F477583

General Info

Members Datasets Scaffolds Average Seq Length
724 512 428 344

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0100772|Ga0501034_0100772_1568_2704
Length 378
Sequence MAAAGPGFPGPAFLSIGLPTSTAALRPAEQPGARMTADVSYRPAGGPPVRSGRVGVLLVNLGTPDGTDYASVRRYLGEFLSDRRVIEEPRWKWYPILFGIVLNTRPRKVGRAYETIWNRERNESFLRTYTRNQSERMAERLKDLPDVQVDWAMRYGTPSIAARIAALKEAGCDRILVFPLYPQYAAATTATVNDVAFQTLLKMRWQPALRTVPDYHADETYIDALASSVTRHLSTLDWEPEMLLASFHGIPVSYSEKGDPYYRQCQETGRLLRERLGLPEDRFMVTFQSRFGPEEWLQPYTDKTVEKLAQEGVKRIAVINPGFVSDCLETLEEIAEQAAHSFRHNGGEKFTHVPCLNDGEDGMRVLEKVVRRELMGWV

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
18 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
19 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
20 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
21 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
22 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
23 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
24 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
25 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
26 2519899620 Rhizobium sp. Pop5 Isolate Nodule
27 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
28 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
29 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
30 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
31 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
32 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
33 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
37 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
38 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
39 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
40 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
41 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
42 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
43 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
44 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
45 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
46 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
51 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
52 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
53 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
54 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
55 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
56 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
57 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
58 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
59 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
60 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
63 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
64 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
65 2643221558 Rhizobium sp. Root149 Isolate Unclassified
66 2643221568 Rhizobium sp. Root564 Isolate Unclassified
67 2643221582 Rhizobium sp. Root651 Isolate Unclassified
68 2643221599 Rhizobium sp. Root708 Isolate Unclassified
69 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
70 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
71 2643221693 Rhizobium sp. Root491 Isolate Unclassified
72 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
73 2718217882 Rhizobium sp. N741 Isolate Nodule
74 2718217927 Rhizobium sp. N324 Isolate Nodule
75 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
76 2718218009 Rhizobium sp. N561 Isolate Nodule
77 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
78 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
79 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
80 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
81 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
82 2718218363 Rhizobium sp. N113 Isolate Nodule
83 2718218365 Rhizobium sp. N731 Isolate Nodule
84 2718218366 Rhizobium sp. N621 Isolate Nodule
85 2718218423 Rhizobium sp. N941 Isolate Nodule
86 2721755514 Rhizobium sp. N6212 Isolate Nodule
87 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
88 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
89 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
90 2721755809 Rhizobium sp. N541 Isolate Nodule
91 2721755810 Rhizobium sp. N871 Isolate Nodule
92 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
93 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
94 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
95 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
96 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
97 2728369365 Rhizobium sp. N1341 Isolate Nodule
98 2728369397 Rhizobium sp. N1314 Isolate Nodule
99 2738541293 Rhizobium sp. GV031 Isolate Unclassified
100 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
101 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
102 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
103 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
104 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
105 2791355256 Rhizobium sp. M10 Isolate Nodule
106 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
107 2791355260 Rhizobium sp. L9 Isolate Nodule
108 2791355261 Rhizobium sp. J15 Isolate Nodule
109 2791355262 Rhizobium sp. M1 Isolate Nodule
110 2791355263 Rhizobium chutanense C5 Isolate Nodule
111 2791355264 Rhizobium sp. S9 Isolate Nodule
112 2791355265 Rhizobium sp. H4 Isolate Nodule
113 2791355266 Rhizobium sp. L43 Isolate Nodule
114 2791355267 Rhizobium sp. L18 Isolate Nodule
115 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
116 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
117 2802429633 Rhizobium anhuiense J3 Isolate Nodule
118 2802429634 Rhizobium anhuiense S10 Isolate Nodule
119 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
120 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
121 2802429637 Rhizobium anhuiense C15 Isolate Nodule
122 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
123 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
124 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
125 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
126 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
127 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
128 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
129 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
130 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
131 2838048938 Rhizobium pisi 27/80 Isolate Nodule
