacteria 1016
19 JGI25160J50197_1000502 3300003354 Bacteria 23268
20 JGI25160J50197_1031094 3300003354 Bacteria 1380
21 Ga0007410J51695_1017575 3300003574 Bacteria 640
22 Ga0007409J51694_1047815 3300003575 Bacteria 735
23 Ga0055525_1000001 3300003759 Bacteria 1016948
24 Ga0055529_1000565 3300003763 Bacteria 30558
25 Ga0055526_1002819 3300003771 Bacteria 11505
26 Ga0055528_1000198 3300003790 Bacteria 51108
27 Ga0055530_10001095 3300003791 Bacteria 21241
28 Ga0055531_10000066 3300003794 Bacteria 115693
29 Ga0065165_1000182 3300005262 Bacteria 110108
30 Ga0065165_1015676 3300005262 Unclassified 2880
31 Ga0065712_10225353 3300005290 Bacteria 1028
32 Ga0070658_10006081 3300005327 Bacteria 9788
33 Ga0070658_10081937 3300005327 Bacteria 2651
34 Ga0070658_10131064 3300005327 Bacteria 2090
35 Ga0070658_10154095 3300005327 Bacteria 1925
36 Ga0070658_10563734 3300005327 Unclassified 986
37 Ga0070676_10047522 3300005328 Bacteria 2506
38 Ga0070676_10122021 3300005328 Bacteria 1637
39 Ga0070676_10828537 3300005328 Bacteria 684
40 Ga0070683_100248547 3300005329 Unclassified 1691
41 Ga0070683_101470947 3300005329 Bacteria 655
42 Ga0070690_100006305 3300005330 Bacteria 6726
43 Ga0070690_100075349 3300005330 Bacteria 2199
44 Ga0070670_100022809 3300005331 Bacteria 5386
45 Ga0070670_100061704 3300005331 Bacteria 3218
46 Ga0070670_100242702 3300005331 Bacteria 1568
47 Ga0070670_100329253 3300005331 Bacteria 1339
48 Ga0070670_100357323 3300005331 Bacteria 1284
49 Ga0070677_10104260 3300005333 Bacteria 1256
50 Ga0070677_10182920 3300005333 Unclassified 999
51 Ga0068869_100008593 3300005334 Bacteria 6594
52 Ga0068869_100046334 3300005334 Unclassified 3135
53 Ga0068869_100565438 3300005334 Unclassified 957
54 Ga0070666_10029713 3300005335 Bacteria 3595
55 Ga0070666_10073391 3300005335 Bacteria 2330
56 Ga0070666_10231929 3300005335 Bacteria 1304
57 Ga0070666_10300118 3300005335 Unclassified 1144
58 Ga0070680_100112488 3300005336 Bacteria 2267
59 Ga0070680_100718947 3300005336 Bacteria 859
60 Ga0068868_100172208 3300005338 Bacteria 1792
61 Ga0068868_100795985 3300005338 Bacteria 853
62 Ga0068868_100806646 3300005338 Unclassified 847
63 Ga0070660_100077013 3300005339 Bacteria 2612
64 Ga0070660_100233792 3300005339 Bacteria 1496
65 Ga0070660_100452314 3300005339 Bacteria 1065
66 Ga0070660_100711953 3300005339 Bacteria 842
67 Ga0070689_100386895 3300005340 Bacteria 1180
68 Ga0070689_100745588 3300005340 Bacteria 858
69 Ga0070689_100849889 3300005340 Bacteria 805
70 Ga0070687_100059898 3300005343 Bacteria 2006
71 Ga0070687_100535028 3300005343 Bacteria 795
72 Ga0070661_100336434 3300005344 Bacteria 1182
73 Ga0070661_101069854 3300005344 Bacteria 671
74 Ga0070692_10067099 3300005345 Bacteria 1904
75 Ga0070668_100017133 3300005347 Bacteria 5422
76 Ga0070668_100078333 3300005347 Bacteria 2585
77 Ga0070669_100006476 3300005353 Bacteria 8430
78 Ga0070669_100032016 3300005353 Bacteria 3798
79 Ga0070669_100305439 3300005353 Bacteria 1281
80 Ga0070675_100007775 3300005354 Bacteria 8302
81 Ga0070675_100031307 3300005354 Bacteria 4300
82 Ga0070675_100087551 3300005354 Bacteria 2604
83 Ga0070675_100242007 3300005354 Bacteria 1577
84 Ga0070675_100258942 3300005354 Bacteria 1524
85 Ga0070675_100299983 3300005354 Bacteria 1415
86 Ga0070675_100432026 3300005354 Bacteria 1179
87 Ga0070675_100476966 3300005354 Bacteria 1121
88 Ga0070671_100036407 3300005355 Bacteria 4081
89 Ga0070674_100019422 3300005356 Bacteria 4316
90 Ga0070674_100033911 3300005356 Bacteria 3403
91 Ga0070674_100082322 3300005356 Bacteria 2302
92 Ga0070674_100152763 3300005356 Bacteria 1743
93 Ga0070673_100014221 3300005364 Bacteria 5533
94 Ga0070673_100026035 3300005364 Bacteria 4314
95 Ga0070673_100039035 3300005364 Bacteria 3630
96 Ga0070673_100559003 3300005364 Bacteria 1040
97 Ga0070673_100581498 3300005364 Bacteria 1020
98 Ga0070688_100143325 3300005365 Unclassified 1625
99 Ga0070659_100014736 3300005366 Bacteria 5848
100 Ga0070659_100037941 3300005366 Bacteria 3756
101 Ga0070659_100272733 3300005366 Bacteria 1406
102 Ga0070659_100605785 3300005366 Bacteria 942
103 Ga0070667_100006292 3300005367 Bacteria 9867
104 Ga0070667_100014368 3300005367 Bacteria 6542
105 Ga0070667_100414646 3300005367 Bacteria 1227
106 Ga0070667_100415022 3300005367 Bacteria 1226
107 Ga0070701_10016364 3300005438 Bacteria 3447
108 Ga0070701_10023188 3300005438 Bacteria 2986
109 Ga0070700_100120751 3300005441 Bacteria 1755
110 Ga0070700_100411096 3300005441 Bacteria 1020
111 Ga0070700_100531734 3300005441 Bacteria 910
112 Ga0070694_100054383 3300005444 Unclassified 2712
113 Ga0070663_100055066 3300005455 Bacteria 2845
114 Ga0070678_100130357 3300005456 Bacteria 1997
115 Ga0070678_100211342 3300005456 Bacteria 1608
116 Ga0070678_100319322 3300005456 Bacteria 1326
117 Ga0070662_100110586 3300005457 Bacteria 2093
118 Ga0070662_100297286 3300005457 Bacteria 1311
119 Ga0070662_100556169 3300005457 Unclassified 962
120 Ga0070662_100594775 3300005457 Unclassified 930
121 Ga0068867_100014009 3300005459 Bacteria 5678
122 Ga0068867_100248629 3300005459 Bacteria 1445
123 Ga0070685_10078891 3300005466 Bacteria 1969
124 Ga0070685_10083339 3300005466 Bacteria 1921
125 Ga0070698_100087369 3300005471 Bacteria 3104
126 Ga0070684_100038370 3300005535 Unclassified 4114
127 Ga0070684_100172102 3300005535 Bacteria 1967
128 Ga0068853_100038142 3300005539 Unclassified 4091
129 Ga0070672_100007590 3300005543 Bacteria 7373
130 Ga0070672_100028864 3300005543 Bacteria 4154
131 Ga0070672_100039105 3300005543 Bacteria 3631
132 Ga0070672_100046777 3300005543 Bacteria 3354
133 Ga0070672_100055912 3300005543 Bacteria 3093
134 Ga0070672_100152131 3300005543 Bacteria 1914
135 Ga0070672_100259014 3300005543 Bacteria 1466
136 Ga0070686_100174196 3300005544 Bacteria 1524
137 Ga0070665_100000072 3300005548 Bacteria 198575
138 Ga0070665_100164153 3300005548 Bacteria 2224
139 Ga0070704_100024434 3300005549 Bacteria 3965
140 Ga0070704_100668436 3300005549 Bacteria 918
141 Ga0068855_100062790 3300005563 Bacteria 4336
142 Ga0068855_100131060 3300005563 Bacteria 2863
143 Ga0068855_100149305 3300005563 Bacteria 2658
144 Ga0068855_100239358 3300005563 Bacteria 2029
145 Ga0068855_100750905 3300005563 Bacteria 1040
146 Ga0068855_100758252 3300005563 Bacteria 1034
147 Ga0070664_100083618 3300005564 Bacteria 2754
148 Ga0070664_100141269 3300005564 Unclassified 2120
149 Ga0070664_100184969 3300005564 Bacteria 1854
150 Ga0070664_100644387 3300005564 Bacteria 984
151 Ga0070664_101170256 3300005564 Bacteria 725
152 Ga0068857_100015636 3300005577 Bacteria 6633
153 Ga0068857_100431080 3300005577 Bacteria 1230
154 Ga0068854_100400983 3300005578 Bacteria 1135
155 Ga0068856_100198886 3300005614 Bacteria 2019
156 Ga0068856_100235083 3300005614 Bacteria 1848
157 Ga0070702_100019351 3300005615 Bacteria 3549
158 Ga0068852_100082915 3300005616 Bacteria 2850
159 Ga0068852_100118376 3300005616 Bacteria 2420
160 Ga0068852_100268799 3300005616 Bacteria 1640
161 Ga0068852_101068404 3300005616 Bacteria 827
162 Ga0068852_101374920 3300005616 Bacteria 728
163 Ga0068859_100142010 3300005617 Bacteria 2475
164 Ga0068859_100878809 3300005617 Bacteria 982
165 Ga0068864_100023586 3300005618 Bacteria 5168
166 Ga0068866_10015069 3300005718 Bacteria 3428
167 Ga0068861_100004049 3300005719 Bacteria 9815
168 Ga0068861_100167451 3300005719 Bacteria 1818
169 Ga0068861_100174837 3300005719 Bacteria 1782
170 Ga0068861_101439500 3300005719 Bacteria 674
171 Ga0068870_10118377 3300005840 Bacteria 1522
172 Ga0068870_10380223 3300005840 Bacteria 914
173 Ga0068863_100016559 3300005841 Bacteria 7074
174 Ga0068863_100881237 3300005841 Bacteria 895
175 Ga0068858_100004355 3300005842 Bacteria 13888
176 Ga0068858_100208856 3300005842 Bacteria 1847
177 Ga0068860_100006985 3300005843 Bacteria 11311
178 Ga0068862_100021261 3300005844 Bacteria 5422
179 Ga0068862_100023221 3300005844 Bacteria 5195
180 Ga0068862_100266114 3300005844 Bacteria 1566
181 Ga0081539_10014767 3300005985 Bacteria 5742
182 Ga0070717_10540073 3300006028 Bacteria 1055
183 Ga0070717_11178015 3300006028 Bacteria 697
184 Ga0075363_100114095 3300006048 Bacteria 1504
185 Ga0075362_10103097 3300006177 Bacteria 1336
186 Ga0075362_10271580 3300006177 Bacteria 837
187 Ga0075366_10020915 3300006195 Bacteria 3801
188 Ga0097621_100294117 3300006237 Bacteria 1433
189 Ga0097621_100502382 3300006237 Bacteria 1098
190 Ga0097621_100649095 3300006237 Bacteria 968
191 Ga0097621_101172875 3300006237 Unclassified 723
192 Ga0068871_100309030 3300006358 Bacteria 1389
193 Ga0068871_100896637 3300006358 Bacteria 822
194 Ga0075434_100556879 3300006871 Unclassified 1166
195 Ga0075429_100001972 3300006880 Bacteria 17070
196 Ga0068865_100036633 3300006881 Bacteria 3308
197 Ga0068865_100055260 3300006881 Bacteria 2761
198 Ga0068865_100184920 3300006881 Bacteria 1607
199 Ga0068865_101045816 3300006881 Bacteria 717
200 Ga0097620_100142013 3300006931 Bacteria 2475
201 Ga0097620_100878768 3300006931 Bacteria 982
202 Ga0079104_1012978 3300006946 Bacteria 2590
203 Ga0105244_10012232 3300009036 Bacteria 5084
204 Ga0105244_10211440 3300009036 Bacteria 912
205 Ga0105240_10000706 3300009093 Bacteria 61234
206 Ga0105240_10012165 3300009093 Bacteria 11914
207 Ga0105240_10118786 3300009093 Bacteria 3186
208 Ga0105240_10909320 3300009093 Bacteria 946
209 Ga0111539_10067626 3300009094 Bacteria 4219
210 Ga0111539_10477062 3300009094 Bacteria 1453
211 Ga0111539_10917825 3300009094 Unclassified 1018
212 Ga0111539_11136833 3300009094 Bacteria 907
213 Ga0111539_11856748 3300009094 Bacteria 699
214 Ga0105245_10207429 3300009098 Bacteria 1884
215 Ga0105245_10308744 3300009098 Bacteria 1555
216 Ga0105245_10690970 3300009098 Unclassified 1053
217 Ga0105245_11645249 3300009098 Bacteria 694
218 Ga0114129_10008756 3300009147 Bacteria 14432
219 Ga0105243_10058898 3300009148 Bacteria 3063
220 Ga0105243_10272217 3300009148 Bacteria 1521
221 Ga0105243_10323310 3300009148 Bacteria 1407
