F477667

General Info

Members Datasets Scaffolds Average Seq Length
726 231 1452 283

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100179454|Ga0070697_1001794542
Length 270
Sequence MAQVRAFDVVTAPQILPAERPRGSTLGRFIRKKPLGAAGGFLVLLLVITALLAGVLATHDPVRTSGTVLVAPGADHWLGTDNLGRDLYSRIVHGARISLLVGTDLLSQRVMDIMQALPILVLAALGPSLTNAIVAISIPIVPRAARIIRASVLAIRELTYVESARALGARHARVALRHILPNTMGPFIVLATAQLGGSILVEAALSFLGLGIPEPYPSWGRMLSIAAAEYAEKAPWLVIWPGLAISLAVFGTNLLGDALRDTLDPRLRGS

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
159 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
174 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
183 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.96
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 0.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100179454 3300005536 Bacteria 1795
2 JGI25406J46586_10004577 3300003203 Bacteria 6439
3 JGI26141J51220_1000456 3300003503 Bacteria 2263
4 Ga0065715_10105909 3300005293 Bacteria 2864
5 Ga0070676_10000535 3300005328 Bacteria 18325
6 Ga0070676_10077769 3300005328 Bacteria 2006
7 Ga0070690_100062409 3300005330 Bacteria 2403
8 Ga0068869_100000489 3300005334 Bacteria 21984
9 Ga0068869_100000597 3300005334 Bacteria 20289
10 Ga0068869_100103693 3300005334 Bacteria 2155
11 Ga0070680_100013001 3300005336 Bacteria 6476
12 Ga0070680_100016161 3300005336 Bacteria 5868
13 Ga0070660_100000553 3300005339 Bacteria 25074
14 Ga0070689_100139354 3300005340 Bacteria 1950
15 Ga0070691_10018339 3300005341 Bacteria 3227
16 Ga0070691_10021720 3300005341 Bacteria 2972
17 Ga0070687_100003708 3300005343 Bacteria 5981
18 Ga0070661_100006387 3300005344 Bacteria 8132
19 Ga0070692_10004718 3300005345 Bacteria 5714
20 Ga0070669_100078431 3300005353 Bacteria 2455
21 Ga0070669_100199949 3300005353 Bacteria 1572
22 Ga0070675_100480972 3300005354 Bacteria 1117
23 Ga0070673_100028458 3300005364 Bacteria 4156
24 Ga0070688_100145586 3300005365 Bacteria 1614
25 Ga0070688_100321056 3300005365 Bacteria 1125
26 Ga0070659_100000361 3300005366 Bacteria 34618
27 Ga0070703_10001080 3300005406 Bacteria 8487
28 Ga0070703_10003999 3300005406 Bacteria 4166
29 Ga0070710_10123324 3300005437 Bacteria 1571
30 Ga0070701_10024534 3300005438 Bacteria 2917
31 Ga0070701_10026849 3300005438 Bacteria 2813
32 Ga0070701_10163095 3300005438 Bacteria 1293
33 Ga0070711_100011243 3300005439 Bacteria 5552
34 Ga0070705_100000749 3300005440 Bacteria 18426
35 Ga0070705_100003784 3300005440 Bacteria 7400
36 Ga0070705_100292527 3300005440 Bacteria 1163
37 Ga0070700_100036353 3300005441 Bacteria 2986
38 Ga0070694_100000075 3300005444 Bacteria 47763
39 Ga0070694_100001685 3300005444 Bacteria 12996
40 Ga0070694_100023886 3300005444 Bacteria 3938
41 Ga0070694_100038420 3300005444 Bacteria 3181
42 Ga0070708_100004744 3300005445 Bacteria 10708
43 Ga0070708_100008247 3300005445 Bacteria 8365
44 Ga0070708_100013614 3300005445 Bacteria 6667
45 Ga0070708_100018405 3300005445 Bacteria 5846
46 Ga0070708_100026016 3300005445 Bacteria 5005
47 Ga0070708_100099736 3300005445 Bacteria 2657
48 Ga0070708_100135642 3300005445 Bacteria 2280
49 Ga0070708_100176316 3300005445 Bacteria 1997
50 Ga0070708_100221066 3300005445 Bacteria 1776
51 Ga0070708_100377623 3300005445 Bacteria 1336
52 Ga0070663_100009039 3300005455 Bacteria 6155
53 Ga0070662_100001124 3300005457 Bacteria 16336
54 Ga0070681_10029620 3300005458 Bacteria 5496
55 Ga0070706_100002460 3300005467 Bacteria 18675
56 Ga0070706_100004339 3300005467 Bacteria 13722
57 Ga0070706_100016657 3300005467 Bacteria 6790
58 Ga0070706_100018217 3300005467 Bacteria 6479
59 Ga0070706_100087543 3300005467 Bacteria 2887
60 Ga0070706_100157130 3300005467 Bacteria 2123
61 Ga0070706_100165443 3300005467 Bacteria 2065
62 Ga0070706_100165941 3300005467 Bacteria 2062
63 Ga0070707_100002048 3300005468 Bacteria 19307
64 Ga0070707_100003191 3300005468 Bacteria 15511
65 Ga0070707_100013670 3300005468 Bacteria 7602
66 Ga0070707_100015860 3300005468 Bacteria 7073
67 Ga0070707_100022793 3300005468 Bacteria 5921
68 Ga0070707_100085762 3300005468 Bacteria 3044
69 Ga0070707_100086238 3300005468 Bacteria 3036
70 Ga0070707_100509834 3300005468 Bacteria 1165
71 Ga0070698_100002641 3300005471 Bacteria 19751
72 Ga0070698_100007501 3300005471 Bacteria 11802
73 Ga0070698_100008603 3300005471 Bacteria 11002
74 Ga0070698_100029304 3300005471 Bacteria 5713
75 Ga0070698_100143768 3300005471 Bacteria 2335
76 Ga0070698_100540248 3300005471 Bacteria 1105
77 Ga0070699_100004395 3300005518 Bacteria 12459
78 Ga0070699_100015190 3300005518 Bacteria 6616
79 Ga0070699_100035843 3300005518 Bacteria 4289
80 Ga0070699_100052370 3300005518 Bacteria 3532
81 Ga0070699_100093064 3300005518 Bacteria 2637
82 Ga0070699_100129926 3300005518 Bacteria 2220
83 Ga0070699_100550865 3300005518 Bacteria 1050
84 Ga0070679_100035088 3300005530 Bacteria 4975
85 Ga0070684_100085838 3300005535 Bacteria 2792
86 Ga0070697_100006259 3300005536 Bacteria 9217
87 Ga0070697_100026663 3300005536 Bacteria 4620
88 Ga0070697_100037921 3300005536 Unclassified 3892
89 Ga0070697_100048971 3300005536 Bacteria 3428
90 Ga0070697_100060093 3300005536 Bacteria 3097
91 Ga0070697_100076260 3300005536 Bacteria 2757
92 Ga0070697_100102328 3300005536 Bacteria 2380
93 Ga0068853_100004643 3300005539 Bacteria 10650
94 Ga0070672_100182341 3300005543 Bacteria 1750
95 Ga0070695_100000644 3300005545 Bacteria 18552
96 Ga0070695_100000681 3300005545 Bacteria 18140
97 Ga0070695_100001082 3300005545 Bacteria 14891
98 Ga0070695_100001864 3300005545 Bacteria 11908
99 Ga0070695_100004551 3300005545 Bacteria 8145
100 Ga0070695_100013140 3300005545 Bacteria 4975
101 Ga0070695_100379100 3300005545 Bacteria 1067
102 Ga0070696_100029706 3300005546 Bacteria 3739
103 Ga0070696_100089950 3300005546 Bacteria 2183
104 Ga0070696_100134978 3300005546 Bacteria 1798
105 Ga0070693_100095718 3300005547 Bacteria 1798
106 Ga0070704_100006488 3300005549 Bacteria 6895
107 Ga0070704_100176623 3300005549 Bacteria 1704
108 Ga0068855_100001782 3300005563 Bacteria 26913
109 Ga0070664_100020894 3300005564 Bacteria 5394
110 Ga0068857_100017712 3300005577 Bacteria 6247
111 Ga0068857_100434856 3300005577 Bacteria 1225
112 Ga0068854_100016893 3300005578 Bacteria 4873
113 Ga0068856_100012429 3300005614 Bacteria 8242
114 Ga0070702_100059797 3300005615 Bacteria 2213
115 Ga0068859_100000846 3300005617 Bacteria 31150
116 Ga0068859_100209678 3300005617 Bacteria 2034
117 Ga0068859_100625946 3300005617 Bacteria 1169
118 Ga0068864_100123840 3300005618 Bacteria 2314
119 Ga0068866_10169651 3300005718 Bacteria 1280
120 Ga0068870_10001449 3300005840 Bacteria 9595
121 Ga0068863_100017318 3300005841 Bacteria 6909
122 Ga0068863_100054432 3300005841 Bacteria 3791