132 2838061910 Rhizobium phaseoli L15 Isolate Nodule
133 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
134 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
135 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
136 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
137 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
138 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
139 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
140 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
141 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
142 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
143 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
144 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
145 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
146 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
147 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
148 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
149 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
150 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
151 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
152 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
153 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
154 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
155 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
156 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
157 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
158 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
159 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
160 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
161 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
162 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
163 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
164 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
165 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
166 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
167 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
168 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
169 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
170 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
171 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
172 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
173 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
174 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
175 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
176 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
177 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
178 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
179 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
180 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
181 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
182 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
183 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
184 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
185 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
186 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
187 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
188 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
189 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
190 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
191 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
192 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
193 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
194 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
195 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
196 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
197 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
198 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
199 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
200 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
201 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
202 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
203 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
204 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
205 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
206 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
207 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
208 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
209 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
210 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
211 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
212 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
213 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
214 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
215 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
216 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
217 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
218 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
219 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
220 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
221 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
222 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
223 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
224 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
225 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
226 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
227 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
228 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
229 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
230 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
231 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
232 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
233 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
234 2933599457 Rhizobium phaseoli M3 Isolate Nodule
235 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
236 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
237 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
238 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
239 2936381700 Rhizobium chutanense C16 Isolate Unclassified
240 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
241 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
242 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