222 Ga0105241_10075560 3300009174 Bacteria 2625
223 Ga0105241_10342179 3300009174 Bacteria 1296
224 Ga0105241_11102432 3300009174 Unclassified 748
225 Ga0105242_10113197 3300009176 Bacteria 2317
226 Ga0105242_10181182 3300009176 Bacteria 1859
227 Ga0105242_10305918 3300009176 Unclassified 1453
228 Ga0105242_11010046 3300009176 Unclassified 840
229 Ga0105248_10364264 3300009177 Bacteria 1627
230 Ga0105248_10539677 3300009177 Bacteria 1315
231 Ga0105237_10004544 3300009545 Bacteria 16031
232 Ga0105237_10013372 3300009545 Bacteria 8609
233 Ga0105237_10226593 3300009545 Bacteria 1869
234 Ga0105249_10026578 3300009553 Bacteria 5218
235 Ga0105249_10040482 3300009553 Bacteria 4233
236 Ga0105249_10854052 3300009553 Bacteria 976
237 Ga0105239_10000039 3300010375 Bacteria 203537
238 Ga0105239_10283915 3300010375 Bacteria 1864
239 Ga0105239_10458484 3300010375 Bacteria 1447
240 Ga0157373_10002214 3300013100 Bacteria 14711
241 Ga0157371_10000263 3300013102 Bacteria 71557
242 Ga0157371_10086714 3300013102 Bacteria 2217
243 Ga0157371_10186255 3300013102 Bacteria 1485
244 Ga0157371_10433575 3300013102 Bacteria 965
245 Ga0157370_10087207 3300013104 Bacteria 2932
246 Ga0157370_10254646 3300013104 Unclassified 1623
247 Ga0157369_11870551 3300013105 Bacteria 609
248 Ga0157374_10008921 3300013296 Bacteria 8593
249 Ga0157374_10038943 3300013296 Bacteria 4372
250 Ga0157374_10228118 3300013296 Bacteria 1829
251 Ga0157374_10510314 3300013296 Bacteria 1207
252 Ga0157378_10003189 3300013297 Bacteria 14572
253 Ga0157378_10315185 3300013297 Bacteria 1518
254 Ga0157378_10405309 3300013297 Bacteria 1345
255 Ga0157378_10467842 3300013297 Bacteria 1254
256 Ga0163162_10000010 3300013306 Bacteria 302032
257 Ga0163162_10015161 3300013306 Bacteria 7527
258 Ga0163162_10030422 3300013306 Bacteria 5350
259 Ga0163162_10146804 3300013306 Bacteria 2475
260 Ga0163162_10182220 3300013306 Bacteria 2226
261 Ga0163162_10286793 3300013306 Unclassified 1778
262 Ga0163162_11365194 3300013306 Bacteria 806
263 Ga0157372_10000266 3300013307 Bacteria 57783
264 Ga0157372_10017724 3300013307 Bacteria 7646
265 Ga0157372_10390463 3300013307 Bacteria 1622
266 Ga0157372_11189962 3300013307 Bacteria 881
267 Ga0157372_11503583 3300013307 Unclassified 776
268 Ga0157375_10005490 3300013308 Bacteria 11026
269 Ga0157375_10006022 3300013308 Bacteria 10577
270 Ga0157375_10227431 3300013308 Bacteria 2024
271 Ga0157375_10575227 3300013308 Bacteria 1287
272 Ga0163163_10119700 3300014325 Unclassified 2666
273 Ga0163163_10206266 3300014325 Bacteria 2014
274 Ga0157380_10001590 3300014326 Bacteria 14970
275 Ga0157380_10015585 3300014326 Bacteria 5588
276 Ga0157380_10081663 3300014326 Bacteria 2645
277 Ga0157380_10085913 3300014326 Bacteria 2584
278 Ga0157380_10105588 3300014326 Bacteria 2355
279 Ga0157377_10035022 3300014745 Bacteria 2751
280 Ga0157377_10129451 3300014745 Bacteria 1540
281 Ga0157379_10010838 3300014968 Bacteria 7950
282 Ga0157379_10498934 3300014968 Bacteria 1128
283 Ga0157376_10369969 3300014969 Bacteria 1377
284 Ga0157376_10804823 3300014969 Bacteria 953
285 Ga0157376_11442255 3300014969 Bacteria 721
286 Ga0157376_11494715 3300014969 Bacteria 708
287 Ga0182006_1000070 3300015261 Bacteria 137793
288 Ga0182005_1000003 3300015265 Bacteria 683269
289 Ga0163161_10032549 3300017792 Bacteria 3723
290 Ga0163161_10565044 3300017792 Bacteria 934
291 Ga0197907_10049391 3300020069 Bacteria 703
292 Ga0154015_1290094 3300020610 Bacteria 1283
293 Ga0209563_100007 3300025230 Bacteria 1579402
294 Ga0209563_116249 3300025230 Bacteria 918
295 Ga0207427_100172 3300025231 Bacteria 71550
296 Ga0209437_100034 3300025233 Bacteria 494007
297 Ga0209646_1000025 3300025246 Bacteria 406493
298 Ga0209026_1000097 3300025250 Bacteria 163212
299 Ga0209026_1001446 3300025250 Bacteria 10492
300 Ga0209677_110274 3300025253 Bacteria 1575
301 Ga0209129_1018604 3300025258 Bacteria 1330
302 Ga0209233_1000038 3300025261 Bacteria 548972
303 Ga0209233_1022403 3300025261 Unclassified 1618
304 Ga0209455_1000063 3300025272 Bacteria 333019
305 Ga0209673_1000226 3300025273 Bacteria 111427
306 Ga0209564_1000006 3300025295 Bacteria 1100927
307 Ga0209564_1002364 3300025295 Bacteria 15176
308 Ga0209050_1000125 3300025298 Bacteria 189641
309 Ga0207426_1000261 3300025302 Bacteria 112697
310 Ga0207426_1000898 3300025302 Bacteria 30067
311 Ga0209257_1000004 3300025304 Bacteria 1678347
312 Ga0209257_1003617 3300025304 Bacteria 13021
313 Ga0207697_10020450 3300025315 Bacteria 2710
314 Ga0207656_10102190 3300025321 Bacteria 1315
315 Ga0207655_1003374 3300025728 Bacteria 11935
316 Ga0207655_1019553 3300025728 Bacteria 3531
317 Ga0207653_10063423 3300025885 Bacteria 1251
318 Ga0207682_10017920 3300025893 Bacteria 2765
319 Ga0207682_10024021 3300025893 Bacteria 2411
320 Ga0207642_10040786 3300025899 Bacteria 2028
321 Ga0207688_10131067 3300025901 Unclassified 1470
322 Ga0207680_10017322 3300025903 Bacteria 3805
323 Ga0207680_10073731 3300025903 Unclassified 2123
324 Ga0207680_10136585 3300025903 Unclassified 1621
325 Ga0207647_10000662 3300025904 Bacteria 26925
326 Ga0207647_10172898 3300025904 Unclassified 1257
327 Ga0207647_10220447 3300025904 Bacteria 1093
328 Ga0207645_10011322 3300025907 Bacteria 6096
329 Ga0207645_10028782 3300025907 Bacteria 3584
330 Ga0207643_10166547 3300025908 Bacteria 1328
331 Ga0207705_10064176 3300025909 Bacteria 2654
332 Ga0207705_10207776 3300025909 Unclassified 1485
333 Ga0207654_10016340 3300025911 Bacteria 3864
334 Ga0207695_10004844 3300025913 Bacteria 18169
335 Ga0207695_10012457 3300025913 Bacteria 10211
336 Ga0207695_10104269 3300025913 Bacteria 2825
337 Ga0207695_10186648 3300025913 Bacteria 1992
338 Ga0207695_10582723 3300025913 Bacteria 1000
339 Ga0207695_11054493 3300025913 Bacteria 693
340 Ga0207671_10009023 3300025914 Bacteria 8389
341 Ga0207671_10011406 3300025914 Bacteria 7239
342 Ga0207671_10027835 3300025914 Bacteria 4225
343 Ga0207671_10069713 3300025914 Bacteria 2620
344 Ga0207671_10147834 3300025914 Bacteria 1814
345 Ga0207660_10257178 3300025917 Bacteria 1380
346 Ga0207660_10435269 3300025917 Bacteria 1059
347 Ga0207662_10023917 3300025918 Bacteria 3513
348 Ga0207657_10004452 3300025919 Bacteria 14820
349 Ga0207657_10709583 3300025919 Bacteria 781
350 Ga0207649_10248512 3300025920 Bacteria 1280
351 Ga0207649_10336893 3300025920 Bacteria 1113
352 Ga0207649_10925622 3300025920 Bacteria 684
353 Ga0207652_10152518 3300025921 Bacteria 2069
354 Ga0207681_10000326 3300025923 Bacteria 34311
355 Ga0207681_10200460 3300025923 Bacteria 1532
356 Ga0207681_10379391 3300025923 Bacteria 1138
357 Ga0207681_10859066 3300025923 Bacteria 759
358 Ga0207694_10121056 3300025924 Bacteria 2090
359 Ga0207694_10430384 3300025924 Bacteria 1100
360 Ga0207650_10004536 3300025925 Bacteria 9496
361 Ga0207650_10078473 3300025925 Bacteria 2498
362 Ga0207650_10297828 3300025925 Bacteria 1316
363 Ga0207659_10006659 3300025926 Bacteria 7099
364 Ga0207659_10011221 3300025926 Bacteria 5655
365 Ga0207659_10099788 3300025926 Bacteria 2186
366 Ga0207659_10286865 3300025926 Bacteria 1348
367 Ga0207659_10865003 3300025926 Bacteria 777
368 Ga0207687_10438689 3300025927 Bacteria 1081
369 Ga0207644_10103722 3300025931 Bacteria 2140
370 Ga0207690_10008888 3300025932 Bacteria 5963
371 Ga0207690_10045089 3300025932 Bacteria 2911
372 Ga0207690_10064005 3300025932 Bacteria 2509
373 Ga0207706_10022343 3300025933 Bacteria 5676
374 Ga0207706_10045314 3300025933 Bacteria 3897
375 Ga0207706_10280298 3300025933 Bacteria 1454
376 Ga0207706_10398265 3300025933 Bacteria 1194
377 Ga0207686_10138733 3300025934 Bacteria 1678
378 Ga0207709_10048851 3300025935 Bacteria 2580
379 Ga0207709_10268343 3300025935 Bacteria 1255
380 Ga0207670_10582123 3300025936 Bacteria 917
381 Ga0207669_10030025 3300025937 Bacteria 3015
382 Ga0207669_10100034 3300025937 Bacteria 1914
383 Ga0207669_10110015 3300025937 Bacteria 1844
384 Ga0207669_10794194 3300025937 Bacteria 784
385 Ga0207669_11381908 3300025937 Bacteria 599
386 Ga0207704_10005361 3300025938 Bacteria 5908
387 Ga0207704_10048658 3300025938 Bacteria 2544
388 Ga0207704_10260191 3300025938 Unclassified 1308
389 Ga0207704_10848821 3300025938 Bacteria 765
390 Ga0207691_10014600 3300025940 Bacteria 7486
391 Ga0207691_10023107 3300025940 Bacteria 5856
392 Ga0207691_10050802 3300025940 Bacteria 3794
393 Ga0207691_10060131 3300025940 Bacteria 3453
394 Ga0207691_10066154 3300025940 Bacteria 3271
395 Ga0207691_10082662 3300025940 Bacteria 2884
396 Ga0207691_10211369 3300025940 Bacteria 1685
397 Ga0207691_10352983 3300025940 Bacteria 1258
398 Ga0207711_10094114 3300025941 Bacteria 2640
399 Ga0207711_10249989 3300025941 Bacteria 1628
400 Ga0207689_10004982 3300025942 Bacteria 11962
401 Ga0207689_10031602 3300025942 Bacteria 4406
402 Ga0207689_10152997 3300025942 Bacteria 1901
403 Ga0207689_10364685 3300025942 Bacteria 1201
404 Ga0207661_10079128 3300025944 Unclassified 2709
405 Ga0207661_10173369 3300025944 Bacteria 1879
406 Ga0207679_10032039 3300025945 Bacteria 3685
407 Ga0207679_10142990 3300025945 Bacteria 1936
408 Ga0207679_10802714 3300025945 Bacteria 858
409 Ga0207667_10201043 3300025949 Bacteria 2044
410 Ga0207667_10456601 3300025949 Bacteria 1298
411 Ga0207667_10658801 3300025949 Bacteria 1052
412 Ga0207667_11565428 3300025949 Unclassified 629
413 Ga0207651_10262702 3300025960 Bacteria 1418
414 Ga0207651_10363308 3300025960 Bacteria 1222
415 Ga0207651_10429652 3300025960 Bacteria 1129
416 Ga0207651_10842587 3300025960 Bacteria 814
417 Ga0207651_11141895 3300025960 Bacteria 699
418 Ga0207712_10040571 3300025961 Bacteria 3196
419 Ga0207712_10079316 3300025961 Bacteria 2385
420 Ga0207668_10102815 3300025972 Bacteria 2126
421 Ga0207668_10263355 3300025972 Bacteria 1406
422 Ga0207640_10735066 3300025981 Bacteria 849
423 Ga0207658_10002120 3300025986 Bacteria 14748
424 Ga0207658_10101506 3300025986 Bacteria 2254
425 Ga0207658_10239187 3300025986 Bacteria 1537
426 Ga0207677_10511390 3300026023 Bacteria 1040