123 Ga0068858_100091955 3300005842 Bacteria 2824
124 Ga0068860_100050069 3300005843 Bacteria 3978
125 Ga0068860_100096645 3300005843 Bacteria 2816
126 Ga0068860_100136915 3300005843 Bacteria 2352
127 Ga0068860_100417697 3300005843 Bacteria 1329
128 Ga0068862_100038217 3300005844 Bacteria 4070
129 Ga0068862_100091491 3300005844 Bacteria 2650
130 Ga0068862_100262484 3300005844 Bacteria 1577
131 Ga0081455_10000907 3300005937 Bacteria 37985
132 Ga0081538_10002972 3300005981 Bacteria 16184
133 Ga0081538_10015138 3300005981 Bacteria 5989
134 Ga0081539_10001199 3300005985 Bacteria 46742
135 Ga0070716_100009726 3300006173 Bacteria 4800
136 Ga0070716_100336144 3300006173 Bacteria 1064
137 Ga0070712_100003855 3300006175 Bacteria 9229
138 Ga0075428_100000270 3300006844 Bacteria 51517
139 Ga0075428_100000620 3300006844 Bacteria 36286
140 Ga0075428_100002673 3300006844 Bacteria 19366
141 Ga0075428_100019634 3300006844 Bacteria 7478
142 Ga0075428_100103747 3300006844 Bacteria 3100
143 Ga0075428_100147819 3300006844 Bacteria 2554
144 Ga0075428_100156253 3300006844 Bacteria 2478
145 Ga0075428_100263498 3300006844 Bacteria 1855
146 Ga0075428_100264984 3300006844 Bacteria 1850
147 Ga0075428_100412433 3300006844 Bacteria 1447
148 Ga0075430_100001096 3300006846 Bacteria 21510
149 Ga0075430_100001761 3300006846 Bacteria 17689
150 Ga0075430_100003622 3300006846 Bacteria 12953
151 Ga0075430_100005337 3300006846 Bacteria 10852
152 Ga0075430_100023833 3300006846 Bacteria 5212
153 Ga0075430_100039631 3300006846 Bacteria 3988
154 Ga0075430_100088592 3300006846 Bacteria 2590
155 Ga0075430_100247727 3300006846 Bacteria 1476
156 Ga0075431_100000248 3300006847 Bacteria 40965
157 Ga0075431_100001908 3300006847 Bacteria 19801
158 Ga0075431_100002113 3300006847 Bacteria 18986
159 Ga0075431_100002354 3300006847 Bacteria 18153
160 Ga0075431_100002858 3300006847 Bacteria 16702
161 Ga0075431_100012781 3300006847 Bacteria 8476
162 Ga0075431_100014665 3300006847 Bacteria 7929
163 Ga0075431_100019736 3300006847 Bacteria 6879
164 Ga0075431_100059646 3300006847 Bacteria 3937
165 Ga0075431_100062175 3300006847 Bacteria 3853
166 Ga0075431_100099795 3300006847 Bacteria 2996
167 Ga0075431_100303364 3300006847 Bacteria 1613
168 Ga0075431_100310521 3300006847 Bacteria 1592
169 Ga0075431_100349356 3300006847 Bacteria 1487
170 Ga0075431_100349476 3300006847 Bacteria 1487
171 Ga0075433_10001347 3300006852 Bacteria 17999
172 Ga0075433_10011277 3300006852 Bacteria 7193
173 Ga0075433_10011708 3300006852 Bacteria 7065
174 Ga0075433_10017376 3300006852 Bacteria 5957
175 Ga0075433_10021514 3300006852 Bacteria 5409
176 Ga0075433_10021592 3300006852 Bacteria 5399
177 Ga0075433_10028313 3300006852 Bacteria 4762
178 Ga0075433_10064496 3300006852 Bacteria 3211
179 Ga0075433_10090777 3300006852 Bacteria 2700
180 Ga0075433_10150849 3300006852 Bacteria 2068
181 Ga0075433_10197431 3300006852 Bacteria 1789
182 Ga0075433_10203183 3300006852 Bacteria 1761
183 Ga0075433_10258235 3300006852 Bacteria 1545
184 Ga0075433_10362828 3300006852 Bacteria 1280
185 Ga0075434_100014308 3300006871 Bacteria 7583
186 Ga0075434_100014384 3300006871 Bacteria 7563
187 Ga0075434_100040047 3300006871 Bacteria 4641
188 Ga0075434_100041564 3300006871 Bacteria 4555
189 Ga0075434_100052179 3300006871 Bacteria 4063
190 Ga0075434_100062056 3300006871 Bacteria 3720
191 Ga0075434_100071694 3300006871 Bacteria 3456
192 Ga0075434_100083579 3300006871 Bacteria 3190
193 Ga0075434_100084525 3300006871 Bacteria 3172
194 Ga0075434_100086632 3300006871 Bacteria 3132
195 Ga0075434_100108419 3300006871 Bacteria 2787
196 Ga0075434_100167997 3300006871 Bacteria 2213
197 Ga0075434_100205671 3300006871 Bacteria 1989
198 Ga0075434_100319293 3300006871 Bacteria 1574
199 Ga0075429_100000213 3300006880 Bacteria 39048
200 Ga0075429_100001899 3300006880 Bacteria 17309
201 Ga0075429_100008433 3300006880 Bacteria 8969
202 Ga0075429_100009355 3300006880 Bacteria 8507
203 Ga0075429_100015114 3300006880 Bacteria 6691
204 Ga0075429_100023861 3300006880 Bacteria 5308
205 Ga0075429_100026046 3300006880 Bacteria 5076
206 Ga0075429_100038151 3300006880 Bacteria 4182
207 Ga0075429_100183328 3300006880 Bacteria 1834
208 Ga0075429_100290771 3300006880 Bacteria 1431
209 Ga0075429_100315216 3300006880 Bacteria 1369
210 Ga0068865_100287613 3300006881 Bacteria 1311
211 Ga0075436_100039538 3300006914 Bacteria 3255
212 Ga0075436_100194810 3300006914 Bacteria 1434
213 Ga0097620_100000846 3300006931 Bacteria 31150
214 Ga0097620_100209669 3300006931 Bacteria 2034
215 Ga0097620_100625974 3300006931 Bacteria 1169
216 Ga0075435_100005157 3300007076 Bacteria 9083
217 Ga0075435_100009059 3300007076 Bacteria 7180
218 Ga0075435_100017643 3300007076 Bacteria 5408
219 Ga0075435_100022613 3300007076 Bacteria 4851
220 Ga0075435_100036511 3300007076 Bacteria 3906
221 Ga0075435_100044770 3300007076 Bacteria 3545
222 Ga0075435_100073273 3300007076 Bacteria 2799
223 Ga0075435_100426531 3300007076 Bacteria 1142
224 Ga0099794_10001369 3300007265 Bacteria 8482
225 Ga0099794_10011061 3300007265 Bacteria 3856
226 Ga0099794_10019761 3300007265 Bacteria 3041
227 Ga0111539_10000318 3300009094 Bacteria 58792
228 Ga0111539_10002886 3300009094 Bacteria 22825
229 Ga0111539_10016499 3300009094 Bacteria 9158
230 Ga0111539_10021399 3300009094 Bacteria 7960
231 Ga0111539_10488923 3300009094 Bacteria 1433
232 Ga0105245_10342349 3300009098 Bacteria 1479
233 Ga0105245_10422561 3300009098 Bacteria 1336
234 Ga0105247_10033843 3300009101 Bacteria 3111
235 Ga0114129_10003766 3300009147 Bacteria 21379
236 Ga0114129_10004848 3300009147 Bacteria 18996
237 Ga0114129_10005728 3300009147 Bacteria 17602
238 Ga0114129_10007755 3300009147 Bacteria 15271
239 Ga0114129_10009065 3300009147 Bacteria 14182
240 Ga0114129_10014976 3300009147 Bacteria 11048
241 Ga0114129_10020971 3300009147 Bacteria 9281
242 Ga0114129_10025266 3300009147 Bacteria 8416
243 Ga0114129_10034198 3300009147 Bacteria 7176
244 Ga0114129_10052390 3300009147 Bacteria 5727
245 Ga0114129_10066726 3300009147 Bacteria 5018
246 Ga0114129_10071080 3300009147 Bacteria 4852
247 Ga0114129_10075363 3300009147 Bacteria 4698
248 Ga0114129_10161288 3300009147 Bacteria 3062
249 Ga0114129_10165902 3300009147 Bacteria 3014
250 Ga0114129_10242302 3300009147 Bacteria 2424
251 Ga0114129_10335672 3300009147 Bacteria 2006
252 Ga0114129_10420353 3300009147 Bacteria 1758
253 Ga0114129_10654529 3300009147 Bacteria 1355
254 Ga0105243_10015781 3300009148 Bacteria 5712
255 Ga0105243_10142187 3300009148 Bacteria 2049
256 Ga0105241_10320642 3300009174 Bacteria 1336
257 Ga0105241_10359203 3300009174 Bacteria 1267
258 Ga0105242_10002142 3300009176 Bacteria 15585
259 Ga0105248_10070173 3300009177 Bacteria 3935
260 Ga0105248_10338404 3300009177 Bacteria 1694