243 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
244 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
245 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
246 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
247 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
248 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
249 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
250 2996887358 Rhizobium sp. R711 Isolate Nodule
251 2996893221 Rhizobium sp. R635 Isolate Nodule
252 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
253 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
254 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
255 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
256 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
257 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
258 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
259 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
260 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
261 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
262 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
263 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
264 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
265 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
266 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
267 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
268 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
269 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
270 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
271 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
272 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
273 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
274 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
275 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
276 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
277 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
278 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
279 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
280 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
281 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
282 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
283 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
284 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
285 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
286 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
287 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
288 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
289 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
290 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
291 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
292 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
293 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
294 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
295 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
296 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
297 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
298 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
299 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
300 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
301 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
302 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
303 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
304 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
305 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
306 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
307 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
308 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
309 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
310 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
313 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
314 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
315 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
316 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
317 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
318 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
319 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
320 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
321 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
322 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
323 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
324 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
325 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
326 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
328 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
329 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
330 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
331 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
332 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
334 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
335 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
336 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
337 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
338 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
339 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
341 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
343 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
345 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
346 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
368 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
369 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
372 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
373 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
376 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
377 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
378 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
379 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
380 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
381 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
382 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
383 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
384 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
385 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
386 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
387 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
388 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
389 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
390 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
391 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
392 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
393 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
394 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
395 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
396 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
397 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
398 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
399 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
400 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
403 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
404 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
405 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
406 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
407 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
408 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
412 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
413 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
414 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
415 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
416 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
417 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
424 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
425 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
426 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
427 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
428 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
429 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
430 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
431 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
432 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
433 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
434 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
435 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
449 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
450 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
451 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
454 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
455 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
456 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
457 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
458 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
459 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
460 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
461 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
462 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
463 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
464 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
465 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
466 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
467 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
468 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
469 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
470 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
471 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
473 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
474 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
475 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
476 8005258706 Rhizobium sp. R693 Isolate Nodule
477 8005275841 Rhizobium sp. N4311 Isolate Nodule
478 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
479 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
480 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
481 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
482 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
483 8005321885 Rhizobium sp. R72 Isolate Nodule
484 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
485 8005395548 Rhizobium sp. R339 Isolate Nodule
486 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
487 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
488 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
489 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
490 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
491 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
492 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
493 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
494 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
495 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
496 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
497 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
498 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
499 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
500 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
501 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
502 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
503 8018176218 Rhizobium sp. N122 Isolate Nodule
504 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
505 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
506 8024501048 Rhizobium sp. H4 Isolate Nodule
507 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
508 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
509 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
510 8056382006 Rhizobium croatiense 13T Isolate Nodule
511 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
512 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.98
Metatranscriptomes 0.14
Isolates 40.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 22.93
Nodule 28.31
Rhizoplane 2.76
Rhizosphere 26.66
Stem 0
Stem Tuber 0
Unclassified 18.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000449 3300001979 Bacteria 17614
2 JGI25155J39150_1000007 3300002704 Bacteria 238857
3 JGI25156J39149_1000215 3300002705 Bacteria 40194
4 JGI25162J39368_1000449 3300002737 Bacteria 32568
5 JGI25154J39366_1000169 3300002738 Bacteria 50665
6 JGI25158J39367_1000696 3300002739 Bacteria 6515
7 JGI25157J39369_1000226 3300002741 Bacteria 44207
8 JGI25152J39213_1001612 3300002773 Bacteria 9433
9 JGI25152J39213_1004430 3300002773 Bacteria 4426