427 Ga0207677_10805667 3300026023 Bacteria 841
428 Ga0207677_10835696 3300026023 Bacteria 827
429 Ga0207703_10001042 3300026035 Bacteria 26535
430 Ga0207639_10008764 3300026041 Bacteria 6950
431 Ga0207639_10124312 3300026041 Unclassified 2125
432 Ga0207678_10014659 3300026067 Bacteria 6898
433 Ga0207678_10125991 3300026067 Bacteria 2185
434 Ga0207678_10725688 3300026067 Bacteria 875
435 Ga0207678_10971170 3300026067 Bacteria 752
436 Ga0207708_10004039 3300026075 Bacteria 10790
437 Ga0207708_10214778 3300026075 Bacteria 1539
438 Ga0207708_10233392 3300026075 Bacteria 1478
439 Ga0207702_10155484 3300026078 Bacteria 2084
440 Ga0207702_10679113 3300026078 Unclassified 1014
441 Ga0207641_10005975 3300026088 Bacteria 10314
442 Ga0207648_10016034 3300026089 Bacteria 6865
443 Ga0207648_10026491 3300026089 Bacteria 5151
444 Ga0207648_10030734 3300026089 Unclassified 4754
445 Ga0207648_10041365 3300026089 Bacteria 4047
446 Ga0207648_10100924 3300026089 Bacteria 2529
447 Ga0207648_10125386 3300026089 Bacteria 2259
448 Ga0207648_10278139 3300026089 Bacteria 1496
449 Ga0207676_10140378 3300026095 Bacteria 2067
450 Ga0207674_10128615 3300026116 Bacteria 2497
451 Ga0207674_10143691 3300026116 Unclassified 2345
452 Ga0207675_100005687 3300026118 Bacteria 11928
453 Ga0207675_100009505 3300026118 Bacteria 9099
454 Ga0207675_100045900 3300026118 Bacteria 4081
455 Ga0207675_100057826 3300026118 Bacteria 3618
456 Ga0207675_100159726 3300026118 Unclassified 2149
457 Ga0207675_100587648 3300026118 Unclassified 1115
458 Ga0207675_100769629 3300026118 Bacteria 975
459 Ga0207683_10009885 3300026121 Bacteria 8134
460 Ga0207683_10052785 3300026121 Bacteria 3563
461 Ga0207683_10057715 3300026121 Bacteria 3408
462 Ga0207683_10249295 3300026121 Bacteria 1620
463 Ga0207683_10364528 3300026121 Bacteria 1327
464 Ga0207698_10049348 3300026142 Bacteria 3203
465 Ga0207698_10174206 3300026142 Bacteria 1898
466 Ga0209281_1024949 3300027111 Bacteria 1119
467 Ga0207428_10676880 3300027907 Bacteria 739
468 Ga0268266_10000089 3300028379 Bacteria 198566
469 Ga0268266_10004476 3300028379 Bacteria 13361
470 Ga0268266_10051758 3300028379 Bacteria 3526
471 Ga0268266_10267474 3300028379 Unclassified 1586
472 Ga0268266_10307819 3300028379 Bacteria 1480
473 Ga0268266_10338075 3300028379 Bacteria 1413
474 Ga0268265_10244138 3300028380 Bacteria 1586
475 Ga0268265_10262108 3300028380 Bacteria 1537
476 Ga0268264_10001548 3300028381 Bacteria 21322
477 Ga0316181_1215377 3300030744 Bacteria 1764
478 Ga0316182_1111809 3300030745 Bacteria 878
479 Ga0316182_1444012 3300030745 Bacteria 1015
480 Ga0307516_10771555 3300031730 Bacteria 622
481 Ga0307406_10221387 3300031901 Bacteria 1407
482 Ga0307409_102351618 3300031995 Unclassified 562
483 Ga0307414_10025237 3300032004 Bacteria 3804
484 Ga0307414_10120923 3300032004 Unclassified 2013
485 Ga0307414_10185893 3300032004 Bacteria 1676
486 Ga0307411_11225900 3300032005 Unclassified 681
487 Ga0373931_0281197 3300035691 Bacteria 1022
488 Ga0395899_0004327 3300037312 Bacteria 11087
489 Ga0395899_0227739 3300037312 Bacteria 1288
490 Ga0395900_0011119 3300037418 Bacteria 9198
491 Ga0395900_0118609 3300037418 Bacteria 2715
492 Ga0395900_0266100 3300037418 Bacteria 1710
493 Ga0395900_0708058 3300037418 Bacteria 940
494 Ga0395898_0040629 3300037466 Bacteria 4598
495 Ga0395898_0315631 3300037466 Bacteria 1491
496 Ga0395898_0383443 3300037466 Bacteria 1340
497 Ga0395898_0664270 3300037466 Bacteria 984
498 Ga0395905_0043241 3300037471 Bacteria 4226
499 Ga0395905_0216238 3300037471 Bacteria 1794
500 Ga0395905_0218941 3300037471 Bacteria 1782
501 Ga0395901_0060473 3300038443 Bacteria 3942
502 Ga0395901_0180469 3300038443 Bacteria 2214
503 Ga0395901_0229568 3300038443 Bacteria 1938
504 Ga0395901_0867619 3300038443 Bacteria 886
505 Ga0439436_0001868 3300041404 Bacteria 6221
506 Ga0439436_0131802 3300041404 Bacteria 701
507 Ga0439439_0025805 3300041406 Unclassified 1480
508 Ga0451789_1155240 3300041443 Bacteria 800
509 Ga0451800_0019211 3300041459 Bacteria 1123
510 Ga0451807_1987758 3300041486 Bacteria 1890
511 Ga0451851_0419090 3300041507 Bacteria 836
512 Ga0451843_0382176 3300041509 Bacteria 922
513 Ga0451853_2116684 3300041512 Bacteria 1815
514 Ga0451853_2843714 3300041512 Unclassified 680
515 Ga0451853_3651035 3300041512 Bacteria 3356
516 Ga0439448_0011764 3300042005 Bacteria 2610
517 Ga0439449_0154825 3300042007 Bacteria 855
518 Ga0439457_000051 3300042014 Bacteria 24309
519 Ga0439462_0008914 3300042015 Bacteria 2537
520 Ga0450911_013748 3300042115 Bacteria 1080
521 Ga0450904_000205 3300042139 Bacteria 12831
522 Ga0439458_0008570 3300042157 Bacteria 2278
523 Ga0466969_0140533 3300044656 Bacteria 1116
524 Ga0466972_0006553 3300044658 Bacteria 5851
525 Ga0466965_0026529 3300044683 Bacteria 2808
526 Ga0466965_0029393 3300044683 Bacteria 2674
527 Ga0466965_0061824 3300044683 Bacteria 1872
528 Ga0466965_0108536 3300044683 Unclassified 1425
529 Ga0466966_0165873 3300044684 Bacteria 1343
530 Ga0466966_0210034 3300044684 Bacteria 1176
531 Ga0466966_0351808 3300044684 Bacteria 885
532 Ga0466961_0177653 3300044693 Bacteria 1322
533 Ga0466961_0411151 3300044693 Bacteria 820
534 Ga0466961_0550525 3300044693 Bacteria 695
535 Ga0466964_0006233 3300044706 Bacteria 4445
536 Ga0466971_0159725 3300044719 Bacteria 1055
537 Ga0466968_0001045 3300044735 Bacteria 9798
538 Ga0466970_0403186 3300044765 Bacteria 780
539 Ga0466957_0000826 3300044842 Bacteria 15810
540 Ga0466957_0065542 3300044842 Bacteria 2237
541 Ga0466960_0113856 3300044901 Bacteria 1409
542 Ga0466959_0165467 3300045049 Bacteria 1553
543 Ga0466958_0198188 3300045836 Bacteria 1277
544 Ga0466958_0584575 3300045836 Bacteria 726
545 Ga0466967_0794093 3300045976 Bacteria 940
546 Ga0495617_000048 3300046452 Bacteria 113357
547 Ga0495627_000046 3300046453 Bacteria 176186
548 Ga0495590_0032795 3300046457 Bacteria 1816
549 Ga0495638_0016471 3300046460 Bacteria 4951
550 Ga0495638_0056354 3300046460 Bacteria 2439
551 Ga0495638_0088713 3300046460 Bacteria 1867
552 Ga0495638_0250318 3300046460 Unclassified 977
553 Ga0495653_0000018 3300046463 Bacteria 185787
554 Ga0495650_0000173 3300046471 Bacteria 142734
555 Ga0495650_0000227 3300046471 Bacteria 114662
556 Ga0495650_0000712 3300046471 Bacteria 42514
557 Ga0495650_0009894 3300046471 Bacteria 5375
558 Ga0495605_0000332 3300046474 Bacteria 47384
559 Ga0495605_0003120 3300046474 Bacteria 9985
560 Ga0495605_0012320 3300046474 Bacteria 4746
561 Ga0495584_0000159 3300046491 Bacteria 47242
562 Ga0495584_0009198 3300046491 Bacteria 5095
563 Ga0495585_0009818 3300046492 Bacteria 5726
564 Ga0495585_0411527 3300046492 Bacteria 650
565 Ga0495594_0200207 3300046499 Bacteria 1138
566 Ga0495607_0005780 3300046501 Bacteria 8798
567 Ga0495607_0018386 3300046501 Bacteria 4456
568 Ga0495607_0031601 3300046501 Bacteria 3239
569 Ga0495606_0001344 3300046507 Bacteria 33466
570 Ga0495606_0002941 3300046507 Bacteria 18816
571 Ga0495606_0023593 3300046507 Bacteria 4450
572 Ga0495606_0107104 3300046507 Bacteria 1691
573 Ga0495610_0000021 3300046512 Bacteria 336300
574 Ga0495610_0004255 3300046512 Bacteria 10653
575 Ga0495616_0026833 3300046513 Bacteria 3060
576 Ga0495632_0000093 3300046519 Bacteria 91309
577 Ga0495632_0032543 3300046519 Bacteria 2685
578 Ga0495637_0002248 3300046520 Bacteria 10724
579 Ga0495637_0005241 3300046520 Bacteria 6634
580 Ga0495643_0011460 3300046522 Bacteria 5400
581 Ga0495643_0107505 3300046522 Bacteria 1422
582 Ga0495643_0162639 3300046522 Bacteria 1097
583 Ga0495644_0090935 3300046523 Bacteria 1152
584 Ga0495648_0003527 3300046524 Bacteria 13706
585 Ga0495648_0037037 3300046524 Bacteria 3139
586 Ga0495648_0038741 3300046524 Bacteria 3043
587 Ga0495648_0045237 3300046524 Bacteria 2740
588 Ga0495648_0069765 3300046524 Bacteria 2044
589 Ga0495642_0000111 3300046528 Bacteria 46419
590 Ga0495642_0016911 3300046528 Bacteria 2846
591 Ga0495642_0073599 3300046528 Bacteria 1432
592 Ga0495654_0000005 3300046530 Bacteria 491381
593 Ga0495654_0007915 3300046530 Bacteria 5910
594 Ga0495654_0037784 3300046530 Bacteria 2418
595 Ga0495609_0000039 3300046538 Bacteria 179384
596 Ga0495609_0001266 3300046538 Bacteria 17276
597 Ga0495597_0004948 3300046542 Bacteria 7162
598 Ga0495633_0000409 3300046558 Bacteria 44723
599 Ga0495633_0008816 3300046558 Bacteria 5634
600 Ga0495633_0011544 3300046558 Bacteria 4755
601 Ga0495633_0126775 3300046558 Bacteria 1181
602 Ga0495633_0185295 3300046558 Bacteria 958
603 Ga0495656_0073064 3300046615 Bacteria 1528
604 Ga0495656_0093464 3300046615 Bacteria 1379
605 Ga0495668_0002762 3300046616 Bacteria 14038
606 Ga0495668_0002817 3300046616 Bacteria 13834
607 Ga0495625_0006244 3300046660 Bacteria 10672
608 Ga0495625_0022645 3300046660 Bacteria 4814
609 Ga0495625_0028546 3300046660 Bacteria 4184
610 Ga0495625_0075789 3300046660 Bacteria 2353
611 Ga0495661_0000295 3300046665 Bacteria 56555
612 Ga0495661_0013898 3300046665 Bacteria 5400
613 Ga0495661_0021505 3300046665 Bacteria 4205
614 Ga0495661_0046029 3300046665 Bacteria 2665
615 Ga0495588_0139361 3300046674 Bacteria 1281
616 Ga0495670_0019070 3300046691 Bacteria 3380
617 Ga0495670_0048754 3300046691 Bacteria 2118
618 Ga0495670_0104150 3300046691 Bacteria 1464
619 Ga0495671_0046835 3300046692 Bacteria 2161
620 Ga0495671_0065748 3300046692 Bacteria 1785
621 Ga0495671_0274660 3300046692 Bacteria 812
622 Ga0495649_0003804 3300046694 Bacteria 9986
623 Ga0495649_0012162 3300046694 Bacteria 5021
624 Ga0495649_0022145 3300046694 Bacteria 3555
625 Ga0495589_0000097 3300046794 Bacteria 84037
626 Ga0495589_0000226 3300046794 Bacteria 47688
627 Ga0495660_0000230 3300046810 Bacteria 55115
628 Ga0495660_0005422 3300046810 Bacteria 7636
629 Ga0495660_0005578 3300046810 Bacteria 7531
630 Ga0495660_0012252 3300046810 Bacteria 4974
631 Ga0495660_0131459 3300046810 Bacteria 1255
632 Ga0495672_0000410 3300047320 Bacteria 51954
633 Ga0495672_0005276 3300047320 Bacteria 10284
634 Ga0495672_0141684 3300047320 Bacteria 1255