261 Ga0105249_10022716 3300009553 Bacteria 5621
262 Ga0105249_10088965 3300009553 Bacteria 2885
263 Ga0105249_10269066 3300009553 Bacteria 1697
264 Ga0105239_10073951 3300010375 Bacteria 3747
265 Ga0157373_10000895 3300013100 Bacteria 23063
266 Ga0157369_10013504 3300013105 Bacteria 9229
267 Ga0157378_10054340 3300013297 Bacteria 3566
268 Ga0163162_10783077 3300013306 Bacteria 1072
269 Ga0157372_10003412 3300013307 Bacteria 17142
270 Ga0157372_10030680 3300013307 Bacteria 5882
271 Ga0157375_10010732 3300013308 Bacteria 8073
272 Ga0157375_10110089 3300013308 Bacteria 2851
273 Ga0157380_10412698 3300014326 Bacteria 1285
274 Ga0157380_10803364 3300014326 Bacteria 958
275 Ga0157379_10704446 3300014968 Bacteria 948
276 Ga0206353_11590816 3300020082 Bacteria 1574
277 Ga0207653_10002440 3300025885 Bacteria 5911
278 Ga0207653_10007828 3300025885 Bacteria 3333
279 Ga0207653_10085294 3300025885 Bacteria 1099
280 Ga0207710_10073718 3300025900 Bacteria 1570
281 Ga0207688_10029098 3300025901 Bacteria 3040
282 Ga0207647_10038530 3300025904 Bacteria 3021
283 Ga0207699_10175172 3300025906 Bacteria 1438
284 Ga0207645_10000406 3300025907 Bacteria 35625
285 Ga0207645_10079862 3300025907 Bacteria 2097
286 Ga0207643_10003335 3300025908 Bacteria 8656
287 Ga0207643_10026294 3300025908 Bacteria 3221
288 Ga0207684_10000508 3300025910 Bacteria 48513
289 Ga0207684_10010763 3300025910 Bacteria 8028
290 Ga0207684_10025957 3300025910 Bacteria 4994
291 Ga0207684_10029580 3300025910 Bacteria 4663
292 Ga0207684_10034142 3300025910 Bacteria 4323
293 Ga0207684_10132462 3300025910 Bacteria 2140
294 Ga0207684_10324781 3300025910 Bacteria 1326
295 Ga0207684_10443324 3300025910 Bacteria 1115
296 Ga0207654_10001734 3300025911 Bacteria 11338
297 Ga0207707_10000171 3300025912 Bacteria 67484
298 Ga0207693_10072757 3300025915 Bacteria 2691
299 Ga0207660_10000651 3300025917 Bacteria 23409
300 Ga0207660_10072760 3300025917 Bacteria 2504
301 Ga0207662_10007469 3300025918 Bacteria 5953
302 Ga0207657_10000085 3300025919 Bacteria 89158
303 Ga0207649_10010784 3300025920 Bacteria 5025
304 Ga0207652_10000264 3300025921 Bacteria 54769
305 Ga0207646_10002657 3300025922 Bacteria 20965
306 Ga0207646_10007022 3300025922 Bacteria 11533
307 Ga0207646_10016912 3300025922 Bacteria 6834
308 Ga0207646_10020059 3300025922 Bacteria 6199
309 Ga0207646_10021109 3300025922 Bacteria 6023
310 Ga0207646_10066377 3300025922 Bacteria 3221
311 Ga0207646_10117708 3300025922 Bacteria 2386
312 Ga0207646_10213264 3300025922 Bacteria 1744
313 Ga0207646_10218319 3300025922 Bacteria 1722
314 Ga0207646_10220066 3300025922 Bacteria 1715
315 Ga0207646_10240720 3300025922 Bacteria 1635
316 Ga0207646_10290133 3300025922 Bacteria 1478
317 Ga0207646_10366705 3300025922 Bacteria 1301
318 Ga0207681_10024979 3300025923 Bacteria 3839
319 Ga0207681_10080399 3300025923 Bacteria 2299
320 Ga0207681_10293466 3300025923 Bacteria 1284
321 Ga0207659_10216667 3300025926 Bacteria 1537
322 Ga0207690_10004576 3300025932 Bacteria 8170
323 Ga0207706_10003246 3300025933 Bacteria 15585
324 Ga0207706_10024855 3300025933 Bacteria 5369
325 Ga0207706_10202265 3300025933 Bacteria 1742
326 Ga0207686_10009765 3300025934 Bacteria 5216
327 Ga0207709_10004861 3300025935 Bacteria 7687
328 Ga0207709_10039737 3300025935 Bacteria 2812
329 Ga0207709_10109605 3300025935 Bacteria 1843
330 Ga0207665_10002655 3300025939 Bacteria 12011
331 Ga0207691_10010502 3300025940 Bacteria 8884
332 Ga0207711_10112482 3300025941 Bacteria 2423
333 Ga0207689_10000579 3300025942 Bacteria 34972
334 Ga0207689_10004704 3300025942 Bacteria 12322
335 Ga0207689_10049449 3300025942 Bacteria 3468
336 Ga0207679_10000724 3300025945 Bacteria 21897
337 Ga0207667_10013787 3300025949 Bacteria 9235
338 Ga0207712_10019754 3300025961 Bacteria 4403
339 Ga0207712_10061806 3300025961 Bacteria 2660
340 Ga0207668_10252549 3300025972 Bacteria 1433
341 Ga0207640_10003974 3300025981 Bacteria 7981
342 Ga0207703_10129504 3300026035 Bacteria 2177
343 Ga0207703_10359059 3300026035 Bacteria 1343
344 Ga0207678_10000868 3300026067 Bacteria 27729
345 Ga0207708_10050148 3300026075 Bacteria 3178
346 Ga0207702_10005061 3300026078 Bacteria 11576
347 Ga0207641_10046084 3300026088 Bacteria 3675
348 Ga0207641_10402960 3300026088 Bacteria 1314
349 Ga0207641_10414902 3300026088 Bacteria 1295
350 Ga0207648_10126288 3300026089 Bacteria 2250
351 Ga0207648_10261967 3300026089 Bacteria 1543
352 Ga0207648_10349906 3300026089 Bacteria 1332
353 Ga0207676_10205667 3300026095 Bacteria 1742
354 Ga0207674_10001185 3300026116 Bacteria 33885
355 Ga0207675_100003318 3300026118 Bacteria 15756
356 Ga0207675_100066957 3300026118 Bacteria 3357
357 Ga0207675_100069402 3300026118 Bacteria 3294
358 Ga0207675_100101026 3300026118 Bacteria 2717
359 Ga0207675_100434499 3300026118 Bacteria 1298
360 Ga0209969_1001814 3300027360 Bacteria 2936
361 Ga0209969_1011477 3300027360 Bacteria 1273
362 Ga0209967_1002244 3300027364 Bacteria 2509
363 Ga0209996_1001038 3300027395 Bacteria 3313
364 Ga0210000_1004236 3300027462 Bacteria 2074
365 Ga0209995_1003377 3300027471 Bacteria 2542
366 Ga0209968_1000978 3300027526 Bacteria 4396
367 Ga0209968_1001678 3300027526 Bacteria 3343
368 Ga0209999_1000729 3300027543 Bacteria 5341
369 Ga0209982_1002773 3300027552 Bacteria 2464
370 Ga0210002_1000759 3300027617 Bacteria 4377
371 Ga0210002_1001006 3300027617 Bacteria 3899
372 Ga0209983_1000857 3300027665 Bacteria 6698
373 Ga0209588_1007645 3300027671 Bacteria 3186
374 Ga0209971_1000033 3300027682 Bacteria 48530
375 Ga0209971_1000104 3300027682 Bacteria 24919
376 Ga0209966_1000123 3300027695 Bacteria 33905
377 Ga0209966_1000135 3300027695 Bacteria 31056
378 Ga0209998_10000003 3300027717 Bacteria 110511
379 Ga0209998_10000162 3300027717 Bacteria 24625
380 Ga0209974_10001334 3300027876 Bacteria 8863
381 Ga0209974_10005872 3300027876 Bacteria 4305
382 Ga0207428_10000399 3300027907 Bacteria 53984
383 Ga0207428_10000489 3300027907 Bacteria 47382
384 Ga0207428_10010665 3300027907 Bacteria 8194
385 Ga0268265_10063544 3300028380 Bacteria 2840
386 Ga0268265_10127518 3300028380 Bacteria 2109
387 Ga0268265_10175592 3300028380 Bacteria 1836
388 Ga0268264_10111376 3300028381 Bacteria 2398
389 Ga0268264_10150463 3300028381 Bacteria 2086
390 Ga0268264_10210263 3300028381 Bacteria 1785
391 Ga0268264_10416344 3300028381 Bacteria 1295
392 Ga0307408_100005830 3300031548 Bacteria 8194
393 Ga0307408_100110310 3300031548 Bacteria 2112
394 Ga0307408_100135278 3300031548 Bacteria 1928
395 Ga0307410_10362763 3300031852 Bacteria 1161
396 Ga0307406_10026462 3300031901 Bacteria 3485
397 Ga0307406_10041212 3300031901 Bacteria 2876
398 Ga0307407_10189670 3300031903 Bacteria 1369
399 Ga0307409_100401814 3300031995 Bacteria 1309