10 JGI25152J39213_1009983 3300002773 Bacteria 2208
11 JGI25152J39213_1011464 3300002773 Bacteria 1959
12 JGI25150J39212_1000142 3300002774 Bacteria 40535
13 JGI25159J45721_1000470 3300002987 Bacteria 18595
14 JGI25159J45721_1000718 3300002987 Bacteria 14447
15 JGI25151J46595_10000031 3300003187 Bacteria 197865
16 JGI25151J46595_10001034 3300003187 Bacteria 20801
17 JGI25151J46595_10018268 3300003187 Bacteria 3017
18 JGI25165J46597_1001071 3300003214 Bacteria 17571
19 JGI25165J46597_1004692 3300003214 Bacteria 2846
20 JGI25153J46596_10002913 3300003215 Bacteria 9684
21 JGI25153J46596_10005117 3300003215 Bacteria 6917
22 JGI25153J46596_10008222 3300003215 Bacteria 5018
23 rootL2_10087167 3300003322 Bacteria 2302
24 rootH1_10079668 3300003323 Bacteria 1516
25 JGI25160J50197_1000114 3300003354 Bacteria 75947
26 JGI25160J50197_1002798 3300003354 Bacteria 7987
27 JGI25160J50197_1012499 3300003354 Bacteria 2943
28 JGI25161J50226_1000089 3300003374 Bacteria 73775
29 JGI25161J50226_1000114 3300003374 Bacteria 62957
30 Ga0055526_1002079 3300003771 Bacteria 13754
31 Ga0055526_1006902 3300003771 Bacteria 6043
32 Ga0055526_1008512 3300003771 Bacteria 5104
33 Ga0055524_1001259 3300003775 Bacteria 14879
34 Ga0055524_1006116 3300003775 Bacteria 5265
35 Ga0055524_1006544 3300003775 Bacteria 5043
36 Ga0055524_1015065 3300003775 Bacteria 2836
37 Ga0055536_1002677 3300003781 Bacteria 9884
38 Ga0055528_1000485 3300003790 Bacteria 31501
39 Ga0055528_1002081 3300003790 Bacteria 11117
40 Ga0055528_1002316 3300003790 Bacteria 10318
41 Ga0055528_1005600 3300003790 Bacteria 5811
42 Ga0055528_1007750 3300003790 Bacteria 4699
43 Ga0055530_10028178 3300003791 Bacteria 1520
44 Ga0055540_1000537 3300003792 Bacteria 28483
45 Ga0055540_1003608 3300003792 Bacteria 7387
46 Ga0055540_1015541 3300003792 Bacteria 2209
47 Ga0055540_1026343 3300003792 Bacteria 1408
48 Ga0058692_1000707 3300003856 Bacteria 13669
49 Ga0058692_1000793 3300003856 Bacteria 12657
50 Ga0055543_1000002 3300004625 Bacteria 390020
51 Ga0055543_1000077 3300004625 Bacteria 86457
52 Ga0065165_1000537 3300005262 Bacteria 57544
53 Ga0065165_1004996 3300005262 Bacteria 7772
54 Ga0065165_1007567 3300005262 Bacteria 5297
55 Ga0065165_1008608 3300005262 Bacteria 4736
56 Ga0070658_10018163 3300005327 Bacteria 5626
57 Ga0070666_10024598 3300005335 Bacteria 3925
58 Ga0070682_100274618 3300005337 Bacteria 1226
59 Ga0070660_100119509 3300005339 Bacteria 2102
60 Ga0070661_100149984 3300005344 Bacteria 1762
61 Ga0070668_100320340 3300005347 Bacteria 1305
62 Ga0070671_100152820 3300005355 Bacteria 1949
63 Ga0070659_100012696 3300005366 Bacteria 6249
64 Ga0070663_100069237 3300005455 Bacteria 2563
65 Ga0068853_100297259 3300005539 Bacteria 1492
66 Ga0070695_100045274 3300005545 Bacteria 2804
67 Ga0070693_100044026 3300005547 Bacteria 2523
68 Ga0070665_100072296 3300005548 Bacteria 3457
69 Ga0070665_100118058 3300005548 Bacteria 2655
70 Ga0068855_100042187 3300005563 Bacteria 5406
71 Ga0068856_100312433 3300005614 Bacteria 1589
72 Ga0068852_100014145 3300005616 Bacteria 6129
73 Ga0068851_10048993 3300005834 Bacteria 2142
74 Ga0068851_10187512 3300005834 Bacteria 1148
75 Ga0068860_100276088 3300005843 Bacteria 1641
76 Ga0075365_10000097 3300006038 Bacteria 25569
77 Ga0075365_10000532 3300006038 Bacteria 14622
78 Ga0075365_10003563 3300006038 Bacteria 8055
79 Ga0075368_10015988 3300006042 Bacteria 2790
80 Ga0075368_10038994 3300006042 Bacteria 1861
81 Ga0075368_10066149 3300006042 Bacteria 1453
82 Ga0075364_10025268 3300006051 Bacteria 3780
83 Ga0075362_10001609 3300006177 Bacteria 7322
84 Ga0075362_10023126 3300006177 Bacteria 2626
85 Ga0075362_10024294 3300006177 Bacteria 2570
86 Ga0075367_10000139 3300006178 Bacteria 21915
87 Ga0075367_10018640 3300006178 Bacteria 3833
88 Ga0075367_10126927 3300006178 Bacteria 1575
89 Ga0075369_10003084 3300006186 Bacteria 6035
90 Ga0075369_10004729 3300006186 Bacteria 5050
91 Ga0075369_10013535 3300006186 Bacteria 3240
92 Ga0075369_10057582 3300006186 Bacteria 1690
93 Ga0075366_10006995 3300006195 Bacteria 6209
94 Ga0075366_10013156 3300006195 Bacteria 4705
95 Ga0075370_10001799 3300006353 Bacteria 9584
96 Ga0075370_10013497 3300006353 Bacteria 4345
97 Ga0099826_10000059 3300006948 Bacteria 63493
98 Ga0099826_10048187 3300006948 Bacteria 2885
99 Ga0105245_10076453 3300009098 Bacteria 3050
100 Ga0105248_10221046 3300009177 Bacteria 2132
101 Ga0105237_10002680 3300009545 Bacteria 21825
102 Ga0105237_10173975 3300009545 Bacteria 2153
103 Ga0105249_10313447 3300009553 Bacteria 1578
104 Ga0123341_1000016 3300009765 Bacteria 85309
105 Ga0123342_1007669 3300009766 Bacteria 14126
106 Ga0123342_1018817 3300009766 Bacteria 5407
107 Ga0105239_10002581 3300010375 Bacteria 22935
108 Ga0157322_1001304 3300012490 Bacteria 1210
109 Ga0157373_10060519 3300013100 Bacteria 2683
110 Ga0157371_10000002 3300013102 Bacteria 665040
111 Ga0157371_10005871 3300013102 Bacteria 10257
112 Ga0157370_10000246 3300013104 Bacteria 69424
113 Ga0157370_10003061 3300013104 Bacteria 19833
114 Ga0157370_10048311 3300013104 Bacteria 4076
115 Ga0157375_10089455 3300013308 Bacteria 3135
116 Ga0182007_10003089 3300015262 Bacteria 8017
117 Ga0182005_1014497 3300015265 Bacteria 2204
118 Ga0209435_100005 3300025206 Bacteria 573745
119 Ga0209760_103135 3300025207 Bacteria 1487
120 Ga0209436_100050 3300025208 Bacteria 65942
121 Ga0209672_104327 3300025228 Bacteria 2660
122 Ga0209563_110339 3300025230 Bacteria 1366
123 Ga0209437_100291 3300025233 Bacteria 72764
124 Ga0207425_1000070 3300025245 Bacteria 116438
125 Ga0207425_1001972 3300025245 Bacteria 7681
126 Ga0207425_1011352 3300025245 Bacteria 2130
127 Ga0209646_1000011 3300025246 Bacteria 573745
128 Ga0209646_1015564 3300025246 Bacteria 1134
129 Ga0209026_1000008 3300025250 Bacteria 573745
130 Ga0209677_100524 3300025253 Bacteria 21308
131 Ga0209759_1000004 3300025256 Bacteria 573745
132 Ga0209129_1000080 3300025258 Bacteria 186416
133 Ga0209129_1000232 3300025258 Bacteria 61645
134 Ga0209129_1001669 3300025258 Bacteria 12020
135 Ga0209129_1001959 3300025258 Bacteria 10740
136 Ga0209129_1003444 3300025258 Bacteria 6868
137 Ga0209129_1004393 3300025258 Bacteria 5529
138 Ga0209129_1004836 3300025258 Bacteria 5063
139 Ga0209233_1000192 3300025261 Bacteria 127171
140 Ga0209233_1000194 3300025261 Bacteria 126185
141 Ga0209455_1013492 3300025272 Bacteria 1893
142 Ga0209673_1000037 3300025273 Bacteria 313804
143 Ga0209673_1000060 3300025273 Bacteria 263602