635 Ga0495683_0013352 3300047323 Bacteria 4297
636 Ga0495683_0039838 3300047323 Bacteria 2374
637 Ga0495687_000059 3300047443 Bacteria 179357
638 Ga0495687_000949 3300047443 Bacteria 29869
639 Ga0495687_001538 3300047443 Bacteria 20986
640 Ga0495677_0000006 3300047445 Bacteria 199230
641 Ga0495677_0000078 3300047445 Bacteria 49500
642 Ga0495677_0003740 3300047445 Bacteria 5887
643 Ga0495677_0066472 3300047445 Bacteria 1341
644 Ga0495679_039944 3300047446 Bacteria 1461
645 Ga0495673_0000033 3300047469 Bacteria 354152
646 Ga0495673_0000034 3300047469 Bacteria 326920
647 Ga0495673_0000150 3300047469 Bacteria 122768
648 Ga0495686_0303388 3300047472 Bacteria 880
649 Ga0495626_0000121 3300048091 Bacteria 102193
650 Ga0495626_0004773 3300048091 Bacteria 8185
651 Ga0495626_0044065 3300048091 Bacteria 2090
652 Ga0496107_0628803 3300048910 Bacteria 792
653 Ga0496109_0701276 3300048912 Bacteria 950
654 Ga0496110_0385472 3300048913 Bacteria 1277
655 Ga0496111_0151698 3300048914 Bacteria 1719
656 Ga0496118_0243720 3300048921 Bacteria 1027
657 Ga0496121_0027907 3300048924 Bacteria 5272
658 Ga0496121_0613464 3300048924 Bacteria 669
659 Ga0496122_0007022 3300048925 Bacteria 12660
660 Ga0496122_0142923 3300048925 Bacteria 1493
661 Ga0496123_0003043 3300048926 Bacteria 19312
662 Ga0496123_0008423 3300048926 Bacteria 9474
663 Ga0496124_0034257 3300048927 Bacteria 4459
664 Ga0496124_0057939 3300048927 Bacteria 3261
665 Ga0496124_0170800 3300048927 Bacteria 1684
666 Ga0496125_0000006 3300048928 Bacteria 759385
667 Ga0496125_0081021 3300048928 Bacteria 2482
668 Ga0496126_0060699 3300048929 Bacteria 3399
669 Ga0496126_0082691 3300048929 Bacteria 2836
670 Ga0501306_035214 3300049127 Bacteria 759
671 Ga0495678_000076 3300049459 Bacteria 125077
672 Ga0495678_000780 3300049459 Bacteria 28573
673 Ga0495678_026104 3300049459 Bacteria 2499
674 Ga0501298_009226 3300049521 Unclassified 1674
675 Ga0501034_0001219 3300049571 Bacteria 35187
676 Ga0501034_0271376 3300049571 Unclassified 1637
677 Ga0501073_0340950 3300049589 Bacteria 1034
678 Ga0501076_0517444 3300049592 Bacteria 984
679 Ga0501198_029454 3300049649 Bacteria 910
680 Ga0501202_000293 3300049652 Bacteria 6851
681 Ga0501209_162664 3300049656 Bacteria 676
682 Ga0501217_021425 3300049661 Bacteria 1526
683 Ga0501228_011713 3300049666 Bacteria 892
684 Ga0501235_045234 3300049669 Bacteria 1012
685 Ga0501249_006054 3300049679 Bacteria 2483
686 Ga0501261_001605 3300049690 Bacteria 2772
687 Ga0501221_000588 3300049704 Bacteria 5798
688 Ga0501225_0000272 3300049705 Bacteria 16350
689 Ga0501245_039540 3300049708 Bacteria 807
690 Ga0501081_0892067 3300049743 Unclassified 670
691 Ga0501241_001599 3300049758 Bacteria 4551
692 Ga0501241_026330 3300049758 Bacteria 1084
693 Ga0501269_000253 3300049766 Bacteria 15243
694 Ga0501045_0862984 3300049824 Bacteria 666
695 nmdc:mga03683_480919_c1 3300050489 Bacteria 600
696 nmdc:mga03683_73693_c1 3300050489 Bacteria 1464
697 nmdc:mga03n38_15942_c1 3300050490 Bacteria 2913
698 nmdc:mga0k408_60597_c1 3300050493 Bacteria 2199
699 nmdc:mga05p37_188220_c1 3300050507 Bacteria 2508
700 nmdc:mga09592_282029_c1 3300050508 Bacteria 1441
701 nmdc:mga08y16_357918_c1 3300050511 Bacteria 1498
702 nmdc:mga08y16_434262_c1 3300050511 Bacteria 1341
703 Ga0500583_0000504 3300053092 Bacteria 12002
704 Ga0500594_0015910 3300053118 Bacteria 1821
705 Ga0500594_0050566 3300053118 Bacteria 1169
706 Ga0500642_0116964 3300053130 Bacteria 1246
707 Ga0500655_058411 3300053133 Unclassified 775
708 Ga0500559_0052121 3300053136 Bacteria 1808
709 Ga0500586_005434 3300053145 Bacteria 3222
710 Ga0500586_048917 3300053145 Bacteria 1454
711 Ga0500589_008980 3300053147 Bacteria 4207
712 Ga0500622_0000103 3300053156 Bacteria 86203
713 Ga0500622_0036821 3300053156 Bacteria 2557
714 Ga0500636_0085449 3300053177 Bacteria 1813
715 Ga0500611_000044 3300053727 Bacteria 57726
716 Ga0500645_072949 3300053730 Bacteria 984
717 Ga0500587_026770 3300053739 Bacteria 775
718 Ga0500661_010674 3300055283 Bacteria 1671
719 Ga0587068_011007 3300059641 Bacteria 1358
720 Ga0587072_073391 3300059643 Bacteria 727

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857553236 2857555057 173
2 iso_pu_bacteria 2919476304 2919481262 173
3 iso_pu_bacteria 2929239360 2929245203 174
4 iso_pu_bacteria 2929921140 2929927432 174
5 iso_pu_bacteria 8003151029 8003151287 174
6 3300006946 Ga0079104_1012978 Ga0079104_10129782 176
7 3300015261 Ga0182006_1000070 Ga0182006_100007076 176
8 3300015265 Ga0182005_1000003 Ga0182005_100000377 176
9 3300027111 Ga0209281_1024949 Ga0209281_10249491 176
10 3300059643 Ga0587072_073391 Ga0587072_073391_49_579 176
11 3300002077 JGI24744J21845_10037876 JGI24744J21845_100378761 177
12 3300003763 Ga0055529_1000565 Ga0055529_100056523 177
13 3300005331 Ga0070670_100357323 Ga0070670_1003573232 177
14 3300005344 Ga0070661_101069854 Ga0070661_1010698541 177
15 3300005347 Ga0070668_100078333 Ga0070668_1000783332 177
16 3300005353 Ga0070669_100032016 Ga0070669_1000320163 177
17 3300005356 Ga0070674_100019422 Ga0070674_1000194222 177
18 3300005366 Ga0070659_100272733 Ga0070659_1002727332 177
19 3300005441 Ga0070700_100120751 Ga0070700_1001207512 177
20 3300005441 Ga0070700_100411096 Ga0070700_1004110962 177
21 3300005457 Ga0070662_100297286 Ga0070662_1002972861 177
22 3300005466 Ga0070685_10083339 Ga0070685_100833392 177
23 3300005543 Ga0070672_100055912 Ga0070672_1000559122 177
24 3300005719 Ga0068861_100167451 Ga0068861_1001674512 177
25 3300005844 Ga0068862_100266114 Ga0068862_1002661142 177
26 3300006881 Ga0068865_100036633 Ga0068865_1000366332 177
27 3300009093 Ga0105240_10118786 Ga0105240_101187863 177
28 3300009148 Ga0105243_10272217 Ga0105243_102722172 177
29 3300009553 Ga0105249_10040482 Ga0105249_100404824 177
30 3300013306 Ga0163162_10030422 Ga0163162_100304224 177
31 3300013306 Ga0163162_10146804 Ga0163162_101468042 177
32 3300014326 Ga0157380_10081663 Ga0157380_100816632 177
33 3300025272 Ga0209455_1000063 Ga0209455_1000063244 177
34 3300025913 Ga0207695_10104269 Ga0207695_101042693 177
35 3300025920 Ga0207649_10925622 Ga0207649_109256221 177
36 3300025925 Ga0207650_10078473 Ga0207650_100784734 177
37 3300025933 Ga0207706_10045314 Ga0207706_100453142 177
38 3300025935 Ga0207709_10268343 Ga0207709_102683432 177
39 3300025937 Ga0207669_10100034 Ga0207669_101000342 177
40 3300025938 Ga0207704_10048658 Ga0207704_100486582 177
41 3300025940 Ga0207691_10050802 Ga0207691_100508022 177
42 3300025961 Ga0207712_10079316 Ga0207712_100793162 177
43 3300026023 Ga0207677_10835696 Ga0207677_108356962 177
44 3300026075 Ga0207708_10233392 Ga0207708_102333922 177
45 3300026089 Ga0207648_10100924 Ga0207648_101009242 177
46 3300026118 Ga0207675_100045900 Ga0207675_1000459004 177
47 3300026142 Ga0207698_10049348 Ga0207698_100493483 177
48 3300028380 Ga0268265_10244138 Ga0268265_102441382 177
49 3300030745 Ga0316182_1444012 Ga0316182_14440121 177
50 3300046453 Ga0495627_000046 Ga0495627_000046_95462_95995 177
51 3300046522 Ga0495643_0162639 Ga0495643_0162639_69_602 177
52 3300046538 Ga0495609_0001266 Ga0495609_0001266_6882_7415 177
53 3300046810 Ga0495660_0005422 Ga0495660_0005422_281_814 177
54 3300046810 Ga0495660_0012252 Ga0495660_0012252_928_1461 177
55 3300047446 Ga0495679_039944 Ga0495679_039944_166_699 177
56 3300048927 Ga0496124_0170800 Ga0496124_0170800_184_717 177
57 3300049459 Ga0495678_000076 Ga0495678_000076_31124_31657 177
58 3300053177 Ga0500636_0085449 Ga0500636_0085449_221_754 177
59 3300001979 JGI24740J21852_10002490 JGI24740J21852_100024905 178
60 3300001990 JGI24737J22298_10012954 JGI24737J22298_100129543 178
61 3300002737 JGI25162J39368_1002026 JGI25162J39368_10020269 178
62 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004178 178
63 3300002741 JGI25157J39369_1004662 JGI25157J39369_10046622 178
64 3300002741 JGI25157J39369_1010603 JGI25157J39369_10106032 178
65 3300003214 JGI25165J46597_1002705 JGI25165J46597_10027052 178
66 3300003215 JGI25153J46596_10006708 JGI25153J46596_100067083 178
67 3300003316 rootH1_10027867 rootH1_100278673 178
68 3300003320 rootH2_10058135 rootH2_100581354 178
69 3300003322 rootL2_10018465 rootL2_100184654 178
70 3300003322 rootL2_10254815 rootL2_102548152 178
71 3300003322 rootL2_10297884 rootL2_102978842 178
72 3300003322 rootL2_10315931 rootL2_103159312 178
73 3300003323 rootH1_10010194 rootH1_100101943 178
74 3300003323 rootH1_10165335 rootH1_101653354 178
75 3300003323 rootH1_10329849 rootH1_103298492 178
76 3300003354 JGI25160J50197_1000502 JGI25160J50197_100050218 178
77 3300003354 JGI25160J50197_1031094 JGI25160J50197_10310942 178
78 3300003574 Ga0007410J51695_1017575 Ga0007410J51695_10175751 178
79 3300003575 Ga0007409J51694_1047815 Ga0007409J51694_10478151 178
80 3300003759 Ga0055525_1000001 Ga0055525_1000001692 178
81 3300003771 Ga0055526_1002819 Ga0055526_10028198 178
82 3300003790 Ga0055528_1000198 Ga0055528_100019828 178
83 3300003791 Ga0055530_10001095 Ga0055530_100010953 178
84 3300003794 Ga0055531_10000066 Ga0055531_1000006661 178
85 3300005262 Ga0065165_1000182 Ga0065165_100018218 178
86 3300005262 Ga0065165_1015676 Ga0065165_10156763 178
87 3300005290 Ga0065712_10225353 Ga0065712_102253531 178
88 3300005327 Ga0070658_10006081 Ga0070658_100060814 178
89 3300005327 Ga0070658_10081937 Ga0070658_100819373 178
90 3300005327 Ga0070658_10131064 Ga0070658_101310642 178
91 3300005327 Ga0070658_10154095 Ga0070658_101540952 178
92 3300005327 Ga0070658_10563734 Ga0070658_105637342 178
93 3300005328 Ga0070676_10047522 Ga0070676_100475222 178
94 3300005328 Ga0070676_10122021 Ga0070676_101220212 178
95 3300005328 Ga0070676_10828537 Ga0070676_108285371 178
96 3300005329 Ga0070683_100248547 Ga0070683_1002485472 178
97 3300005329 Ga0070683_101470947 Ga0070683_1014709471 178
98 3300005330 Ga0070690_100006305 Ga0070690_1000063051 178
99 3300005330 Ga0070690_100075349 Ga0070690_1000753492 178
100 3300005331 Ga0070670_100022809 Ga0070670_1000228094 178