400 Ga0307416_100041858 3300032002 Bacteria 3571
401 Ga0307416_100291534 3300032002 Bacteria 1616
402 Ga0307416_100586406 3300032002 Bacteria 1193
403 Ga0307411_10013147 3300032005 Bacteria 4553
404 Ga0307411_10203885 3300032005 Bacteria 1521
405 Ga0373930_0022472 3300034816 Bacteria 1248
406 Ga0373948_0032683 3300034817 Bacteria 1056
407 Ga0373959_0017205 3300034820 Bacteria 1348
408 Ga0373940_0004910 3300035088 Bacteria 2859
409 Ga0373940_0014528 3300035088 Bacteria 1922
410 Ga0373949_0024770 3300035090 Bacteria 1397
411 Ga0373951_0007840 3300035091 Bacteria 2422
412 Ga0373932_0034165 3300035112 Bacteria 1431
413 Ga0373939_0081905 3300035114 Bacteria 1073
414 Ga0373962_0014308 3300035242 Bacteria 2021
415 Ga0373931_0003748 3300035691 Bacteria 6872
416 Ga0373931_0008181 3300035691 Bacteria 4954
417 Ga0373931_0087287 3300035691 Bacteria 1732
418 Ga0373931_0098836 3300035691 Bacteria 1638
419 Ga0395899_0013627 3300037312 Bacteria 6216
420 Ga0395900_0007319 3300037418 Bacteria 11417
421 Ga0395898_0002760 3300037466 Bacteria 20226
422 Ga0395901_0004796 3300038443 Bacteria 13643
423 Ga0439448_0034342 3300042005 Unclassified 1620
424 Ga0439450_009183 3300042008 Bacteria 1870
425 Ga0439450_035717 3300042008 Bacteria 1135
426 Ga0439455_0013530 3300042012 Bacteria 1849
427 Ga0439464_0001275 3300042439 Bacteria 5858
428 Ga0439464_0016950 3300042439 Unclassified 1973
429 Ga0439460_0000679 3300042461 Bacteria 7521
430 Ga0439460_0001183 3300042461 Bacteria 6131
431 Ga0439460_0008908 3300042461 Bacteria 2538
432 Ga0451577_0002998 3300042876 Bacteria 19238
433 Ga0451577_0022851 3300042876 Bacteria 5708
434 Ga0451577_0051032 3300042876 Bacteria 3693
435 Ga0451577_0225250 3300042876 Bacteria 1695
436 Ga0451577_0462253 3300042876 Bacteria 1152
437 Ga0453683_0002797 3300044673 Bacteria 13268
438 Ga0453683_0072537 3300044673 Bacteria 2155
439 Ga0453684_0029631 3300044712 Bacteria 7761
440 Ga0453684_0062219 3300044712 Bacteria 4783
441 Ga0453684_0296254 3300044712 Bacteria 1840
442 Ga0451576_0008317 3300045051 Bacteria 12198
443 Ga0451576_0009532 3300045051 Bacteria 11250
444 Ga0451576_0012415 3300045051 Bacteria 9568
445 Ga0451576_0052512 3300045051 Bacteria 4271
446 Ga0451576_0071563 3300045051 Bacteria 3609
447 Ga0451576_0072286 3300045051 Unclassified 3590
448 Ga0451576_0142892 3300045051 Bacteria 2495
449 Ga0451576_0157253 3300045051 Bacteria 2371
450 Ga0451576_0164562 3300045051 Bacteria 2315
451 Ga0451576_0454709 3300045051 Bacteria 1344
452 Ga0495594_0081398 3300046499 Bacteria 1808
453 Ga0495642_0085332 3300046528 Bacteria 1333
454 Ga0495659_0051612 3300046664 Bacteria 1498
455 Ga0495659_0128966 3300046664 Bacteria 1002
456 Ga0495588_0064527 3300046674 Bacteria 1900
457 Ga0495669_0013283 3300046684 Bacteria 3507
458 Ga0495670_0039432 3300046691 Bacteria 2356
459 Ga0496102_0005073 3300048905 Bacteria 11151
460 Ga0496102_0240144 3300048905 Bacteria 1708
461 Ga0496103_0030039 3300048906 Bacteria 3305
462 Ga0496104_0212967 3300048907 Bacteria 1844
463 Ga0496106_0160955 3300048909 Bacteria 1775
464 Ga0496106_0422691 3300048909 Bacteria 1071
465 Ga0496109_0102379 3300048912 Bacteria 2658
466 Ga0501031_0145713 3300049568 Bacteria 1547
467 Ga0501031_0334544 3300049568 Bacteria 980
468 Ga0501033_0014928 3300049570 Bacteria 5897
469 Ga0501033_0091283 3300049570 Bacteria 2228
470 Ga0501036_0004351 3300049572 Bacteria 11427
471 Ga0501036_0066752 3300049572 Bacteria 3044
472 Ga0501036_0104423 3300049572 Bacteria 2396
473 Ga0501036_0370930 3300049572 Bacteria 1195
474 Ga0501037_0079815 3300049573 Bacteria 2375
475 Ga0501037_0294871 3300049573 Bacteria 1127
476 Ga0501037_0329119 3300049573 Bacteria 1057
477 Ga0501038_0050772 3300049574 Bacteria 3583
478 Ga0501038_0072956 3300049574 Bacteria 2908
479 Ga0501039_0002929 3300049575 Bacteria 12772
480 Ga0501039_0021336 3300049575 Bacteria 4970
481 Ga0501039_0027807 3300049575 Bacteria 4349
482 Ga0501039_0033550 3300049575 Bacteria 3958
483 Ga0501039_0088686 3300049575 Bacteria 2409
484 Ga0501039_0298221 3300049575 Bacteria 1267
485 Ga0501040_0000791 3300049576 Bacteria 19704
486 Ga0501040_0005567 3300049576 Bacteria 8153
487 Ga0501040_0016654 3300049576 Bacteria 4870
488 Ga0501040_0043751 3300049576 Bacteria 3053
489 Ga0501040_0054320 3300049576 Bacteria 2746
490 Ga0501040_0088141 3300049576 Bacteria 2155
491 Ga0501040_0178018 3300049576 Bacteria 1507
492 Ga0501041_0028298 3300049577 Bacteria 3381
493 Ga0501041_0041934 3300049577 Bacteria 2780
494 Ga0501041_0086656 3300049577 Bacteria 1932
495 Ga0501041_0292622 3300049577 Bacteria 1026
496 Ga0501042_0001561 3300049578 Bacteria 13549
497 Ga0501042_0006686 3300049578 Bacteria 7511
498 Ga0501042_0013234 3300049578 Bacteria 5615
499 Ga0501042_0398179 3300049578 Bacteria 997
500 Ga0501046_0004532 3300049580 Bacteria 12586
501 Ga0501046_0019559 3300049580 Bacteria 5614
502 Ga0501046_0035757 3300049580 Bacteria 4001
503 Ga0501046_0043794 3300049580 Bacteria 3562
504 Ga0501046_0069222 3300049580 Bacteria 2746
505 Ga0501046_0297294 3300049580 Bacteria 1180
506 Ga0501047_0110257 3300049581 Bacteria 2635
507 Ga0501048_0009386 3300049582 Bacteria 7345
508 Ga0501048_0011675 3300049582 Bacteria 6552
509 Ga0501048_0021286 3300049582 Bacteria 4748
510 Ga0501048_0078058 3300049582 Bacteria 2337
511 Ga0501048_0123908 3300049582 Bacteria 1827
512 Ga0501048_0160089 3300049582 Bacteria 1593
513 Ga0501048_0306675 3300049582 Bacteria 1130
514 Ga0501067_0027891 3300049583 Bacteria 3129
515 Ga0501068_0056743 3300049584 Bacteria 2374
516 Ga0501068_0294180 3300049584 Bacteria 1039
517 Ga0501071_0026960 3300049587 Bacteria 4039
518 Ga0501071_0037030 3300049587 Bacteria 3482
519 Ga0501071_0116368 3300049587 Unclassified 1979
520 Ga0501071_0258373 3300049587 Bacteria 1315
521 Ga0501072_0020224 3300049588 Bacteria 5155
522 Ga0501072_0021656 3300049588 Bacteria 4985
523 Ga0501072_0023696 3300049588 Bacteria 4769
524 Ga0501072_0032129 3300049588 Bacteria 4110
525 Ga0501072_0070982 3300049588 Bacteria 2751
526 Ga0501072_0105398 3300049588 Bacteria 2242
527 Ga0501072_0147940 3300049588 Bacteria 1873
528 Ga0501072_0259121 3300049588 Bacteria 1384
529 Ga0501073_0170640 3300049589 Bacteria 1506
530 Ga0501074_0000711 3300049590 Bacteria 20839
531 Ga0501074_0019135 3300049590 Bacteria 4970
532 Ga0501074_0082996 3300049590 Bacteria 2298
533 Ga0501074_0084839 3300049590 Bacteria 2270
534 Ga0501074_0112711 3300049590 Bacteria 1946
535 Ga0501074_0140251 3300049590 Bacteria 1729
536 Ga0501074_0198729 3300049590 Bacteria 1429
537 Ga0501074_0352110 3300049590 Bacteria 1045
538 Ga0501075_0000027 3300049591 Bacteria 58951
539 Ga0501075_0004995 3300049591 Bacteria 9050
540 Ga0501075_0014848 3300049591 Bacteria 5585
541 Ga0501075_0015798 3300049591 Bacteria 5427