144 Ga0209673_1000312 3300025273 Bacteria 89594
145 Ga0209673_1000439 3300025273 Bacteria 71645
146 Ga0209673_1001082 3300025273 Bacteria 30702
147 Ga0209673_1002522 3300025273 Bacteria 12558
148 Ga0209673_1025044 3300025273 Bacteria 1992
149 Ga0209130_1000030 3300025284 Bacteria 323323
150 Ga0209130_1000083 3300025284 Bacteria 162582
151 Ga0209130_1010025 3300025284 Bacteria 2641
152 Ga0209130_1025664 3300025284 Bacteria 1273
153 Ga0209676_1005631 3300025292 Bacteria 6460
154 Ga0209676_1014588 3300025292 Bacteria 2946
155 Ga0209025_1000083 3300025294 Bacteria 265556
156 Ga0209025_1000255 3300025294 Bacteria 125764
157 Ga0209025_1000389 3300025294 Bacteria 90997
158 Ga0209025_1003226 3300025294 Bacteria 15787
159 Ga0209025_1008127 3300025294 Bacteria 7621
160 Ga0209025_1012044 3300025294 Bacteria 5604
161 Ga0209025_1018547 3300025294 Bacteria 3933
162 Ga0209025_1043720 3300025294 Bacteria 1883
163 Ga0209564_1000116 3300025295 Bacteria 207889
164 Ga0209564_1000125 3300025295 Bacteria 201709
165 Ga0209564_1000281 3300025295 Bacteria 104019
166 Ga0209564_1011173 3300025295 Bacteria 4048
167 Ga0209564_1013081 3300025295 Bacteria 3554
168 Ga0209758_1000090 3300025297 Bacteria 246564
169 Ga0209758_1000357 3300025297 Bacteria 82792
170 Ga0209758_1000621 3300025297 Bacteria 54479
171 Ga0209758_1000657 3300025297 Bacteria 51923
172 Ga0209758_1001459 3300025297 Bacteria 27768
173 Ga0209758_1004007 3300025297 Bacteria 12734
174 Ga0209758_1006040 3300025297 Bacteria 8932
175 Ga0209758_1007916 3300025297 Bacteria 7053
176 Ga0209758_1057874 3300025297 Bacteria 1300
177 Ga0209050_1006103 3300025298 Bacteria 7270
178 Ga0209050_1010608 3300025298 Bacteria 4510
179 Ga0209256_1000854 3300025299 Bacteria 37992
180 Ga0209256_1002625 3300025299 Bacteria 14193
181 Ga0209256_1002788 3300025299 Bacteria 13391
182 Ga0209256_1004253 3300025299 Bacteria 9159
183 Ga0209256_1006696 3300025299 Bacteria 5983
184 Ga0209256_1012609 3300025299 Bacteria 3211
185 Ga0207426_1000047 3300025302 Bacteria 417011
186 Ga0207426_1000173 3300025302 Bacteria 162697
187 Ga0207426_1000268 3300025302 Bacteria 109321
188 Ga0207426_1000984 3300025302 Bacteria 27966
189 Ga0209051_1000874 3300025303 Bacteria 30458
190 Ga0209051_1002732 3300025303 Bacteria 12249
191 Ga0209051_1005608 3300025303 Bacteria 7279
192 Ga0209051_1010356 3300025303 Bacteria 4720
193 Ga0209051_1016099 3300025303 Bacteria 3408
194 Ga0209051_1036235 3300025303 Bacteria 1825
195 Ga0209257_1005500 3300025304 Bacteria 8851
196 Ga0209257_1013064 3300025304 Bacteria 3744
197 Ga0209257_1040076 3300025304 Bacteria 1402
198 Ga0207656_10059638 3300025321 Bacteria 1671
199 Ga0207680_10092178 3300025903 Bacteria 1930
200 Ga0207647_10021766 3300025904 Bacteria 4273
201 Ga0207647_10053088 3300025904 Bacteria 2499
202 Ga0207707_10037615 3300025912 Bacteria 4230
203 Ga0207695_10000049 3300025913 Bacteria 406233
204 Ga0207671_10000860 3300025914 Bacteria 38458
205 Ga0207671_10080763 3300025914 Bacteria 2438
206 Ga0207657_10015996 3300025919 Bacteria 7243
207 Ga0207657_10073644 3300025919 Bacteria 2886
208 Ga0207650_10003669 3300025925 Bacteria 10501
209 Ga0207687_10044723 3300025927 Bacteria 3057
210 Ga0207644_10205387 3300025931 Bacteria 1555
211 Ga0207690_10102075 3300025932 Bacteria 2050
212 Ga0207689_10025480 3300025942 Bacteria 4956
213 Ga0207667_10037727 3300025949 Bacteria 5165
214 Ga0207667_10139161 3300025949 Bacteria 2499
215 Ga0207668_10141275 3300025972 Bacteria 1852
216 Ga0207639_10019140 3300026041 Bacteria 4878
217 Ga0207639_10256508 3300026041 Bacteria 1527
218 Ga0207678_10000550 3300026067 Bacteria 34309
219 Ga0207702_10249571 3300026078 Bacteria 1666
220 Ga0207698_10177876 3300026142 Bacteria 1881
221 Ga0209371_1000003 3300027312 Bacteria 1122971
222 Ga0209371_1001136 3300027312 Bacteria 19534
223 Ga0209371_1007452 3300027312 Bacteria 3809
224 Ga0209282_1000870 3300027666 Bacteria 15631
225 Ga0209282_1040982 3300027666 Bacteria 2746
226 Ga0209813_10025623 3300027866 Bacteria 1698
227 Ga0268266_10032423 3300028379 Bacteria 4439
228 Ga0268266_10135150 3300028379 Bacteria 2208
229 Ga0268266_10152845 3300028379 Bacteria 2082
230 Ga0268264_10209087 3300028381 Bacteria 1790
231 Ga0307515_10027931 3300028794 Bacteria 9614
232 Ga0307515_10224392 3300028794 Bacteria 1688
233 Ga0268256_1000004 3300030500 Bacteria 1122967
234 Ga0268256_1005571 3300030500 Bacteria 4906
235 Ga0268256_1007669 3300030500 Bacteria 3809
236 Ga0265331_10037048 3300031250 Bacteria 2390
237 Ga0307513_10015647 3300031456 Bacteria 9183
238 Ga0307405_10015099 3300031731 Bacteria 4172
239 Ga0307412_10005928 3300031911 Bacteria 6888
240 Ga0395905_0000479 3300037471 Bacteria 55266
241 Ga0395901_0005041 3300038443 Bacteria 13336
242 Ga0439436_0015315 3300041404 Bacteria 2307
243 Ga0439465_0040609 3300041413 Bacteria 1504
244 Ga0451787_099781 3300041441 Bacteria 1682
245 Ga0451835_0662584 3300041492 Bacteria 1658
246 Ga0451845_0285652 3300041501 Bacteria 1374
247 Ga0451853_2728515 3300041512 Bacteria 2597
248 Ga0450920_015487 3300042122 Bacteria 1450
249 Ga0439434_0051168 3300042435 Bacteria 1281
250 Ga0439435_0001931 3300042436 Bacteria 3984
251 Ga0466965_0110038 3300044683 Bacteria 1415
252 Ga0466970_0003151 3300044765 Bacteria 8013
253 Ga0466958_0037901 3300045836 Bacteria 2890
254 Ga0466967_0106530 3300045976 Bacteria 2570
255 Ga0495638_0000377 3300046460 Bacteria 55414
256 Ga0495638_0042028 3300046460 Bacteria 2889
257 Ga0495605_0001620 3300046474 Bacteria 14568
258 Ga0495662_0005387 3300046476 Bacteria 6406
259 Ga0495607_0044034 3300046501 Bacteria 2634
260 Ga0495606_0001835 3300046507 Bacteria 26895
261 Ga0495606_0027778 3300046507 Bacteria 4005
262 Ga0495606_0070168 3300046507 Bacteria 2211
263 Ga0495610_0001475 3300046512 Bacteria 20721
264 Ga0495610_0014975 3300046512 Bacteria 4530
265 Ga0495610_0028550 3300046512 Bacteria 2949
266 Ga0495620_0033584 3300046515 Bacteria 2328
267 Ga0495631_0008609 3300046518 Bacteria 5135
268 Ga0495631_0070163 3300046518 Bacteria 1515
269 Ga0495632_0034121 3300046519 Bacteria 2607
270 Ga0495632_0054107 3300046519 Bacteria 1968
271 Ga0495643_0032005 3300046522 Bacteria 2922
272 Ga0495643_0072095 3300046522 Bacteria 1812
273 Ga0495643_0077826 3300046522 Bacteria 1732
274 Ga0495597_0081073 3300046542 Bacteria 1388
275 Ga0495656_0026555 3300046615 Bacteria 2306
276 Ga0495668_0009593 3300046616 Bacteria 5925
277 Ga0495634_0058790 3300046642 Bacteria 2562
278 Ga0495625_0003727 3300046660 Bacteria 14852