101 3300005331 Ga0070670_100061704 Ga0070670_1000617043 178
102 3300005331 Ga0070670_100242702 Ga0070670_1002427021 178
103 3300005331 Ga0070670_100329253 Ga0070670_1003292532 178
104 3300005333 Ga0070677_10104260 Ga0070677_101042602 178
105 3300005333 Ga0070677_10182920 Ga0070677_101829202 178
106 3300005334 Ga0068869_100008593 Ga0068869_1000085932 178
107 3300005334 Ga0068869_100046334 Ga0068869_1000463342 178
108 3300005334 Ga0068869_100565438 Ga0068869_1005654381 178
109 3300005335 Ga0070666_10029713 Ga0070666_100297133 178
110 3300005335 Ga0070666_10073391 Ga0070666_100733912 178
111 3300005335 Ga0070666_10231929 Ga0070666_102319292 178
112 3300005335 Ga0070666_10300118 Ga0070666_103001181 178
113 3300005336 Ga0070680_100112488 Ga0070680_1001124883 178
114 3300005336 Ga0070680_100718947 Ga0070680_1007189472 178
115 3300005338 Ga0068868_100172208 Ga0068868_1001722082 178
116 3300005338 Ga0068868_100795985 Ga0068868_1007959851 178
117 3300005338 Ga0068868_100806646 Ga0068868_1008066461 178
118 3300005339 Ga0070660_100077013 Ga0070660_1000770132 178
119 3300005339 Ga0070660_100233792 Ga0070660_1002337922 178
120 3300005339 Ga0070660_100452314 Ga0070660_1004523142 178
121 3300005339 Ga0070660_100711953 Ga0070660_1007119531 178
122 3300005340 Ga0070689_100386895 Ga0070689_1003868951 178
123 3300005340 Ga0070689_100745588 Ga0070689_1007455881 178
124 3300005340 Ga0070689_100849889 Ga0070689_1008498891 178
125 3300005343 Ga0070687_100059898 Ga0070687_1000598982 178
126 3300005343 Ga0070687_100535028 Ga0070687_1005350282 178
127 3300005344 Ga0070661_100336434 Ga0070661_1003364342 178
128 3300005345 Ga0070692_10067099 Ga0070692_100670992 178
129 3300005347 Ga0070668_100017133 Ga0070668_1000171335 178
130 3300005353 Ga0070669_100006476 Ga0070669_1000064762 178
131 3300005353 Ga0070669_100305439 Ga0070669_1003054392 178
132 3300005354 Ga0070675_100007775 Ga0070675_1000077753 178
133 3300005354 Ga0070675_100031307 Ga0070675_1000313072 178
134 3300005354 Ga0070675_100087551 Ga0070675_1000875514 178
135 3300005354 Ga0070675_100242007 Ga0070675_1002420072 178
136 3300005354 Ga0070675_100258942 Ga0070675_1002589422 178
137 3300005354 Ga0070675_100299983 Ga0070675_1002999833 178
138 3300005354 Ga0070675_100432026 Ga0070675_1004320262 178
139 3300005354 Ga0070675_100476966 Ga0070675_1004769661 178
140 3300005355 Ga0070671_100036407 Ga0070671_1000364075 178
141 3300005356 Ga0070674_100033911 Ga0070674_1000339113 178
142 3300005356 Ga0070674_100082322 Ga0070674_1000823222 178
143 3300005356 Ga0070674_100152763 Ga0070674_1001527631 178
144 3300005364 Ga0070673_100014221 Ga0070673_1000142215 178
145 3300005364 Ga0070673_100026035 Ga0070673_1000260355 178
146 3300005364 Ga0070673_100039035 Ga0070673_1000390354 178
147 3300005364 Ga0070673_100559003 Ga0070673_1005590032 178
148 3300005364 Ga0070673_100581498 Ga0070673_1005814982 178
149 3300005365 Ga0070688_100143325 Ga0070688_1001433252 178
150 3300005366 Ga0070659_100014736 Ga0070659_1000147367 178
151 3300005366 Ga0070659_100037941 Ga0070659_1000379414 178
152 3300005366 Ga0070659_100605785 Ga0070659_1006057852 178
153 3300005367 Ga0070667_100006292 Ga0070667_1000062925 178
154 3300005367 Ga0070667_100014368 Ga0070667_1000143682 178
155 3300005367 Ga0070667_100414646 Ga0070667_1004146462 178
156 3300005367 Ga0070667_100415022 Ga0070667_1004150222 178
157 3300005438 Ga0070701_10016364 Ga0070701_100163642 178
158 3300005438 Ga0070701_10023188 Ga0070701_100231883 178
159 3300005441 Ga0070700_100531734 Ga0070700_1005317341 178
160 3300005444 Ga0070694_100054383 Ga0070694_1000543832 178
161 3300005455 Ga0070663_100055066 Ga0070663_1000550662 178
162 3300005456 Ga0070678_100130357 Ga0070678_1001303572 178
163 3300005456 Ga0070678_100211342 Ga0070678_1002113422 178
164 3300005456 Ga0070678_100319322 Ga0070678_1003193222 178
165 3300005457 Ga0070662_100110586 Ga0070662_1001105862 178
166 3300005457 Ga0070662_100556169 Ga0070662_1005561692 178
167 3300005457 Ga0070662_100594775 Ga0070662_1005947751 178
168 3300005459 Ga0068867_100014009 Ga0068867_1000140092 178
169 3300005459 Ga0068867_100248629 Ga0068867_1002486292 178
170 3300005466 Ga0070685_10078891 Ga0070685_100788912 178
171 3300005471 Ga0070698_100087369 Ga0070698_1000873692 178
172 3300005535 Ga0070684_100038370 Ga0070684_1000383702 178
173 3300005535 Ga0070684_100172102 Ga0070684_1001721022 178
174 3300005539 Ga0068853_100038142 Ga0068853_1000381422 178
175 3300005543 Ga0070672_100007590 Ga0070672_1000075904 178
176 3300005543 Ga0070672_100028864 Ga0070672_1000288644 178
177 3300005543 Ga0070672_100039105 Ga0070672_1000391054 178
178 3300005543 Ga0070672_100046777 Ga0070672_1000467773 178
179 3300005543 Ga0070672_100152131 Ga0070672_1001521312 178
180 3300005543 Ga0070672_100259014 Ga0070672_1002590141 178
181 3300005544 Ga0070686_100174196 Ga0070686_1001741962 178
182 3300005548 Ga0070665_100000072 Ga0070665_10000007265 178
183 3300005548 Ga0070665_100164153 Ga0070665_1001641531 178
184 3300005549 Ga0070704_100024434 Ga0070704_1000244342 178
185 3300005549 Ga0070704_100668436 Ga0070704_1006684361 178
186 3300005563 Ga0068855_100062790 Ga0068855_1000627903 178
187 3300005563 Ga0068855_100131060 Ga0068855_1001310604 178
188 3300005563 Ga0068855_100149305 Ga0068855_1001493052 178
189 3300005563 Ga0068855_100239358 Ga0068855_1002393583 178
190 3300005563 Ga0068855_100750905 Ga0068855_1007509051 178
191 3300005563 Ga0068855_100758252 Ga0068855_1007582522 178
192 3300005564 Ga0070664_100083618 Ga0070664_1000836182 178
193 3300005564 Ga0070664_100141269 Ga0070664_1001412692 178
194 3300005564 Ga0070664_100184969 Ga0070664_1001849692 178
195 3300005564 Ga0070664_100644387 Ga0070664_1006443872 178
196 3300005564 Ga0070664_101170256 Ga0070664_1011702561 178
197 3300005577 Ga0068857_100015636 Ga0068857_1000156365 178
198 3300005577 Ga0068857_100431080 Ga0068857_1004310803 178
199 3300005578 Ga0068854_100400983 Ga0068854_1004009833 178
200 3300005614 Ga0068856_100198886 Ga0068856_1001988862 178
201 3300005614 Ga0068856_100235083 Ga0068856_1002350832 178
202 3300005615 Ga0070702_100019351 Ga0070702_1000193512 178
203 3300005616 Ga0068852_100082915 Ga0068852_1000829154 178
204 3300005616 Ga0068852_100118376 Ga0068852_1001183763 178
205 3300005616 Ga0068852_100268799 Ga0068852_1002687992 178
206 3300005616 Ga0068852_101068404 Ga0068852_1010684042 178
207 3300005616 Ga0068852_101374920 Ga0068852_1013749201 178
208 3300005617 Ga0068859_100142010 Ga0068859_1001420103 178
209 3300005617 Ga0068859_100878809 Ga0068859_1008788092 178
210 3300005618 Ga0068864_100023586 Ga0068864_1000235862 178
211 3300005718 Ga0068866_10015069 Ga0068866_100150694 178
212 3300005719 Ga0068861_100004049 Ga0068861_1000040495 178
213 3300005719 Ga0068861_100174837 Ga0068861_1001748372 178
214 3300005719 Ga0068861_101439500 Ga0068861_1014395001 178
215 3300005840 Ga0068870_10118377 Ga0068870_101183772 178
216 3300005840 Ga0068870_10380223 Ga0068870_103802231 178
217 3300005841 Ga0068863_100016559 Ga0068863_1000165593 178
218 3300005841 Ga0068863_100881237 Ga0068863_1008812372 178
219 3300005842 Ga0068858_100004355 Ga0068858_1000043556 178
220 3300005842 Ga0068858_100208856 Ga0068858_1002088561 178
221 3300005843 Ga0068860_100006985 Ga0068860_1000069858 178
222 3300005844 Ga0068862_100021261 Ga0068862_1000212612 178
223 3300005844 Ga0068862_100023221 Ga0068862_1000232212 178
224 3300005985 Ga0081539_10014767 Ga0081539_100147676 178
225 3300006028 Ga0070717_10540073 Ga0070717_105400732 178
226 3300006028 Ga0070717_11178015 Ga0070717_111780152 178
227 3300006048 Ga0075363_100114095 Ga0075363_1001140951 178
228 3300006177 Ga0075362_10103097 Ga0075362_101030972 178
229 3300006177 Ga0075362_10271580 Ga0075362_102715801 178
230 3300006195 Ga0075366_10020915 Ga0075366_100209152 178
231 3300006237 Ga0097621_100294117 Ga0097621_1002941172 178
232 3300006237 Ga0097621_100502382 Ga0097621_1005023821 178
233 3300006237 Ga0097621_100649095 Ga0097621_1006490951 178
234 3300006237 Ga0097621_101172875 Ga0097621_1011728751 178
235 3300006358 Ga0068871_100309030 Ga0068871_1003090302 178
236 3300006358 Ga0068871_100896637 Ga0068871_1008966371 178
237 3300006871 Ga0075434_100556879 Ga0075434_1005568791 178
238 3300006880 Ga0075429_100001972 Ga0075429_1000019722 178
239 3300006881 Ga0068865_100055260 Ga0068865_1000552602 178
240 3300006881 Ga0068865_100184920 Ga0068865_1001849202 178
241 3300006881 Ga0068865_101045816 Ga0068865_1010458161 178
242 3300006931 Ga0097620_100142013 Ga0097620_1001420132 178
243 3300006931 Ga0097620_100878768 Ga0097620_1008787682 178
244 3300009036 Ga0105244_10012232 Ga0105244_100122325 178
245 3300009036 Ga0105244_10211440 Ga0105244_102114401 178
246 3300009093 Ga0105240_10000706 Ga0105240_1000070633 178
247 3300009093 Ga0105240_10012165 Ga0105240_100121653 178
248 3300009093 Ga0105240_10909320 Ga0105240_109093201 178
249 3300009094 Ga0111539_10067626 Ga0111539_100676262 178
250 3300009094 Ga0111539_10477062 Ga0111539_104770622 178
251 3300009094 Ga0111539_10917825 Ga0111539_109178252 178
252 3300009094 Ga0111539_11136833 Ga0111539_111368332 178
253 3300009094 Ga0111539_11856748 Ga0111539_118567481 178
254 3300009098 Ga0105245_10207429 Ga0105245_102074292 178
255 3300009098 Ga0105245_10308744 Ga0105245_103087442 178
256 3300009098 Ga0105245_10690970 Ga0105245_106909702 178
257 3300009098 Ga0105245_11645249 Ga0105245_116452491 178
258 3300009147 Ga0114129_10008756 Ga0114129_100087568 178
259 3300009148 Ga0105243_10058898 Ga0105243_100588982 178
260 3300009148 Ga0105243_10323310 Ga0105243_103233102 178
261 3300009174 Ga0105241_10075560 Ga0105241_100755603 178
262 3300009174 Ga0105241_10342179 Ga0105241_103421791 178
263 3300009174 Ga0105241_11102432 Ga0105241_111024321 178
264 3300009176 Ga0105242_10113197 Ga0105242_101131973 178
265 3300009176 Ga0105242_10181182 Ga0105242_101811822 178
266 3300009176 Ga0105242_10305918 Ga0105242_103059182 178