542 Ga0501075_0023466 3300049591 Bacteria 4517
543 Ga0501075_0025958 3300049591 Bacteria 4307
544 Ga0501075_0075705 3300049591 Bacteria 2545
545 Ga0501075_0088006 3300049591 Bacteria 2354
546 Ga0501075_0102423 3300049591 Bacteria 2174
547 Ga0501075_0208089 3300049591 Bacteria 1492
548 Ga0501075_0297292 3300049591 Bacteria 1230
549 Ga0501075_0395811 3300049591 Bacteria 1053
550 Ga0501075_0424920 3300049591 Bacteria 1013
551 Ga0501076_0000052 3300049592 Bacteria 56924
552 Ga0501076_0024864 3300049592 Bacteria 4632
553 Ga0501076_0063537 3300049592 Bacteria 2941
554 Ga0501076_0070817 3300049592 Bacteria 2788
555 Ga0501076_0122325 3300049592 Bacteria 2107
556 Ga0501076_0129380 3300049592 Bacteria 2047
557 Ga0501076_0156415 3300049592 Bacteria 1856
558 Ga0501077_0003091 3300049593 Bacteria 10008
559 Ga0501077_0046957 3300049593 Bacteria 2743
560 Ga0501077_0096158 3300049593 Bacteria 1877
561 Ga0501077_0205165 3300049593 Bacteria 1252
562 Ga0501077_0257495 3300049593 Bacteria 1110
563 Ga0501079_0004312 3300049741 Bacteria 10557
564 Ga0501079_0004631 3300049741 Bacteria 10185
565 Ga0501079_0014988 3300049741 Bacteria 5909
566 Ga0501079_0018415 3300049741 Bacteria 5336
567 Ga0501079_0213563 3300049741 Bacteria 1507
568 Ga0501079_0215313 3300049741 Bacteria 1500
569 Ga0501079_0228101 3300049741 Bacteria 1455
570 Ga0501079_0243005 3300049741 Bacteria 1407
571 Ga0501079_0267115 3300049741 Bacteria 1337
572 Ga0501080_0023986 3300049742 Bacteria 5655
573 Ga0501080_0133840 3300049742 Bacteria 2295
574 Ga0501080_0231891 3300049742 Bacteria 1687
575 Ga0501080_0272479 3300049742 Bacteria 1540
576 Ga0501080_0588580 3300049742 Bacteria 988
577 Ga0501081_0001007 3300049743 Bacteria 16802
578 Ga0501081_0002009 3300049743 Bacteria 12665
579 Ga0501081_0018078 3300049743 Bacteria 4677
580 Ga0501081_0034237 3300049743 Bacteria 3455
581 Ga0501081_0036973 3300049743 Bacteria 3331
582 Ga0501081_0045381 3300049743 Bacteria 3018
583 Ga0501081_0053894 3300049743 Bacteria 2777
584 Ga0501081_0077514 3300049743 Bacteria 2323
585 Ga0501081_0168833 3300049743 Bacteria 1579
586 Ga0501081_0170720 3300049743 Bacteria 1570
587 Ga0501083_0003406 3300049744 Bacteria 11127
588 Ga0501083_0019182 3300049744 Bacteria 4763
589 Ga0501035_0261230 3300049822 Bacteria 1468
590 Ga0501045_0000228 3300049824 Bacteria 32513
591 Ga0501045_0003224 3300049824 Bacteria 11145
592 Ga0501045_0008341 3300049824 Bacteria 7217
593 Ga0501045_0040410 3300049824 Bacteria 3394
594 Ga0501045_0176438 3300049824 Bacteria 1592
595 Ga0501045_0198612 3300049824 Bacteria 1494
596 nmdc:mga05p37_10235_c1 3300050507 Bacteria 11137
597 nmdc:mga05p37_11137_c1 3300050507 Bacteria 10687
598 nmdc:mga05p37_115994_c1 3300050507 Bacteria 3292
599 nmdc:mga05p37_12117_c1 3300050507 Bacteria 10295
600 nmdc:mga05p37_14068_c1 3300050507 Bacteria 9602
601 nmdc:mga05p37_143010_c1 3300050507 Bacteria 2930
602 nmdc:mga05p37_157398_c1 3300050507 Bacteria 2776
603 nmdc:mga05p37_1693_c1 3300050507 Bacteria 25677
604 nmdc:mga05p37_202657_c1 3300050507 Bacteria 2402
605 nmdc:mga05p37_3059_c2 3300050507 Bacteria 13615
606 nmdc:mga05p37_33107_c1 3300050507 Bacteria 6329
607 nmdc:mga05p37_40455_c1 3300050507 Bacteria 5725
608 nmdc:mga05p37_41682_c1 3300050507 Bacteria 5638
609 nmdc:mga05p37_520489_c1 3300050507 Bacteria 1361
610 nmdc:mga05p37_53373_c1 3300050507 Bacteria 4971
611 nmdc:mga05p37_537133_c1 3300050507 Bacteria 1334
612 nmdc:mga05p37_640647_c1 3300050507 Bacteria 1192
613 nmdc:mga05p37_71716_c1 3300050507 Bacteria 4262
614 nmdc:mga05p37_7425_c1 3300050507 Bacteria 12933
615 nmdc:mga05p37_979033_c1 3300050507 Bacteria 901
616 nmdc:mga09592_13829_c1 3300050508 Bacteria 6594
617 nmdc:mga09592_15605_c1 3300050508 Bacteria 6206
618 nmdc:mga09592_23437_c1 3300050508 Bacteria 5099
619 nmdc:mga09592_3361_c1 3300050508 Bacteria 12931
620 nmdc:mga09592_487577_c1 3300050508 Bacteria 1062
621 nmdc:mga09592_84669_c1 3300050508 Bacteria 2704
622 nmdc:mga09592_99_c1 3300050508 Bacteria 52493
623 nmdc:mga0qj67_127_c1 3300050509 Bacteria 50287
624 nmdc:mga0qj67_1295_c1 3300050509 Bacteria 17530
625 nmdc:mga0qj67_147198_c1 3300050509 Bacteria 1910
626 nmdc:mga0qj67_17387_c1 3300050509 Bacteria 5467
627 nmdc:mga0qj67_21914_c1 3300050509 Bacteria 4903
628 nmdc:mga0qj67_64188_c1 3300050509 Bacteria 2921
629 nmdc:mga0qj67_73412_c1 3300050509 Bacteria 2732
630 nmdc:mga06r32_107813_c1 3300050510 Bacteria 2738
631 nmdc:mga06r32_122655_c1 3300050510 Bacteria 2564
632 nmdc:mga06r32_1371_c1 3300050510 Bacteria 22011
633 nmdc:mga06r32_16054_c1 3300050510 Bacteria 6818
634 nmdc:mga06r32_198780_c1 3300050510 Bacteria 1992
635 nmdc:mga06r32_21420_c1 3300050510 Bacteria 5967
636 nmdc:mga06r32_236507_c1 3300050510 Bacteria 1814
637 nmdc:mga06r32_242489_c1 3300050510 Bacteria 1790
638 nmdc:mga06r32_267983_c1 3300050510 Bacteria 1695
639 nmdc:mga06r32_355766_c1 3300050510 Bacteria 1449
640 nmdc:mga06r32_41521_c1 3300050510 Bacteria 4371
641 nmdc:mga06r32_596864_c1 3300050510 Bacteria 1075
642 nmdc:mga06r32_61667_c1 3300050510 Bacteria 3611
643 nmdc:mga06r32_6203_c1 3300050510 Bacteria 10730
644 nmdc:mga06r32_6946_c1 3300050510 Bacteria 10179
645 nmdc:mga06r32_804351_c1 3300050510 Bacteria 901
646 nmdc:mga06r32_9656_c1 3300050510 Bacteria 8715
647 nmdc:mga08y16_23104_c1 3300050511 Bacteria 6566
648 nmdc:mga08y16_25189_c1 3300050511 Bacteria 6274
649 nmdc:mga08y16_3546_c1 3300050511 Bacteria 16204
650 nmdc:mga08y16_55504_c1 3300050511 Bacteria 4139
651 nmdc:mga0n895_121261_c1 3300050512 Bacteria 2636
652 nmdc:mga0n895_131197_c1 3300050512 Bacteria 2531
653 nmdc:mga0n895_131592_c1 3300050512 Bacteria 2527
654 nmdc:mga0n895_139622_c1 3300050512 Bacteria 2451
655 nmdc:mga0n895_14192_c1 3300050512 Bacteria 7225
656 nmdc:mga0n895_157361_c1 3300050512 Bacteria 2303
657 nmdc:mga0n895_16871_c1 3300050512 Bacteria 6713
658 nmdc:mga0n895_195525_c1 3300050512 Bacteria 2054
659 nmdc:mga0n895_207264_c1 3300050512 Bacteria 1991
660 nmdc:mga0n895_21835_c1 3300050512 Bacteria 5993
661 nmdc:mga0n895_244396_c1 3300050512 Bacteria 1822
662 nmdc:mga0n895_62703_c1 3300050512 Bacteria 3675
663 nmdc:mga0n895_70143_c1 3300050512 Bacteria 3474
664 nmdc:mga0rr50_11613_c1 3300050513 Bacteria 5650
665 nmdc:mga0rr50_157691_c1 3300050513 Bacteria 1840
666 nmdc:mga0rr50_3042_c1 3300050513 Bacteria 9593
667 nmdc:mga0rr50_373492_c1 3300050513 Bacteria 1202
668 nmdc:mga0rr50_439667_c1 3300050513 Bacteria 1105
669 nmdc:mga0rr50_48447_c1 3300050513 Bacteria 3141
670 nmdc:mga0rr50_86408_c1 3300050513 Bacteria 2433
671 nmdc:mga08x19_144401_c1 3300050514 Bacteria 1609
672 nmdc:mga08x19_152049_c1 3300050514 Bacteria 1568
673 nmdc:mga08x19_169489_c1 3300050514 Bacteria 1487
674 nmdc:mga08x19_25549_c1 3300050514 Bacteria 3680
675 nmdc:mga08x19_96853_c1 3300050514 Bacteria 1953