279 Ga0495625_0042603 3300046660 Bacteria 3297
280 Ga0495588_0008129 3300046674 Bacteria 4798
281 Ga0495658_0037360 3300046683 Bacteria 2684
282 Ga0495671_0098571 3300046692 Bacteria 1429
283 Ga0495649_0018488 3300046694 Bacteria 3921
284 Ga0495604_0033731 3300047317 Bacteria 4051
285 Ga0495686_0002535 3300047472 Bacteria 17071
286 Ga0495686_0023756 3300047472 Bacteria 4037
287 Ga0495686_0027582 3300047472 Bacteria 3706
288 Ga0496100_0042154 3300048903 Bacteria 2914
289 Ga0496100_0258262 3300048903 Bacteria 1291
290 Ga0496101_0058413 3300048904 Bacteria 2793
291 Ga0496102_0007586 3300048905 Bacteria 9267
292 Ga0496102_0103717 3300048905 Bacteria 2645
293 Ga0496102_0121941 3300048905 Bacteria 2435
294 Ga0496103_0004542 3300048906 Bacteria 8402
295 Ga0496104_0161886 3300048907 Bacteria 2146
296 Ga0496106_0060447 3300048909 Bacteria 2872
297 Ga0496106_0110579 3300048909 Bacteria 2139
298 Ga0496106_0190679 3300048909 Bacteria 1630
299 Ga0496107_0015667 3300048910 Bacteria 5315
300 Ga0496110_0113746 3300048913 Bacteria 2434
301 Ga0496113_0479176 3300048916 Bacteria 1000
302 Ga0496115_0001918 3300048918 Bacteria 14843
303 Ga0496116_0000416 3300048919 Bacteria 60360
304 Ga0496116_0007605 3300048919 Bacteria 9573
305 Ga0496116_0013724 3300048919 Bacteria 6513
306 Ga0496116_0063346 3300048919 Bacteria 2382
307 Ga0496116_0065329 3300048919 Bacteria 2334
308 Ga0496116_0070494 3300048919 Bacteria 2218
309 Ga0496116_0086342 3300048919 Bacteria 1925
310 Ga0496116_0088217 3300048919 Bacteria 1896
311 Ga0496117_0000052 3300048920 Bacteria 280463
312 Ga0496117_0002487 3300048920 Bacteria 23118
313 Ga0496117_0022286 3300048920 Bacteria 5085
314 Ga0496117_0033275 3300048920 Bacteria 3900
315 Ga0496117_0065671 3300048920 Bacteria 2465
316 Ga0496117_0133688 3300048920 Bacteria 1498
317 Ga0496118_0000709 3300048921 Bacteria 53670
318 Ga0496118_0001701 3300048921 Bacteria 32176
319 Ga0496118_0043408 3300048921 Bacteria 3535
320 Ga0496118_0078286 3300048921 Bacteria 2340
321 Ga0496119_0002975 3300048922 Bacteria 18006
322 Ga0496119_0013386 3300048922 Bacteria 6543
323 Ga0496119_0015606 3300048922 Bacteria 5833
324 Ga0496119_0016179 3300048922 Bacteria 5697
325 Ga0496119_0056450 3300048922 Bacteria 2379
326 Ga0496119_0067387 3300048922 Bacteria 2111
327 Ga0496120_0000019 3300048923 Bacteria 260115
328 Ga0496120_0007260 3300048923 Bacteria 8283
329 Ga0496120_0160398 3300048923 Bacteria 1121
330 Ga0496121_0000003 3300048924 Bacteria 1191431
331 Ga0496121_0001407 3300048924 Bacteria 40738
332 Ga0496121_0002413 3300048924 Bacteria 28637
333 Ga0496121_0015646 3300048924 Bacteria 7915
334 Ga0496121_0023490 3300048924 Bacteria 5936
335 Ga0496121_0037803 3300048924 Bacteria 4282
336 Ga0496121_0093221 3300048924 Bacteria 2345
337 Ga0496121_0128328 3300048924 Bacteria 1903
338 Ga0496121_0172669 3300048924 Bacteria 1568
339 Ga0496122_0000053 3300048925 Bacteria 260120
340 Ga0496122_0002990 3300048925 Bacteria 23012
341 Ga0496122_0008551 3300048925 Bacteria 11011
342 Ga0496122_0012297 3300048925 Bacteria 8548
343 Ga0496122_0032355 3300048925 Bacteria 4327
344 Ga0496122_0038204 3300048925 Bacteria 3851
345 Ga0496122_0061320 3300048925 Bacteria 2761
346 Ga0496123_0000038 3300048926 Bacteria 260120
347 Ga0496123_0000063 3300048926 Bacteria 216072
348 Ga0496123_0007192 3300048926 Bacteria 10563
349 Ga0496123_0009360 3300048926 Bacteria 8833
350 Ga0496123_0018229 3300048926 Bacteria 5595
351 Ga0496124_0011012 3300048927 Bacteria 9083
352 Ga0496124_0019729 3300048927 Bacteria 6260
353 Ga0496124_0023919 3300048927 Bacteria 5564
354 Ga0496124_0025622 3300048927 Bacteria 5338
355 Ga0496124_0030872 3300048927 Bacteria 4747
356 Ga0496124_0066214 3300048927 Bacteria 3009
357 Ga0496124_0083484 3300048927 Bacteria 2620
358 Ga0496124_0107517 3300048927 Bacteria 2250
359 Ga0496124_0145291 3300048927 Bacteria 1867
360 Ga0496124_0204854 3300048927 Bacteria 1497
361 Ga0496125_0000345 3300048928 Bacteria 88357
362 Ga0496125_0020651 3300048928 Bacteria 6176
363 Ga0496125_0022456 3300048928 Bacteria 5860
364 Ga0496125_0022698 3300048928 Bacteria 5819
365 Ga0496125_0025949 3300048928 Bacteria 5353
366 Ga0496125_0053748 3300048928 Bacteria 3298
367 Ga0496125_0071888 3300048928 Bacteria 2699
368 Ga0496126_0000763 3300048929 Bacteria 58240
369 Ga0496126_0071589 3300048929 Bacteria 3086
370 Ga0496126_0123878 3300048929 Bacteria 2238
371 Ga0495678_016971 3300049459 Bacteria 3311
372 Ga0501031_0000464 3300049568 Bacteria 23491
373 Ga0501031_0031265 3300049568 Bacteria 3472
374 Ga0501032_0001325 3300049569 Bacteria 19757
375 Ga0501033_0001374 3300049570 Bacteria 21696
376 Ga0501033_0001441 3300049570 Bacteria 21121
377 Ga0501034_0002660 3300049571 Bacteria 21135
378 Ga0501034_0100772 3300049571 Bacteria 2882
379 Ga0501034_0104444 3300049571 Bacteria 2826
380 Ga0501036_0001020 3300049572 Bacteria 21136
381 Ga0501036_0080467 3300049572 Bacteria 2754
382 Ga0501037_0000203 3300049573 Bacteria 53647
383 Ga0501038_0002240 3300049574 Bacteria 17978
384 Ga0501038_0073737 3300049574 Bacteria 2889
385 Ga0501039_0000945 3300049575 Bacteria 21135
386 Ga0501043_0029517 3300049579 Bacteria 4309
387 Ga0501047_0066334 3300049581 Bacteria 3479
388 Ga0501067_0032301 3300049583 Bacteria 2905
389 Ga0501069_0044423 3300049585 Bacteria 2460
390 Ga0501070_0096813 3300049586 Bacteria 2441
391 Ga0501070_0112839 3300049586 Bacteria 2246
392 Ga0501073_0101955 3300049589 Bacteria 1993
393 Ga0501074_0034080 3300049590 Bacteria 3691
394 Ga0501083_0031059 3300049744 Bacteria 3665
395 Ga0501035_0001283 3300049822 Bacteria 25941
396 Ga0501035_0001667 3300049822 Bacteria 22461
397 Ga0501035_0005583 3300049822 Bacteria 11881
398 Ga0501044_0002456 3300049823 Bacteria 21135
399 Ga0501044_0013231 3300049823 Bacteria 8933
400 Ga0501044_0044843 3300049823 Bacteria 4585
401 Ga0501044_0209921 3300049823 Bacteria 1902
402 Ga0501045_0204822 3300049824 Bacteria 1470
403 nmdc:mga03n38_145_c1 3300050490 Bacteria 15661
404 nmdc:mga00v17_133605_c1 3300050491 Bacteria 1587
405 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
406 nmdc:mga00v17_56242_c1 3300050491 Bacteria 2405
407 nmdc:mga0yw44_1441_c2 3300050492 Bacteria 8093
408 nmdc:mga0yw44_24399_c1 3300050492 Bacteria 3422
409 nmdc:mga0k408_3360_c1 3300050493 Bacteria 8476
410 nmdc:mga0sz30_10334_c1 3300050516 Bacteria 3576
411 nmdc:mga0sz30_586_c1 3300050516 Bacteria 13725
412 Ga0500560_000247 3300053107 Bacteria 6669
413 Ga0500594_0003158 3300053118 Bacteria 3605