267 3300009176 Ga0105242_11010046 Ga0105242_110100461 178
268 3300009177 Ga0105248_10364264 Ga0105248_103642642 178
269 3300009177 Ga0105248_10539677 Ga0105248_105396772 178
270 3300009545 Ga0105237_10004544 Ga0105237_1000454410 178
271 3300009545 Ga0105237_10013372 Ga0105237_100133724 178
272 3300009545 Ga0105237_10226593 Ga0105237_102265931 178
273 3300009553 Ga0105249_10026578 Ga0105249_100265782 178
274 3300009553 Ga0105249_10854052 Ga0105249_108540522 178
275 3300010375 Ga0105239_10000039 Ga0105239_10000039140 178
276 3300010375 Ga0105239_10283915 Ga0105239_102839152 178
277 3300010375 Ga0105239_10458484 Ga0105239_104584842 178
278 3300013100 Ga0157373_10002214 Ga0157373_1000221414 178
279 3300013102 Ga0157371_10000263 Ga0157371_100002638 178
280 3300013102 Ga0157371_10086714 Ga0157371_100867142 178
281 3300013102 Ga0157371_10186255 Ga0157371_101862553 178
282 3300013102 Ga0157371_10433575 Ga0157371_104335752 178
283 3300013104 Ga0157370_10087207 Ga0157370_100872073 178
284 3300013104 Ga0157370_10254646 Ga0157370_102546462 178
285 3300013105 Ga0157369_11870551 Ga0157369_118705511 178
286 3300013296 Ga0157374_10008921 Ga0157374_100089218 178
287 3300013296 Ga0157374_10038943 Ga0157374_100389433 178
288 3300013296 Ga0157374_10228118 Ga0157374_102281181 178
289 3300013296 Ga0157374_10510314 Ga0157374_105103142 178
290 3300013297 Ga0157378_10003189 Ga0157378_100031893 178
291 3300013297 Ga0157378_10315185 Ga0157378_103151851 178
292 3300013297 Ga0157378_10405309 Ga0157378_104053092 178
293 3300013297 Ga0157378_10467842 Ga0157378_104678421 178
294 3300013306 Ga0163162_10000010 Ga0163162_1000001063 178
295 3300013306 Ga0163162_10015161 Ga0163162_100151616 178
296 3300013306 Ga0163162_10182220 Ga0163162_101822201 178
297 3300013306 Ga0163162_10286793 Ga0163162_102867932 178
298 3300013306 Ga0163162_11365194 Ga0163162_113651941 178
299 3300013307 Ga0157372_10000266 Ga0157372_1000026641 178
300 3300013307 Ga0157372_10017724 Ga0157372_1001772410 178
301 3300013307 Ga0157372_10390463 Ga0157372_103904632 178
302 3300013307 Ga0157372_11189962 Ga0157372_111899621 178
303 3300013307 Ga0157372_11503583 Ga0157372_115035831 178
304 3300013308 Ga0157375_10005490 Ga0157375_100054905 178
305 3300013308 Ga0157375_10006022 Ga0157375_100060223 178
306 3300013308 Ga0157375_10227431 Ga0157375_102274312 178
307 3300013308 Ga0157375_10575227 Ga0157375_105752271 178
308 3300014325 Ga0163163_10119700 Ga0163163_101197002 178
309 3300014325 Ga0163163_10206266 Ga0163163_102062662 178
310 3300014326 Ga0157380_10001590 Ga0157380_100015906 178
311 3300014326 Ga0157380_10015585 Ga0157380_100155852 178
312 3300014326 Ga0157380_10085913 Ga0157380_100859132 178
313 3300014326 Ga0157380_10105588 Ga0157380_101055882 178
314 3300014745 Ga0157377_10035022 Ga0157377_100350222 178
315 3300014745 Ga0157377_10129451 Ga0157377_101294512 178
316 3300014968 Ga0157379_10010838 Ga0157379_100108386 178
317 3300014968 Ga0157379_10498934 Ga0157379_104989343 178
318 3300014969 Ga0157376_10369969 Ga0157376_103699692 178
319 3300014969 Ga0157376_10804823 Ga0157376_108048231 178
320 3300014969 Ga0157376_11442255 Ga0157376_114422551 178
321 3300014969 Ga0157376_11494715 Ga0157376_114947151 178
322 3300017792 Ga0163161_10032549 Ga0163161_100325494 178
323 3300017792 Ga0163161_10565044 Ga0163161_105650442 178
324 3300020069 Ga0197907_10049391 Ga0197907_100493911 178
325 3300020610 Ga0154015_1290094 Ga0154015_12900942 178
326 3300025230 Ga0209563_100007 Ga0209563_100007407 178
327 3300025230 Ga0209563_116249 Ga0209563_1162492 178
328 3300025231 Ga0207427_100172 Ga0207427_10017265 178
329 3300025233 Ga0209437_100034 Ga0209437_100034170 178
330 3300025246 Ga0209646_1000025 Ga0209646_1000025159 178
331 3300025250 Ga0209026_1000097 Ga0209026_10000977 178
332 3300025250 Ga0209026_1001446 Ga0209026_10014463 178
333 3300025253 Ga0209677_110274 Ga0209677_1102742 178
334 3300025258 Ga0209129_1018604 Ga0209129_10186041 178
335 3300025261 Ga0209233_1000038 Ga0209233_1000038170 178
336 3300025261 Ga0209233_1022403 Ga0209233_10224032 178
337 3300025273 Ga0209673_1000226 Ga0209673_100022614 178
338 3300025295 Ga0209564_1000006 Ga0209564_1000006932 178
339 3300025295 Ga0209564_1002364 Ga0209564_10023647 178
340 3300025298 Ga0209050_1000125 Ga0209050_1000125181 178
341 3300025302 Ga0207426_1000261 Ga0207426_100026139 178
342 3300025302 Ga0207426_1000898 Ga0207426_100089818 178
343 3300025304 Ga0209257_1000004 Ga0209257_10000041405 178
344 3300025304 Ga0209257_1003617 Ga0209257_100361714 178
345 3300025315 Ga0207697_10020450 Ga0207697_100204502 178
346 3300025321 Ga0207656_10102190 Ga0207656_101021902 178
347 3300025728 Ga0207655_1003374 Ga0207655_10033743 178
348 3300025728 Ga0207655_1019553 Ga0207655_10195534 178
349 3300025885 Ga0207653_10063423 Ga0207653_100634232 178
350 3300025893 Ga0207682_10017920 Ga0207682_100179202 178
351 3300025893 Ga0207682_10024021 Ga0207682_100240213 178
352 3300025899 Ga0207642_10040786 Ga0207642_100407862 178
353 3300025901 Ga0207688_10131067 Ga0207688_101310672 178
354 3300025903 Ga0207680_10017322 Ga0207680_100173222 178
355 3300025903 Ga0207680_10073731 Ga0207680_100737312 178
356 3300025903 Ga0207680_10136585 Ga0207680_101365853 178
357 3300025904 Ga0207647_10000662 Ga0207647_1000066224 178
358 3300025904 Ga0207647_10172898 Ga0207647_101728982 178
359 3300025904 Ga0207647_10220447 Ga0207647_102204472 178
360 3300025907 Ga0207645_10011322 Ga0207645_100113222 178
361 3300025907 Ga0207645_10028782 Ga0207645_100287824 178
362 3300025908 Ga0207643_10166547 Ga0207643_101665472 178
363 3300025909 Ga0207705_10064176 Ga0207705_100641763 178
364 3300025909 Ga0207705_10207776 Ga0207705_102077761 178
365 3300025911 Ga0207654_10016340 Ga0207654_100163402 178
366 3300025913 Ga0207695_10004844 Ga0207695_1000484416 178
367 3300025913 Ga0207695_10012457 Ga0207695_100124576 178
368 3300025913 Ga0207695_10186648 Ga0207695_101866482 178
369 3300025913 Ga0207695_10582723 Ga0207695_105827232 178
370 3300025913 Ga0207695_11054493 Ga0207695_110544931 178
371 3300025914 Ga0207671_10009023 Ga0207671_100090233 178
372 3300025914 Ga0207671_10011406 Ga0207671_100114068 178
373 3300025914 Ga0207671_10027835 Ga0207671_100278351 178
374 3300025914 Ga0207671_10069713 Ga0207671_100697131 178
375 3300025914 Ga0207671_10147834 Ga0207671_101478342 178
376 3300025917 Ga0207660_10257178 Ga0207660_102571782 178
377 3300025917 Ga0207660_10435269 Ga0207660_104352691 178
378 3300025918 Ga0207662_10023917 Ga0207662_100239174 178
379 3300025919 Ga0207657_10004452 Ga0207657_1000445212 178
380 3300025919 Ga0207657_10709583 Ga0207657_107095832 178
381 3300025920 Ga0207649_10248512 Ga0207649_102485122 178
382 3300025920 Ga0207649_10336893 Ga0207649_103368932 178
383 3300025921 Ga0207652_10152518 Ga0207652_101525182 178
384 3300025923 Ga0207681_10000326 Ga0207681_1000032614 178
385 3300025923 Ga0207681_10200460 Ga0207681_102004602 178
386 3300025923 Ga0207681_10379391 Ga0207681_103793911 178
387 3300025923 Ga0207681_10859066 Ga0207681_108590662 178
388 3300025924 Ga0207694_10121056 Ga0207694_101210564 178
389 3300025924 Ga0207694_10430384 Ga0207694_104303841 178
390 3300025925 Ga0207650_10004536 Ga0207650_100045364 178
391 3300025925 Ga0207650_10297828 Ga0207650_102978282 178
392 3300025926 Ga0207659_10006659 Ga0207659_100066597 178
393 3300025926 Ga0207659_10011221 Ga0207659_100112215 178
394 3300025926 Ga0207659_10099788 Ga0207659_100997882 178
395 3300025926 Ga0207659_10286865 Ga0207659_102868652 178
396 3300025926 Ga0207659_10865003 Ga0207659_108650031 178
397 3300025927 Ga0207687_10438689 Ga0207687_104386891 178
398 3300025931 Ga0207644_10103722 Ga0207644_101037221 178
399 3300025932 Ga0207690_10008888 Ga0207690_100088887 178
400 3300025932 Ga0207690_10045089 Ga0207690_100450893 178
401 3300025932 Ga0207690_10064005 Ga0207690_100640053 178
402 3300025933 Ga0207706_10022343 Ga0207706_100223432 178
403 3300025933 Ga0207706_10280298 Ga0207706_102802982 178
404 3300025933 Ga0207706_10398265 Ga0207706_103982652 178
405 3300025934 Ga0207686_10138733 Ga0207686_101387331 178
406 3300025935 Ga0207709_10048851 Ga0207709_100488511 178
407 3300025936 Ga0207670_10582123 Ga0207670_105821231 178
408 3300025937 Ga0207669_10030025 Ga0207669_100300253 178
409 3300025937 Ga0207669_10110015 Ga0207669_101100151 178
410 3300025937 Ga0207669_10794194 Ga0207669_107941942 178
411 3300025937 Ga0207669_11381908 Ga0207669_113819081 178
412 3300025938 Ga0207704_10005361 Ga0207704_100053615 178
413 3300025938 Ga0207704_10260191 Ga0207704_102601912 178
414 3300025938 Ga0207704_10848821 Ga0207704_108488212 178
415 3300025940 Ga0207691_10014600 Ga0207691_100146003 178
416 3300025940 Ga0207691_10023107 Ga0207691_100231074 178
417 3300025940 Ga0207691_10060131 Ga0207691_100601315 178
418 3300025940 Ga0207691_10066154 Ga0207691_100661543 178
419 3300025940 Ga0207691_10082662 Ga0207691_100826622 178
420 3300025940 Ga0207691_10211369 Ga0207691_102113692 178
421 3300025940 Ga0207691_10352983 Ga0207691_103529832 178
422 3300025941 Ga0207711_10094114 Ga0207711_100941143 178
423 3300025941 Ga0207711_10249989 Ga0207711_102499892 178
424 3300025942 Ga0207689_10004982 Ga0207689_100049827 178
425 3300025942 Ga0207689_10031602 Ga0207689_100316023 178
426 3300025942 Ga0207689_10152997 Ga0207689_101529972 178
427 3300025942 Ga0207689_10364685 Ga0207689_103646852 178
428 3300025944 Ga0207661_10079128 Ga0207661_100791282 178
429 3300025944 Ga0207661_10173369 Ga0207661_101733692 178
430 3300025945 Ga0207679_10032039 Ga0207679_100320392 178
431 3300025945 Ga0207679_10142990 Ga0207679_101429902 178
432 3300025945 Ga0207679_10802714 Ga0207679_108027142 178
433 3300025949 Ga0207667_10201043 Ga0207667_102010433 178
434 3300025949 Ga0207667_10456601 Ga0207667_104566012 178
435 3300025949 Ga0207667_10658801 Ga0207667_106588012 178
436 3300025949 Ga0207667_11565428 Ga0207667_115654281 178
437 3300025960 Ga0207651_10262702 Ga0207651_102627022 178