676 nmdc:mga0a205_110247_c1 3300050515 Bacteria 2651
677 nmdc:mga0a205_13406_c2 3300050515 Bacteria 6650
678 nmdc:mga0a205_138159_c2 3300050515 Bacteria 1953
679 nmdc:mga0a205_1411_c1 3300050515 Bacteria 2738
680 nmdc:mga0a205_163149_c1 3300050515 Bacteria 2124
681 nmdc:mga0a205_1638_c1 3300050515 Bacteria 19222
682 nmdc:mga0a205_20069_c1 3300050515 Bacteria 6305
683 nmdc:mga0a205_223510_c1 3300050515 Bacteria 1768
684 nmdc:mga0a205_2344_c1 3300050515 Bacteria 16708
685 nmdc:mga0a205_263276_c1 3300050515 Bacteria 1602
686 nmdc:mga0a205_330042_c1 3300050515 Bacteria 1395
687 nmdc:mga0a205_33946_c1 3300050515 Bacteria 4894
688 nmdc:mga0a205_44204_c1 3300050515 Bacteria 4293
689 nmdc:mga0a205_51127_c1 3300050515 Bacteria 3989
690 nmdc:mga0a205_5113_c1 3300050515 Bacteria 11797
691 nmdc:mga0a205_60690_c1 3300050515 Bacteria 3652
692 nmdc:mga0a205_67120_c1 3300050515 Bacteria 3465
693 nmdc:mga0a205_70503_c1 3300050515 Bacteria 3375
694 Ga0501084_0002275 3300054114 Bacteria 15423
695 Ga0501084_0002669 3300054114 Bacteria 14353
696 Ga0501084_0022246 3300054114 Bacteria 5290
697 Ga0501084_0022805 3300054114 Bacteria 5225
698 Ga0501084_0026940 3300054114 Bacteria 4802
699 Ga0501084_0033667 3300054114 Bacteria 4286
700 Ga0501084_0041036 3300054114 Bacteria 3871
701 Ga0501084_0050736 3300054114 Bacteria 3471
702 Ga0501084_0110450 3300054114 Bacteria 2310
703 Ga0501084_0172975 3300054114 Bacteria 1823
704 Ga0501084_0188833 3300054114 Bacteria 1739
705 Ga0501084_0238473 3300054114 Bacteria 1535
706 Ga0501084_0399996 3300054114 Bacteria 1161
707 Ga0590077_006836 3300059426 Bacteria 2336
708 Ga0501082_0000359 3300060353 Bacteria 40225
709 Ga0501082_0003230 3300060353 Bacteria 14208
710 Ga0501082_0004839 3300060353 Bacteria 11743
711 Ga0501082_0015728 3300060353 Bacteria 6509
712 Ga0501082_0018065 3300060353 Bacteria 6073
713 Ga0501082_0023160 3300060353 Bacteria 5356
714 Ga0501082_0143637 3300060353 Bacteria 2071
715 Ga0501082_0185335 3300060353 Bacteria 1811
716 Ga0501082_0347346 3300060353 Bacteria 1293
717 Ga0501082_0372848 3300060353 Bacteria 1245
718 Ga0530510_0000019 3300061734 Bacteria 80152
719 Ga0530510_0019897 3300061734 Bacteria 4770
720 Ga0530510_0029773 3300061734 Bacteria 3920
721 Ga0530510_0055781 3300061734 Unclassified 2854
722 Ga0530510_0086393 3300061734 Bacteria 2285
723 Ga0530510_0087220 3300061734 Bacteria 2274
724 Ga0530510_0107654 3300061734 Bacteria 2040
725 Ga0530510_0254121 3300061734 Bacteria 1310
726 Ga0530510_0321785 3300061734 Bacteria 1159
727 Ga0070697_100179454
728 JGI25406J46586_10004577
729 JGI26141J51220_1000456
730 Ga0065715_10105909
731 Ga0070676_10000535
732 Ga0070676_10077769
733 Ga0070690_100062409
734 Ga0068869_100000489
735 Ga0068869_100000597
736 Ga0068869_100103693
737 Ga0070680_100013001
738 Ga0070680_100016161
739 Ga0070660_100000553
740 Ga0070689_100139354
741 Ga0070691_10018339
742 Ga0070691_10021720
743 Ga0070687_100003708
744 Ga0070661_100006387
745 Ga0070692_10004718
746 Ga0070669_100078431
747 Ga0070669_100199949
748 Ga0070675_100480972
749 Ga0070673_100028458
750 Ga0070688_100145586
751 Ga0070688_100321056
752 Ga0070659_100000361
753 Ga0070703_10001080
754 Ga0070703_10003999
755 Ga0070710_10123324
756 Ga0070701_10024534
757 Ga0070701_10026849
758 Ga0070701_10163095
759 Ga0070711_100011243
760 Ga0070705_100000749
761 Ga0070705_100003784
762 Ga0070705_100292527
763 Ga0070700_100036353
764 Ga0070694_100000075
765 Ga0070694_100001685
766 Ga0070694_100023886
767 Ga0070694_100038420
768 Ga0070708_100004744
769 Ga0070708_100008247
770 Ga0070708_100013614
771 Ga0070708_100018405
772 Ga0070708_100026016
773 Ga0070708_100099736
774 Ga0070708_100135642
775 Ga0070708_100176316
776 Ga0070708_100221066
777 Ga0070708_100377623
778 Ga0070663_100009039
779 Ga0070662_100001124
780 Ga0070681_10029620
781 Ga0070706_100002460
782 Ga0070706_100004339
783 Ga0070706_100016657
784 Ga0070706_100018217
785 Ga0070706_100087543
786 Ga0070706_100157130
787 Ga0070706_100165443
788 Ga0070706_100165941
789 Ga0070707_100002048
790 Ga0070707_100003191
791 Ga0070707_100013670
792 Ga0070707_100015860
793 Ga0070707_100022793
794 Ga0070707_100085762
795 Ga0070707_100086238
796 Ga0070707_100509834
797 Ga0070698_100002641
798 Ga0070698_100007501
799 Ga0070698_100008603
800 Ga0070698_100029304
801 Ga0070698_100143768
802 Ga0070698_100540248
803 Ga0070699_100004395
804 Ga0070699_100015190
805 Ga0070699_100035843
806 Ga0070699_100052370
807 Ga0070699_100093064
808 Ga0070699_100129926
809 Ga0070699_100550865
810 Ga0070679_100035088
811 Ga0070684_100085838
812 Ga0070697_100006259
813 Ga0070697_100026663
814 Ga0070697_100037921
815 Ga0070697_100048971
816 Ga0070697_100060093
817 Ga0070697_100076260
818 Ga0070697_100102328
819 Ga0068853_100004643
820 Ga0070672_100182341
821 Ga0070695_100000644
822 Ga0070695_100000681
823 Ga0070695_100001082
824 Ga0070695_100001864
825 Ga0070695_100004551
826 Ga0070695_100013140
827 Ga0070695_100379100
828 Ga0070696_100029706
829 Ga0070696_100089950
830 Ga0070696_100134978
831 Ga0070693_100095718
832 Ga0070704_100006488
833 Ga0070704_100176623
834 Ga0068855_100001782
835 Ga0070664_100020894
836 Ga0068857_100017712
837 Ga0068857_100434856
838 Ga0068854_100016893
839 Ga0068856_100012429
840 Ga0070702_100059797
841 Ga0068859_100000846
842 Ga0068859_100209678
843 Ga0068859_100625946
844 Ga0068864_100123840
845 Ga0068866_10169651
846 Ga0068870_10001449
847 Ga0068863_100017318
848 Ga0068863_100054432
849 Ga0068858_100091955
850 Ga0068860_100050069
851 Ga0068860_100096645
852 Ga0068860_100136915
853 Ga0068860_100417697
854 Ga0068862_100038217
855 Ga0068862_100091491
856 Ga0068862_100262484
857 Ga0081455_10000907
858 Ga0081538_10002972
859 Ga0081538_10015138
860 Ga0081539_10001199
861 Ga0070716_100009726
862 Ga0070716_100336144
863 Ga0070712_100003855
864 Ga0075428_100000270
865 Ga0075428_100000620
866 Ga0075428_100002673
867 Ga0075428_100019634
868 Ga0075428_100103747
869 Ga0075428_100147819
870 Ga0075428_100156253
871 Ga0075428_100263498
872 Ga0075428_100264984
873 Ga0075428_100412433
874 Ga0075430_100001096
875 Ga0075430_100001761
876 Ga0075430_100003622
877 Ga0075430_100005337
878 Ga0075430_100023833
879 Ga0075430_100039631
880 Ga0075430_100088592
881 Ga0075430_100247727
882 Ga0075431_100000248
883 Ga0075431_100001908
884 Ga0075431_100002113
885 Ga0075431_100002354
886 Ga0075431_100002858
887 Ga0075431_100012781
888 Ga0075431_100014665
889 Ga0075431_100019736
890 Ga0075431_100059646
891 Ga0075431_100062175
892 Ga0075431_100099795
893 Ga0075431_100303364
894 Ga0075431_100310521
895 Ga0075431_100349356
896 Ga0075431_100349476
897 Ga0075433_10001347
898 Ga0075433_10011277
899 Ga0075433_10011708
900 Ga0075433_10017376
901 Ga0075433_10021514
902 Ga0075433_10021592
903 Ga0075433_10028313
904 Ga0075433_10064496
905 Ga0075433_10090777
906 Ga0075433_10150849
907 Ga0075433_10197431
908 Ga0075433_10203183
909 Ga0075433_10258235
910 Ga0075433_10362828
911 Ga0075434_100014308
912 Ga0075434_100014384
913 Ga0075434_100040047
914 Ga0075434_100041564
915 Ga0075434_100052179
916 Ga0075434_100062056
917 Ga0075434_100071694
918 Ga0075434_100083579
919 Ga0075434_100084525
920 Ga0075434_100086632
921 Ga0075434_100108419
922 Ga0075434_100167997
923 Ga0075434_100205671
924 Ga0075434_100319293
925 Ga0075429_100000213
926 Ga0075429_100001899
927 Ga0075429_100008433
928 Ga0075429_100009355
929 Ga0075429_100015114
930 Ga0075429_100023861
931 Ga0075429_100026046
932 Ga0075429_100038151
933 Ga0075429_100183328
934 Ga0075429_100290771
935 Ga0075429_100315216
936 Ga0068865_100287613
937 Ga0075436_100039538
938 Ga0075436_100194810
939 Ga0097620_100000846
940 Ga0097620_100209669
941 Ga0097620_100625974
942 Ga0075435_100005157
943 Ga0075435_100009059
944 Ga0075435_100017643
945 Ga0075435_100022613
946 Ga0075435_100036511
947 Ga0075435_100044770
948 Ga0075435_100073273
949 Ga0075435_100426531
950 Ga0099794_10001369
951 Ga0099794_10011061
952 Ga0099794_10019761
953 Ga0111539_10000318
954 Ga0111539_10002886
955 Ga0111539_10016499
956 Ga0111539_10021399
957 Ga0111539_10488923
958 Ga0105245_10342349
959 Ga0105245_10422561
960 Ga0105247_10033843
961 Ga0114129_10003766
962 Ga0114129_10004848
963 Ga0114129_10005728
964 Ga0114129_10007755
965 Ga0114129_10009065
966 Ga0114129_10014976
967 Ga0114129_10020971
968 Ga0114129_10025266
969 Ga0114129_10034198
970 Ga0114129_10052390
971 Ga0114129_10066726
972 Ga0114129_10071080
973 Ga0114129_10075363
974 Ga0114129_10161288
975 Ga0114129_10165902
976 Ga0114129_10242302
977 Ga0114129_10335672
978 Ga0114129_10420353
979 Ga0114129_10654529
980 Ga0105243_10015781
981 Ga0105243_10142187
982 Ga0105241_10320642
983 Ga0105241_10359203
984 Ga0105242_10002142
985 Ga0105248_10070173
986 Ga0105248_10338404
987 Ga0105249_10022716
988 Ga0105249_10088965
989 Ga0105249_10269066
990 Ga0105239_10073951
991 Ga0157373_10000895
992 Ga0157369_10013504
993 Ga0157378_10054340
994 Ga0163162_10783077
995 Ga0157372_10003412
996 Ga0157372_10030680
997 Ga0157375_10010732
998 Ga0157375_10110089
999 Ga0157380_10412698
1000 Ga0157380_10803364
1001 Ga0157379_10704446
1002 Ga0206353_11590816
1003 Ga0207653_10002440
1004 Ga0207653_10007828
1005 Ga0207653_10085294
1006 Ga0207710_10073718
1007 Ga0207688_10029098
1008 Ga0207647_10038530
1009 Ga0207699_10175172
1010 Ga0207645_10000406
1011 Ga0207645_10079862
1012 Ga0207643_10003335
1013 Ga0207643_10026294
1014 Ga0207684_10000508
1015 Ga0207684_10010763
1016 Ga0207684_10025957
1017 Ga0207684_10029580
1018 Ga0207684_10034142
1019 Ga0207684_10132462
1020 Ga0207684_10324781
1021 Ga0207684_10443324
1022 Ga0207654_10001734
1023 Ga0207707_10000171
1024 Ga0207693_10072757
1025 Ga0207660_10000651
1026 Ga0207660_10072760
1027 Ga0207662_10007469
1028 Ga0207657_10000085
1029 Ga0207649_10010784
1030 Ga0207652_10000264
1031 Ga0207646_10002657
1032 Ga0207646_10007022
1033 Ga0207646_10016912
1034 Ga0207646_10020059
1035 Ga0207646_10021109
1036 Ga0207646_10066377
1037 Ga0207646_10117708
1038 Ga0207646_10213264
1039 Ga0207646_10218319
1040 Ga0207646_10220066
1041 Ga0207646_10240720
1042 Ga0207646_10290133
1043 Ga0207646_10366705
1044 Ga0207681_10024979
1045 Ga0207681_10080399
1046 Ga0207681_10293466
1047 Ga0207659_10216667
1048 Ga0207690_10004576
1049 Ga0207706_10003246
1050 Ga0207706_10024855
1051 Ga0207706_10202265
1052 Ga0207686_10009765
1053 Ga0207709_10004861
1054 Ga0207709_10039737
1055 Ga0207709_10109605
1056 Ga0207665_10002655
1057 Ga0207691_10010502
1058 Ga0207711_10112482
1059 Ga0207689_10000579
1060 Ga0207689_10004704
1061 Ga0207689_10049449
1062 Ga0207679_10000724
1063 Ga0207667_10013787
1064 Ga0207712_10019754
1065 Ga0207712_10061806
1066 Ga0207668_10252549
1067 Ga0207640_10003974
1068 Ga0207703_10129504
1069 Ga0207703_10359059
1070 Ga0207678_10000868
1071 Ga0207708_10050148
1072 Ga0207702_10005061
1073 Ga0207641_10046084
1074 Ga0207641_10402960
1075 Ga0207641_10414902
1076 Ga0207648_10126288
1077 Ga0207648_10261967
1078 Ga0207648_10349906
1079 Ga0207676_10205667
1080 Ga0207674_10001185
1081 Ga0207675_100003318
1082 Ga0207675_100066957
1083 Ga0207675_100069402
1084 Ga0207675_100101026
1085 Ga0207675_100434499
1086 Ga0209969_1001814
1087 Ga0209969_1011477
1088 Ga0209967_1002244
1089 Ga0209996_1001038
1090 Ga0210000_1004236
1091 Ga0209995_1003377
1092 Ga0209968_1000978
1093 Ga0209968_1001678
1094 Ga0209999_1000729
1095 Ga0209982_1002773
1096 Ga0210002_1000759
1097 Ga0210002_1001006
1098 Ga0209983_1000857
1099 Ga0209588_1007645
1100 Ga0209971_1000033
1101 Ga0209971_1000104
1102 Ga0209966_1000123
1103 Ga0209966_1000135
1104 Ga0209998_10000003
1105 Ga0209998_10000162
1106 Ga0209974_10001334
1107 Ga0209974_10005872
1108 Ga0207428_10000399
1109 Ga0207428_10000489
1110 Ga0207428_10010665
1111 Ga0268265_10063544
1112 Ga0268265_10127518
1113 Ga0268265_10175592
1114 Ga0268264_10111376
1115 Ga0268264_10150463
1116 Ga0268264_10210263
1117 Ga0268264_10416344
1118 Ga0307408_100005830
1119 Ga0307408_100110310
1120 Ga0307408_100135278
1121 Ga0307410_10362763
1122 Ga0307406_10026462
1123 Ga0307406_10041212
1124 Ga0307407_10189670
1125 Ga0307409_100401814
1126 Ga0307416_100041858
1127 Ga0307416_100291534
1128 Ga0307416_100586406
1129 Ga0307411_10013147
1130 Ga0307411_10203885
1131 Ga0373930_0022472
1132 Ga0373948_0032683
1133 Ga0373959_0017205
1134 Ga0373940_0004910
1135 Ga0373940_0014528
1136 Ga0373949_0024770
1137 Ga0373951_0007840
1138 Ga0373932_0034165
1139 Ga0373939_0081905
1140 Ga0373962_0014308
1141 Ga0373931_0003748
1142 Ga0373931_0008181
1143 Ga0373931_0087287
1144 Ga0373931_0098836
1145 Ga0395899_0013627
1146 Ga0395900_0007319
1147 Ga0395898_0002760
1148 Ga0395901_0004796
1149 Ga0439448_0034342
1150 Ga0439450_009183
1151 Ga0439450_035717
1152 Ga0439455_0013530
1153 Ga0439464_0001275
1154 Ga0439464_0016950
1155 Ga0439460_0000679
1156 Ga0439460_0001183
1157 Ga0439460_0008908
1158 Ga0451577_0002998
1159 Ga0451577_0022851
1160 Ga0451577_0051032
1161 Ga0451577_0225250
1162 Ga0451577_0462253
1163 Ga0453683_0002797
1164 Ga0453683_0072537
1165 Ga0453684_0029631
1166 Ga0453684_0062219
1167 Ga0453684_0296254
1168 Ga0451576_0008317
1169 Ga0451576_0009532
1170 Ga0451576_0012415
1171 Ga0451576_0052512
1172 Ga0451576_0071563
1173 Ga0451576_0072286
1174 Ga0451576_0142892
1175 Ga0451576_0157253
1176 Ga0451576_0164562
1177 Ga0451576_0454709
1178 Ga0495594_0081398
1179 Ga0495642_0085332
1180 Ga0495659_0051612
1181 Ga0495659_0128966
1182 Ga0495588_0064527
1183 Ga0495669_0013283
1184 Ga0495670_0039432
1185 Ga0496102_0005073
1186 Ga0496102_0240144