438 3300025960 Ga0207651_10363308 Ga0207651_103633081 178
439 3300025960 Ga0207651_10429652 Ga0207651_104296522 178
440 3300025960 Ga0207651_10842587 Ga0207651_108425871 178
441 3300025960 Ga0207651_11141895 Ga0207651_111418951 178
442 3300025961 Ga0207712_10040571 Ga0207712_100405713 178
443 3300025972 Ga0207668_10102815 Ga0207668_101028152 178
444 3300025972 Ga0207668_10263355 Ga0207668_102633552 178
445 3300025981 Ga0207640_10735066 Ga0207640_107350662 178
446 3300025986 Ga0207658_10002120 Ga0207658_100021207 178
447 3300025986 Ga0207658_10101506 Ga0207658_101015063 178
448 3300025986 Ga0207658_10239187 Ga0207658_102391872 178
449 3300026023 Ga0207677_10511390 Ga0207677_105113901 178
450 3300026023 Ga0207677_10805667 Ga0207677_108056671 178
451 3300026035 Ga0207703_10001042 Ga0207703_1000104224 178
452 3300026041 Ga0207639_10008764 Ga0207639_100087643 178
453 3300026041 Ga0207639_10124312 Ga0207639_101243122 178
454 3300026067 Ga0207678_10014659 Ga0207678_100146593 178
455 3300026067 Ga0207678_10125991 Ga0207678_101259912 178
456 3300026067 Ga0207678_10725688 Ga0207678_107256881 178
457 3300026067 Ga0207678_10971170 Ga0207678_109711701 178
458 3300026075 Ga0207708_10004039 Ga0207708_100040394 178
459 3300026075 Ga0207708_10214778 Ga0207708_102147781 178
460 3300026078 Ga0207702_10155484 Ga0207702_101554842 178
461 3300026078 Ga0207702_10679113 Ga0207702_106791132 178
462 3300026088 Ga0207641_10005975 Ga0207641_1000597510 178
463 3300026089 Ga0207648_10016034 Ga0207648_100160342 178
464 3300026089 Ga0207648_10026491 Ga0207648_100264912 178
465 3300026089 Ga0207648_10030734 Ga0207648_100307346 178
466 3300026089 Ga0207648_10041365 Ga0207648_100413654 178
467 3300026089 Ga0207648_10125386 Ga0207648_101253862 178
468 3300026089 Ga0207648_10278139 Ga0207648_102781392 178
469 3300026095 Ga0207676_10140378 Ga0207676_101403782 178
470 3300026116 Ga0207674_10128615 Ga0207674_101286152 178
471 3300026116 Ga0207674_10143691 Ga0207674_101436912 178
472 3300026118 Ga0207675_100005687 Ga0207675_1000056876 178
473 3300026118 Ga0207675_100009505 Ga0207675_1000095054 178
474 3300026118 Ga0207675_100057826 Ga0207675_1000578265 178
475 3300026118 Ga0207675_100159726 Ga0207675_1001597261 178
476 3300026118 Ga0207675_100587648 Ga0207675_1005876481 178
477 3300026118 Ga0207675_100769629 Ga0207675_1007696292 178
478 3300026121 Ga0207683_10009885 Ga0207683_100098853 178
479 3300026121 Ga0207683_10052785 Ga0207683_100527852 178
480 3300026121 Ga0207683_10057715 Ga0207683_100577152 178
481 3300026121 Ga0207683_10249295 Ga0207683_102492952 178
482 3300026121 Ga0207683_10364528 Ga0207683_103645282 178
483 3300026142 Ga0207698_10174206 Ga0207698_101742061 178
484 3300027907 Ga0207428_10676880 Ga0207428_106768801 178
485 3300028379 Ga0268266_10000089 Ga0268266_1000008964 178
486 3300028379 Ga0268266_10004476 Ga0268266_100044767 178
487 3300028379 Ga0268266_10051758 Ga0268266_100517583 178
488 3300028379 Ga0268266_10267474 Ga0268266_102674742 178
489 3300028379 Ga0268266_10307819 Ga0268266_103078192 178
490 3300028379 Ga0268266_10338075 Ga0268266_103380752 178
491 3300028380 Ga0268265_10262108 Ga0268265_102621082 178
492 3300028381 Ga0268264_10001548 Ga0268264_1000154813 178
493 3300030744 Ga0316181_1215377 Ga0316181_12153772 178
494 3300030745 Ga0316182_1111809 Ga0316182_11118092 178
495 3300031730 Ga0307516_10771555 Ga0307516_107715551 178
496 3300031901 Ga0307406_10221387 Ga0307406_102213872 178
497 3300031995 Ga0307409_102351618 Ga0307409_1023516181 178
498 3300032004 Ga0307414_10025237 Ga0307414_100252373 178
499 3300032004 Ga0307414_10120923 Ga0307414_101209231 178
500 3300032004 Ga0307414_10185893 Ga0307414_101858933 178
501 3300032005 Ga0307411_11225900 Ga0307411_112259002 178
502 3300035691 Ga0373931_0281197 Ga0373931_0281197_182_718 178
503 3300037312 Ga0395899_0004327 Ga0395899_0004327_8147_8683 178
504 3300037312 Ga0395899_0227739 Ga0395899_0227739_39_575 178
505 3300037418 Ga0395900_0011119 Ga0395900_0011119_6993_7529 178
506 3300037418 Ga0395900_0118609 Ga0395900_0118609_1692_2267 178
507 3300037418 Ga0395900_0266100 Ga0395900_0266100_408_944 178
508 3300037418 Ga0395900_0708058 Ga0395900_0708058_45_587 178
509 3300037466 Ga0395898_0040629 Ga0395898_0040629_2361_2897 178
510 3300037466 Ga0395898_0315631 Ga0395898_0315631_407_943 178
511 3300037466 Ga0395898_0383443 Ga0395898_0383443_205_741 178
512 3300037466 Ga0395898_0664270 Ga0395898_0664270_395_970 178
513 3300037471 Ga0395905_0043241 Ga0395905_0043241_1859_2395 178
514 3300037471 Ga0395905_0216238 Ga0395905_0216238_608_1144 178
515 3300037471 Ga0395905_0218941 Ga0395905_0218941_143_679 178
516 3300038443 Ga0395901_0060473 Ga0395901_0060473_3103_3639 178
517 3300038443 Ga0395901_0180469 Ga0395901_0180469_406_942 178
518 3300038443 Ga0395901_0229568 Ga0395901_0229568_902_1438 178
519 3300038443 Ga0395901_0867619 Ga0395901_0867619_190_726 178
520 3300041404 Ga0439436_0001868 Ga0439436_0001868_1104_1640 178
521 3300041404 Ga0439436_0131802 Ga0439436_0131802_71_607 178
522 3300041406 Ga0439439_0025805 Ga0439439_0025805_330_866 178
523 3300041443 Ga0451789_1155240 Ga0451789_1155240_128_664 178
524 3300041459 Ga0451800_0019211 Ga0451800_0019211_54_590 178
525 3300041486 Ga0451807_1987758 Ga0451807_1987758_1220_1756 178
526 3300041507 Ga0451851_0419090 Ga0451851_0419090_158_694 178
527 3300041509 Ga0451843_0382176 Ga0451843_0382176_151_687 178
528 3300041512 Ga0451853_2116684 Ga0451853_2116684_672_1208 178
529 3300041512 Ga0451853_2843714 Ga0451853_2843714_12_551 178
530 3300041512 Ga0451853_3651035 Ga0451853_3651035_142_678 178
531 3300042005 Ga0439448_0011764 Ga0439448_0011764_2034_2570 178
532 3300042007 Ga0439449_0154825 Ga0439449_0154825_76_612 178
533 3300042014 Ga0439457_000051 Ga0439457_000051_23697_24233 178
534 3300042015 Ga0439462_0008914 Ga0439462_0008914_1587_2123 178
535 3300042115 Ga0450911_013748 Ga0450911_013748_199_735 178
536 3300042139 Ga0450904_000205 Ga0450904_000205_10090_10626 178
537 3300042157 Ga0439458_0008570 Ga0439458_0008570_1028_1576 178
538 3300044656 Ga0466969_0140533 Ga0466969_0140533_556_1092 178
539 3300044658 Ga0466972_0006553 Ga0466972_0006553_5108_5644 178
540 3300044683 Ga0466965_0026529 Ga0466965_0026529_2246_2782 178
541 3300044683 Ga0466965_0029393 Ga0466965_0029393_1572_2108 178
542 3300044683 Ga0466965_0061824 Ga0466965_0061824_811_1347 178
543 3300044683 Ga0466965_0108536 Ga0466965_0108536_91_627 178
544 3300044684 Ga0466966_0165873 Ga0466966_0165873_569_1105 178
545 3300044684 Ga0466966_0210034 Ga0466966_0210034_308_844 178
546 3300044684 Ga0466966_0351808 Ga0466966_0351808_50_628 178
547 3300044693 Ga0466961_0177653 Ga0466961_0177653_500_1075 178
548 3300044693 Ga0466961_0411151 Ga0466961_0411151_216_752 178
549 3300044693 Ga0466961_0550525 Ga0466961_0550525_148_684 178
550 3300044706 Ga0466964_0006233 Ga0466964_0006233_272_808 178
551 3300044719 Ga0466971_0159725 Ga0466971_0159725_222_758 178
552 3300044735 Ga0466968_0001045 Ga0466968_0001045_1151_1687 178
553 3300044765 Ga0466970_0403186 Ga0466970_0403186_16_552 178
554 3300044842 Ga0466957_0000826 Ga0466957_0000826_11514_12050 178
555 3300044842 Ga0466957_0065542 Ga0466957_0065542_1275_1811 178
556 3300044901 Ga0466960_0113856 Ga0466960_0113856_449_985 178
557 3300045049 Ga0466959_0165467 Ga0466959_0165467_266_802 178
558 3300045836 Ga0466958_0198188 Ga0466958_0198188_664_1200 178
559 3300045836 Ga0466958_0584575 Ga0466958_0584575_70_645 178
560 3300045976 Ga0466967_0794093 Ga0466967_0794093_224_760 178
561 3300046452 Ga0495617_000048 Ga0495617_000048_79181_79717 178
562 3300046457 Ga0495590_0032795 Ga0495590_0032795_348_884 178
563 3300046460 Ga0495638_0016471 Ga0495638_0016471_2487_3023 178
564 3300046460 Ga0495638_0056354 Ga0495638_0056354_702_1238 178
565 3300046460 Ga0495638_0088713 Ga0495638_0088713_505_1041 178
566 3300046460 Ga0495638_0250318 Ga0495638_0250318_257_793 178
567 3300046463 Ga0495653_0000018 Ga0495653_0000018_12256_12792 178
568 3300046471 Ga0495650_0000173 Ga0495650_0000173_12991_13527 178
569 3300046471 Ga0495650_0000227 Ga0495650_0000227_80265_80801 178
570 3300046471 Ga0495650_0000712 Ga0495650_0000712_33272_33808 178
571 3300046471 Ga0495650_0009894 Ga0495650_0009894_2466_3002 178
572 3300046474 Ga0495605_0000332 Ga0495605_0000332_985_1521 178
573 3300046474 Ga0495605_0003120 Ga0495605_0003120_4043_4579 178
574 3300046474 Ga0495605_0012320 Ga0495605_0012320_1209_1826 178
575 3300046491 Ga0495584_0000159 Ga0495584_0000159_28883_29458 178
576 3300046491 Ga0495584_0009198 Ga0495584_0009198_4020_4637 178
577 3300046492 Ga0495585_0009818 Ga0495585_0009818_1879_2415 178
578 3300046492 Ga0495585_0411527 Ga0495585_0411527_74_610 178
579 3300046499 Ga0495594_0200207 Ga0495594_0200207_155_691 178
580 3300046501 Ga0495607_0005780 Ga0495607_0005780_2355_2972 178
581 3300046501 Ga0495607_0018386 Ga0495607_0018386_998_1534 178
582 3300046501 Ga0495607_0031601 Ga0495607_0031601_857_1393 178
583 3300046507 Ga0495606_0001344 Ga0495606_0001344_1055_1591 178
584 3300046507 Ga0495606_0002941 Ga0495606_0002941_9281_9817 178
585 3300046507 Ga0495606_0023593 Ga0495606_0023593_2159_2695 178
586 3300046507 Ga0495606_0107104 Ga0495606_0107104_949_1524 178
587 3300046512 Ga0495610_0000021 Ga0495610_0000021_86389_86925 178
588 3300046512 Ga0495610_0004255 Ga0495610_0004255_9851_10387 178
589 3300046513 Ga0495616_0026833 Ga0495616_0026833_474_1013 178
590 3300046519 Ga0495632_0000093 Ga0495632_0000093_38376_38912 178
591 3300046519 Ga0495632_0032543 Ga0495632_0032543_1488_2024 178
592 3300046520 Ga0495637_0002248 Ga0495637_0002248_348_884 178
593 3300046520 Ga0495637_0005241 Ga0495637_0005241_2142_2678 178
594 3300046522 Ga0495643_0011460 Ga0495643_0011460_3880_4416 178
595 3300046522 Ga0495643_0107505 Ga0495643_0107505_246_782 178
596 3300046523 Ga0495644_0090935 Ga0495644_0090935_126_662 178
597 3300046524 Ga0495648_0003527 Ga0495648_0003527_8129_8665 178