1187 Ga0496103_0030039
1188 Ga0496104_0212967
1189 Ga0496106_0160955
1190 Ga0496106_0422691
1191 Ga0496109_0102379
1192 Ga0501031_0145713
1193 Ga0501031_0334544
1194 Ga0501033_0014928
1195 Ga0501033_0091283
1196 Ga0501036_0004351
1197 Ga0501036_0066752
1198 Ga0501036_0104423
1199 Ga0501036_0370930
1200 Ga0501037_0079815
1201 Ga0501037_0294871
1202 Ga0501037_0329119
1203 Ga0501038_0050772
1204 Ga0501038_0072956
1205 Ga0501039_0002929
1206 Ga0501039_0021336
1207 Ga0501039_0027807
1208 Ga0501039_0033550
1209 Ga0501039_0088686
1210 Ga0501039_0298221
1211 Ga0501040_0000791
1212 Ga0501040_0005567
1213 Ga0501040_0016654
1214 Ga0501040_0043751
1215 Ga0501040_0054320
1216 Ga0501040_0088141
1217 Ga0501040_0178018
1218 Ga0501041_0028298
1219 Ga0501041_0041934
1220 Ga0501041_0086656
1221 Ga0501041_0292622
1222 Ga0501042_0001561
1223 Ga0501042_0006686
1224 Ga0501042_0013234
1225 Ga0501042_0398179
1226 Ga0501046_0004532
1227 Ga0501046_0019559
1228 Ga0501046_0035757
1229 Ga0501046_0043794
1230 Ga0501046_0069222
1231 Ga0501046_0297294
1232 Ga0501047_0110257
1233 Ga0501048_0009386
1234 Ga0501048_0011675
1235 Ga0501048_0021286
1236 Ga0501048_0078058
1237 Ga0501048_0123908
1238 Ga0501048_0160089
1239 Ga0501048_0306675
1240 Ga0501067_0027891
1241 Ga0501068_0056743
1242 Ga0501068_0294180
1243 Ga0501071_0026960
1244 Ga0501071_0037030
1245 Ga0501071_0116368
1246 Ga0501071_0258373
1247 Ga0501072_0020224
1248 Ga0501072_0021656
1249 Ga0501072_0023696
1250 Ga0501072_0032129
1251 Ga0501072_0070982
1252 Ga0501072_0105398
1253 Ga0501072_0147940
1254 Ga0501072_0259121
1255 Ga0501073_0170640
1256 Ga0501074_0000711
1257 Ga0501074_0019135
1258 Ga0501074_0082996
1259 Ga0501074_0084839
1260 Ga0501074_0112711
1261 Ga0501074_0140251
1262 Ga0501074_0198729
1263 Ga0501074_0352110
1264 Ga0501075_0000027
1265 Ga0501075_0004995
1266 Ga0501075_0014848
1267 Ga0501075_0015798
1268 Ga0501075_0023466
1269 Ga0501075_0025958
1270 Ga0501075_0075705
1271 Ga0501075_0088006
1272 Ga0501075_0102423
1273 Ga0501075_0208089
1274 Ga0501075_0297292
1275 Ga0501075_0395811
1276 Ga0501075_0424920
1277 Ga0501076_0000052
1278 Ga0501076_0024864
1279 Ga0501076_0063537
1280 Ga0501076_0070817
1281 Ga0501076_0122325
1282 Ga0501076_0129380
1283 Ga0501076_0156415
1284 Ga0501077_0003091
1285 Ga0501077_0046957
1286 Ga0501077_0096158
1287 Ga0501077_0205165
1288 Ga0501077_0257495
1289 Ga0501079_0004312
1290 Ga0501079_0004631
1291 Ga0501079_0014988
1292 Ga0501079_0018415
1293 Ga0501079_0213563
1294 Ga0501079_0215313
1295 Ga0501079_0228101
1296 Ga0501079_0243005
1297 Ga0501079_0267115
1298 Ga0501080_0023986
1299 Ga0501080_0133840
1300 Ga0501080_0231891
1301 Ga0501080_0272479
1302 Ga0501080_0588580
1303 Ga0501081_0001007
1304 Ga0501081_0002009
1305 Ga0501081_0018078
1306 Ga0501081_0034237
1307 Ga0501081_0036973
1308 Ga0501081_0045381
1309 Ga0501081_0053894
1310 Ga0501081_0077514
1311 Ga0501081_0168833
1312 Ga0501081_0170720
1313 Ga0501083_0003406
1314 Ga0501083_0019182
1315 Ga0501035_0261230
1316 Ga0501045_0000228
1317 Ga0501045_0003224
1318 Ga0501045_0008341
1319 Ga0501045_0040410
1320 Ga0501045_0176438
1321 Ga0501045_0198612
1322 nmdc:mga05p37_10235_c1
1323 nmdc:mga05p37_11137_c1
1324 nmdc:mga05p37_115994_c1
1325 nmdc:mga05p37_12117_c1
1326 nmdc:mga05p37_14068_c1
1327 nmdc:mga05p37_143010_c1
1328 nmdc:mga05p37_157398_c1
1329 nmdc:mga05p37_1693_c1
1330 nmdc:mga05p37_202657_c1
1331 nmdc:mga05p37_3059_c2
1332 nmdc:mga05p37_33107_c1
1333 nmdc:mga05p37_40455_c1
1334 nmdc:mga05p37_41682_c1
1335 nmdc:mga05p37_520489_c1
1336 nmdc:mga05p37_53373_c1
1337 nmdc:mga05p37_537133_c1
1338 nmdc:mga05p37_640647_c1
1339 nmdc:mga05p37_71716_c1
1340 nmdc:mga05p37_7425_c1
1341 nmdc:mga05p37_979033_c1
1342 nmdc:mga09592_13829_c1
1343 nmdc:mga09592_15605_c1
1344 nmdc:mga09592_23437_c1
1345 nmdc:mga09592_3361_c1
1346 nmdc:mga09592_487577_c1
1347 nmdc:mga09592_84669_c1
1348 nmdc:mga09592_99_c1
1349 nmdc:mga0qj67_127_c1
1350 nmdc:mga0qj67_1295_c1
1351 nmdc:mga0qj67_147198_c1
1352 nmdc:mga0qj67_17387_c1
1353 nmdc:mga0qj67_21914_c1
1354 nmdc:mga0qj67_64188_c1
1355 nmdc:mga0qj67_73412_c1
1356 nmdc:mga06r32_107813_c1
1357 nmdc:mga06r32_122655_c1
1358 nmdc:mga06r32_1371_c1
1359 nmdc:mga06r32_16054_c1
1360 nmdc:mga06r32_198780_c1
1361 nmdc:mga06r32_21420_c1
1362 nmdc:mga06r32_236507_c1
1363 nmdc:mga06r32_242489_c1
1364 nmdc:mga06r32_267983_c1
1365 nmdc:mga06r32_355766_c1
1366 nmdc:mga06r32_41521_c1
1367 nmdc:mga06r32_596864_c1
1368 nmdc:mga06r32_61667_c1
1369 nmdc:mga06r32_6203_c1
1370 nmdc:mga06r32_6946_c1
1371 nmdc:mga06r32_804351_c1
1372 nmdc:mga06r32_9656_c1
1373 nmdc:mga08y16_23104_c1
1374 nmdc:mga08y16_25189_c1
1375 nmdc:mga08y16_3546_c1
1376 nmdc:mga08y16_55504_c1
1377 nmdc:mga0n895_121261_c1
1378 nmdc:mga0n895_131197_c1
1379 nmdc:mga0n895_131592_c1
1380 nmdc:mga0n895_139622_c1
1381 nmdc:mga0n895_14192_c1
1382 nmdc:mga0n895_157361_c1
1383 nmdc:mga0n895_16871_c1
1384 nmdc:mga0n895_195525_c1
1385 nmdc:mga0n895_207264_c1
1386 nmdc:mga0n895_21835_c1
1387 nmdc:mga0n895_244396_c1
1388 nmdc:mga0n895_62703_c1
1389 nmdc:mga0n895_70143_c1
1390 nmdc:mga0rr50_11613_c1
1391 nmdc:mga0rr50_157691_c1
1392 nmdc:mga0rr50_3042_c1
1393 nmdc:mga0rr50_373492_c1
1394 nmdc:mga0rr50_439667_c1
1395 nmdc:mga0rr50_48447_c1
1396 nmdc:mga0rr50_86408_c1
1397 nmdc:mga08x19_144401_c1
1398 nmdc:mga08x19_152049_c1
1399 nmdc:mga08x19_169489_c1
1400 nmdc:mga08x19_25549_c1
1401 nmdc:mga08x19_96853_c1
1402 nmdc:mga0a205_110247_c1
1403 nmdc:mga0a205_13406_c2
1404 nmdc:mga0a205_138159_c2
1405 nmdc:mga0a205_1411_c1
1406 nmdc:mga0a205_163149_c1
1407 nmdc:mga0a205_1638_c1
1408 nmdc:mga0a205_20069_c1
1409 nmdc:mga0a205_223510_c1
1410 nmdc:mga0a205_2344_c1
1411 nmdc:mga0a205_263276_c1
1412 nmdc:mga0a205_330042_c1
1413 nmdc:mga0a205_33946_c1
1414 nmdc:mga0a205_44204_c1
1415 nmdc:mga0a205_51127_c1
1416 nmdc:mga0a205_5113_c1
1417 nmdc:mga0a205_60690_c1
1418 nmdc:mga0a205_67120_c1
1419 nmdc:mga0a205_70503_c1
1420 Ga0501084_0002275
1421 Ga0501084_0002669
1422 Ga0501084_0022246
1423 Ga0501084_0022805
1424 Ga0501084_0026940
1425 Ga0501084_0033667
1426 Ga0501084_0041036
1427 Ga0501084_0050736
1428 Ga0501084_0110450
1429 Ga0501084_0172975
1430 Ga0501084_0188833
1431 Ga0501084_0238473
1432 Ga0501084_0399996
1433 Ga0590077_006836
1434 Ga0501082_0000359
1435 Ga0501082_0003230
1436 Ga0501082_0004839
1437 Ga0501082_0015728
1438 Ga0501082_0018065
1439 Ga0501082_0023160
1440 Ga0501082_0143637
1441 Ga0501082_0185335
1442 Ga0501082_0347346
1443 Ga0501082_0372848
1444 Ga0530510_0000019
1445 Ga0530510_0019897
1446 Ga0530510_0029773
1447 Ga0530510_0055781
1448 Ga0530510_0086393
1449 Ga0530510_0087220
1450 Ga0530510_0107654
1451 Ga0530510_0254121
1452 Ga0530510_0321785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

95

269

0.96

Map