598 3300046524 Ga0495648_0037037 Ga0495648_0037037_2326_2862 178
599 3300046524 Ga0495648_0038741 Ga0495648_0038741_853_1389 178
600 3300046524 Ga0495648_0045237 Ga0495648_0045237_1938_2474 178
601 3300046524 Ga0495648_0069765 Ga0495648_0069765_132_668 178
602 3300046528 Ga0495642_0000111 Ga0495642_0000111_7508_8044 178
603 3300046528 Ga0495642_0016911 Ga0495642_0016911_922_1458 178
604 3300046528 Ga0495642_0073599 Ga0495642_0073599_312_848 178
605 3300046530 Ga0495654_0000005 Ga0495654_0000005_72382_72918 178
606 3300046530 Ga0495654_0007915 Ga0495654_0007915_1401_1937 178
607 3300046530 Ga0495654_0037784 Ga0495654_0037784_749_1285 178
608 3300046538 Ga0495609_0000039 Ga0495609_0000039_8865_9482 178
609 3300046542 Ga0495597_0004948 Ga0495597_0004948_5293_5829 178
610 3300046558 Ga0495633_0000409 Ga0495633_0000409_10125_10661 178
611 3300046558 Ga0495633_0008816 Ga0495633_0008816_548_1084 178
612 3300046558 Ga0495633_0011544 Ga0495633_0011544_2459_2995 178
613 3300046558 Ga0495633_0126775 Ga0495633_0126775_348_884 178
614 3300046558 Ga0495633_0185295 Ga0495633_0185295_252_788 178
615 3300046615 Ga0495656_0073064 Ga0495656_0073064_679_1296 178
616 3300046615 Ga0495656_0093464 Ga0495656_0093464_382_918 178
617 3300046616 Ga0495668_0002762 Ga0495668_0002762_4318_4854 178
618 3300046616 Ga0495668_0002817 Ga0495668_0002817_8376_8912 178
619 3300046660 Ga0495625_0006244 Ga0495625_0006244_4044_4580 178
620 3300046660 Ga0495625_0022645 Ga0495625_0022645_2226_2762 178
621 3300046660 Ga0495625_0028546 Ga0495625_0028546_135_671 178
622 3300046660 Ga0495625_0075789 Ga0495625_0075789_1617_2153 178
623 3300046665 Ga0495661_0000295 Ga0495661_0000295_47074_47691 178
624 3300046665 Ga0495661_0013898 Ga0495661_0013898_985_1521 178
625 3300046665 Ga0495661_0021505 Ga0495661_0021505_1007_1543 178
626 3300046665 Ga0495661_0046029 Ga0495661_0046029_486_1022 178
627 3300046674 Ga0495588_0139361 Ga0495588_0139361_434_970 178
628 3300046691 Ga0495670_0019070 Ga0495670_0019070_2352_2888 178
629 3300046691 Ga0495670_0048754 Ga0495670_0048754_883_1419 178
630 3300046691 Ga0495670_0104150 Ga0495670_0104150_401_937 178
631 3300046692 Ga0495671_0046835 Ga0495671_0046835_756_1292 178
632 3300046692 Ga0495671_0065748 Ga0495671_0065748_949_1485 178
633 3300046692 Ga0495671_0274660 Ga0495671_0274660_45_581 178
634 3300046694 Ga0495649_0003804 Ga0495649_0003804_4691_5227 178
635 3300046694 Ga0495649_0012162 Ga0495649_0012162_3700_4236 178
636 3300046694 Ga0495649_0022145 Ga0495649_0022145_378_914 178
637 3300046794 Ga0495589_0000097 Ga0495589_0000097_74556_75173 178
638 3300046794 Ga0495589_0000226 Ga0495589_0000226_985_1521 178
639 3300046810 Ga0495660_0000230 Ga0495660_0000230_985_1521 178
640 3300046810 Ga0495660_0005578 Ga0495660_0005578_3598_4134 178
641 3300046810 Ga0495660_0131459 Ga0495660_0131459_312_848 178
642 3300047320 Ga0495672_0000410 Ga0495672_0000410_41200_41736 178
643 3300047320 Ga0495672_0005276 Ga0495672_0005276_9648_10184 178
644 3300047320 Ga0495672_0141684 Ga0495672_0141684_603_1139 178
645 3300047323 Ga0495683_0013352 Ga0495683_0013352_2786_3322 178
646 3300047323 Ga0495683_0039838 Ga0495683_0039838_1188_1724 178
647 3300047443 Ga0495687_000059 Ga0495687_000059_8865_9482 178
648 3300047443 Ga0495687_000949 Ga0495687_000949_980_1516 178
649 3300047443 Ga0495687_001538 Ga0495687_001538_1201_1776 178
650 3300047445 Ga0495677_0000006 Ga0495677_0000006_189749_190366 178
651 3300047445 Ga0495677_0000078 Ga0495677_0000078_21474_22010 178
652 3300047445 Ga0495677_0003740 Ga0495677_0003740_763_1299 178
653 3300047445 Ga0495677_0066472 Ga0495677_0066472_13_549 178
654 3300047469 Ga0495673_0000033 Ga0495673_0000033_75877_76413 178
655 3300047469 Ga0495673_0000034 Ga0495673_0000034_245588_246124 178
656 3300047469 Ga0495673_0000150 Ga0495673_0000150_35348_35884 178
657 3300047472 Ga0495686_0303388 Ga0495686_0303388_14_550 178
658 3300048091 Ga0495626_0000121 Ga0495626_0000121_27283_27900 178
659 3300048091 Ga0495626_0004773 Ga0495626_0004773_757_1293 178
660 3300048091 Ga0495626_0044065 Ga0495626_0044065_396_932 178
661 3300048910 Ga0496107_0628803 Ga0496107_0628803_158_694 178
662 3300048912 Ga0496109_0701276 Ga0496109_0701276_51_587 178
663 3300048913 Ga0496110_0385472 Ga0496110_0385472_537_1073 178
664 3300048914 Ga0496111_0151698 Ga0496111_0151698_205_741 178
665 3300048921 Ga0496118_0243720 Ga0496118_0243720_167_703 178
666 3300048924 Ga0496121_0027907 Ga0496121_0027907_4640_5176 178
667 3300048924 Ga0496121_0613464 Ga0496121_0613464_117_653 178
668 3300048925 Ga0496122_0007022 Ga0496122_0007022_2757_3293 178
669 3300048925 Ga0496122_0142923 Ga0496122_0142923_742_1278 178
670 3300048926 Ga0496123_0003043 Ga0496123_0003043_12661_13197 178
671 3300048926 Ga0496123_0008423 Ga0496123_0008423_6562_7098 178
672 3300048927 Ga0496124_0034257 Ga0496124_0034257_2574_3110 178
673 3300048927 Ga0496124_0057939 Ga0496124_0057939_2583_3119 178
674 3300048928 Ga0496125_0000006 Ga0496125_0000006_552342_552884 178
675 3300048928 Ga0496125_0081021 Ga0496125_0081021_1217_1753 178
676 3300048929 Ga0496126_0060699 Ga0496126_0060699_145_681 178
677 3300048929 Ga0496126_0082691 Ga0496126_0082691_773_1309 178
678 3300049127 Ga0501306_035214 Ga0501306_035214_212_748 178
679 3300049459 Ga0495678_000780 Ga0495678_000780_8804_9340 178
680 3300049459 Ga0495678_026104 Ga0495678_026104_1945_2484 178
681 3300049521 Ga0501298_009226 Ga0501298_009226_144_680 178
682 3300049571 Ga0501034_0001219 Ga0501034_0001219_23652_24188 178
683 3300049571 Ga0501034_0271376 Ga0501034_0271376_55_591 178
684 3300049589 Ga0501073_0340950 Ga0501073_0340950_290_826 178
685 3300049592 Ga0501076_0517444 Ga0501076_0517444_122_658 178
686 3300049649 Ga0501198_029454 Ga0501198_029454_346_882 178
687 3300049652 Ga0501202_000293 Ga0501202_000293_419_955 178
688 3300049656 Ga0501209_162664 Ga0501209_162664_124_660 178
689 3300049661 Ga0501217_021425 Ga0501217_021425_906_1442 178
690 3300049666 Ga0501228_011713 Ga0501228_011713_73_609 178
691 3300049669 Ga0501235_045234 Ga0501235_045234_66_602 178
692 3300049679 Ga0501249_006054 Ga0501249_006054_653_1189 178
693 3300049690 Ga0501261_001605 Ga0501261_001605_1663_2199 178
694 3300049704 Ga0501221_000588 Ga0501221_000588_339_875 178
695 3300049705 Ga0501225_0000272 Ga0501225_0000272_14534_15070 178
696 3300049708 Ga0501245_039540 Ga0501245_039540_90_626 178
697 3300049743 Ga0501081_0892067 Ga0501081_0892067_106_645 178
698 3300049758 Ga0501241_001599 Ga0501241_001599_3852_4388 178
699 3300049758 Ga0501241_026330 Ga0501241_026330_255_803 178
700 3300049766 Ga0501269_000253 Ga0501269_000253_3558_4094 178
701 3300049824 Ga0501045_0862984 Ga0501045_0862984_31_567 178
702 3300050489 nmdc:mga03683_480919_c1 nmdc:mga03683_480919_c1_28_564 178
703 3300050489 nmdc:mga03683_73693_c1 nmdc:mga03683_73693_c1_183_758 178
704 3300050490 nmdc:mga03n38_15942_c1 nmdc:mga03n38_15942_c1_995_1570 178
705 3300050493 nmdc:mga0k408_60597_c1 nmdc:mga0k408_60597_c1_862_1398 178
706 3300050507 nmdc:mga05p37_188220_c1 nmdc:mga05p37_188220_c1_380_916 178
707 3300050508 nmdc:mga09592_282029_c1 nmdc:mga09592_282029_c1_389_925 178
708 3300050511 nmdc:mga08y16_357918_c1 nmdc:mga08y16_357918_c1_400_939 178
709 3300050511 nmdc:mga08y16_434262_c1 nmdc:mga08y16_434262_c1_429_965 178
710 3300053092 Ga0500583_0000504 Ga0500583_0000504_48_584 178
711 3300053118 Ga0500594_0015910 Ga0500594_0015910_634_1170 178
712 3300053118 Ga0500594_0050566 Ga0500594_0050566_570_1106 178
713 3300053130 Ga0500642_0116964 Ga0500642_0116964_236_772 178
714 3300053133 Ga0500655_058411 Ga0500655_058411_149_685 178
715 3300053136 Ga0500559_0052121 Ga0500559_0052121_147_683 178
716 3300053145 Ga0500586_005434 Ga0500586_005434_1966_2502 178
717 3300053145 Ga0500586_048917 Ga0500586_048917_327_863 178
718 3300053147 Ga0500589_008980 Ga0500589_008980_2859_3395 178
719 3300053156 Ga0500622_0000103 Ga0500622_0000103_32806_33342 178
720 3300053156 Ga0500622_0036821 Ga0500622_0036821_734_1270 178
721 3300053727 Ga0500611_000044 Ga0500611_000044_18031_18567 178
722 3300053730 Ga0500645_072949 Ga0500645_072949_156_692 178
723 3300053739 Ga0500587_026770 Ga0500587_026770_159_695 178
724 3300055283 Ga0500661_010674 Ga0500661_010674_857_1393 178
725 3300059641 Ga0587068_011007 Ga0587068_011007_72_608 178
726 iso_pu_bacteria 2896109856 2896114536 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16242

Pyrid_ox_like

Pyridoxamine 5'-phosphate oxidase like

60

209

0.97

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

61

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fhq-assembly1.cif.gz_B crystal structure of general stress protein from bacteroides thetaiotaomicron 0.8881 21 144
3ec6-assembly1.cif.gz_A-2 crystal structure of the general stress protein 26 from bacillus anthracis str. sterne 0.8714 22 144
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.8622 23 140
2i02-assembly1.cif.gz_B crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8608 19 151
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.8488 20 178
ID Description Score Start End Superfamily
2fhqB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8887 22 144 2.30.110.10
2re7A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8588 23 140 2.30.110.10
2i02B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8566 19 151 2.30.110.10
3ec6A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8565 22 144 2.30.110.10
2qeaB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8351 20 178 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A254N2B7-F1-model_v4 General stress protein 0.987 13 178
AF-A0A519HWY4-F1-model_v4 General stress protein 0.9782 23 178
AF-A0A519HWY4-F1-model_v4 General stress protein 0.9654 23 178
AF-A0A1H8INP5-F1-model_v4 General stress protein 26 0.9644 12 178
AF-A0A4Q3C170-F1-model_v4 deleted 0.9555 61 178

Feature Viewer

pLDDT pTM Quality
92.8 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map