414 Ga0500608_050987 3300053122 Bacteria 1988
415 Ga0500618_002367 3300053125 Bacteria 7190
416 Ga0500658_0000067 3300053134 Bacteria 48662
417 Ga0500561_0000288 3300053137 Bacteria 8813
418 Ga0500568_0013936 3300053139 Bacteria 3648
419 Ga0500568_0017012 3300053139 Bacteria 3218
420 Ga0500616_0002271 3300053153 Bacteria 16324
421 Ga0500616_0010685 3300053153 Bacteria 5477
422 Ga0500622_0001717 3300053156 Bacteria 16963
423 Ga0500624_000343 3300053157 Bacteria 15439
424 Ga0500634_0009743 3300053161 Bacteria 4881
425 Ga0500634_0015011 3300053161 Bacteria 4102
426 Ga0501084_0013235 3300054114 Bacteria 6827
427 Ga0587072_000445 3300059643 Bacteria 4150
428 Ga0501082_0025055 3300060353 Bacteria 5139

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0081073 Ga0495597_0081073_31_954 307
2 3300048916 Ga0496113_0479176 Ga0496113_0479176_45_968 307
3 3300031250 Ga0265331_10037048 Ga0265331_100370483 314
4 3300042436 Ga0439435_0001931 Ga0439435_0001931_1116_2123 321
5 3300053122 Ga0500608_050987 Ga0500608_050987_486_1520 323
6 3300042122 Ga0450920_015487 Ga0450920_015487_25_1002 325
7 3300050491 nmdc:mga00v17_133605_c1 nmdc:mga00v17_133605_c1_182_1159 325
8 iso_pu_bacteria 2510917028 2511185141 326
9 iso_pu_bacteria 2513237088 2513597126 326
10 iso_pu_bacteria 2513237138 2513870776 326
11 3300037471 Ga0395905_0000479 Ga0395905_0000479_48009_49043 328
12 3300049583 Ga0501067_0032301 Ga0501067_0032301_265_1254 329
13 3300005327 Ga0070658_10018163 Ga0070658_100181635 330
14 3300006038 Ga0075365_10000097 Ga0075365_1000009721 330
15 3300006177 Ga0075362_10023126 Ga0075362_100231264 330
16 3300006186 Ga0075369_10004729 Ga0075369_100047292 330
17 3300009765 Ga0123341_1000016 Ga0123341_10000166 330
18 3300009766 Ga0123342_1018817 Ga0123342_10188172 330
19 3300025258 Ga0209129_1000080 Ga0209129_1000080103 330
20 3300025294 Ga0209025_1003226 Ga0209025_10032268 330
21 3300025294 Ga0209025_1043720 Ga0209025_10437201 330
22 3300025297 Ga0209758_1007916 Ga0209758_10079168 330
23 3300025303 Ga0209051_1002732 Ga0209051_100273211 330
24 3300048919 Ga0496116_0063346 Ga0496116_0063346_198_1232 330
25 3300048920 Ga0496117_0033275 Ga0496117_0033275_2451_3485 330
26 3300048922 Ga0496119_0013386 Ga0496119_0013386_2409_3443 330
27 3300048923 Ga0496120_0007260 Ga0496120_0007260_3055_4089 330
28 3300048924 Ga0496121_0000003 Ga0496121_0000003_952749_953783 330
29 3300048926 Ga0496123_0018229 Ga0496123_0018229_4476_5510 330
30 3300048927 Ga0496124_0083484 Ga0496124_0083484_1020_2054 330
31 3300048928 Ga0496125_0000345 Ga0496125_0000345_22248_23282 330
32 3300049568 Ga0501031_0000464 Ga0501031_0000464_14031_15071 330
33 3300049569 Ga0501032_0001325 Ga0501032_0001325_12681_13721 330
34 3300049570 Ga0501033_0001441 Ga0501033_0001441_14059_15099 330
35 3300049571 Ga0501034_0002660 Ga0501034_0002660_6037_7077 330
36 3300049572 Ga0501036_0001020 Ga0501036_0001020_6038_7078 330
37 3300049573 Ga0501037_0000203 Ga0501037_0000203_38554_39594 330
38 3300049574 Ga0501038_0002240 Ga0501038_0002240_5911_6951 330
39 3300049575 Ga0501039_0000945 Ga0501039_0000945_14059_15099 330
40 3300049579 Ga0501043_0029517 Ga0501043_0029517_299_1339 330
41 3300049822 Ga0501035_0001283 Ga0501035_0001283_10843_11883 330
42 3300049823 Ga0501044_0002456 Ga0501044_0002456_14059_15099 330
43 3300050491 nmdc:mga00v17_56242_c1 nmdc:mga00v17_56242_c1_252_1286 330
44 3300046460 Ga0495638_0042028 Ga0495638_0042028_1297_2331 333
45 iso_pu_bacteria 2738543031 2739350866 333
46 3300046519 Ga0495632_0054107 Ga0495632_0054107_56_1093 334
47 3300049589 Ga0501073_0101955 Ga0501073_0101955_375_1385 334
48 3300054114 Ga0501084_0013235 Ga0501084_0013235_4812_5897 334
49 3300060353 Ga0501082_0025055 Ga0501082_0025055_2328_3413 334
50 iso_pu_bacteria 2523231067 2523470035 334
51 3300053161 Ga0500634_0009743 Ga0500634_0009743_3253_4260 335
52 3300003781 Ga0055536_1002677 Ga0055536_10026775 337
53 3300003792 Ga0055540_1003608 Ga0055540_10036084 337
54 3300006038 Ga0075365_10003563 Ga0075365_1000356310 337
55 3300046507 Ga0495606_0001835 Ga0495606_0001835_17632_18645 337
56 3300048909 Ga0496106_0190679 Ga0496106_0190679_374_1387 337
57 3300048924 Ga0496121_0128328 Ga0496121_0128328_638_1651 337
58 3300048925 Ga0496122_0002990 Ga0496122_0002990_8141_9154 337
59 3300048926 Ga0496123_0000063 Ga0496123_0000063_206919_207932 337
60 3300053153 Ga0500616_0002271 Ga0500616_0002271_12138_13151 337
61 iso_pu_bacteria 2510917022 2511136603 337
62 iso_pu_bacteria 2524023209 2524460114 337
63 iso_pu_bacteria 2582581307 2585274240 337
64 iso_pu_bacteria 2582581315 2585322625 337
65 iso_pu_bacteria 2585427531 2585560689 337
66 iso_pu_bacteria 2585427608 2585898895 337
67 iso_pu_bacteria 2585427609 2585903513 337
68 iso_pu_bacteria 2585428125 2587981368 337
69 iso_pu_bacteria 2842298080 2842298660 337
70 iso_pu_bacteria 2842357229 2842359473 337
71 iso_pu_bacteria 2842509118 2842510688 337
72 iso_pu_bacteria 2852387548 2852391144 337
73 iso_pu_bacteria 8005484373 8005488543 337
74 iso_pu_bacteria 8046767195 8046773270 337
75 iso_pu_bacteria 8057575449 8057580994 337
76 iso_pu_bacteria 2510917030 2511198451 339
77 iso_pu_bacteria 2582581298 2585224830 339
78 iso_pu_bacteria 2585427529 2585547386 339
79 iso_pu_bacteria 2919100787 2919104516 339
80 iso_pu_bacteria 3005445848 3005449230 339
81 3300002987 JGI25159J45721_1000718 JGI25159J45721_10007182 340
82 3300003354 JGI25160J50197_1000114 JGI25160J50197_100011444 340
83 3300003374 JGI25161J50226_1000089 JGI25161J50226_100008939 340
84 3300004625 Ga0055543_1000002 Ga0055543_1000002369 340
85 3300005262 Ga0065165_1000537 Ga0065165_10005376 340
86 3300006353 Ga0075370_10001799 Ga0075370_1000179910 340
87 3300025284 Ga0209130_1000083 Ga0209130_1000083130 340
88 3300025302 Ga0207426_1000173 Ga0207426_1000173130 340
89 3300025904 Ga0207647_10053088 Ga0207647_100530882 340
90 3300026041 Ga0207639_10256508 Ga0207639_102565081 340
91 3300048922 Ga0496119_0067387 Ga0496119_0067387_500_1525 340
92 3300048924 Ga0496121_0172669 Ga0496121_0172669_345_1370 340
93 iso_pu_bacteria 2509276021 2509386434 340
94 iso_pu_bacteria 2509276021 2509389889 340
95 iso_pu_bacteria 2509276033 2509447864 340
96 iso_pu_bacteria 2510065019 2510134797 340
97 iso_pu_bacteria 2510461076 2510896204 340
98 iso_pu_bacteria 2510917026 2511171941 340
99 iso_pu_bacteria 2513237084 2513572563 340
100 iso_pu_bacteria 2513237103 2513710702 340
101 iso_pu_bacteria 2513237144 2513908237 340
102 iso_pu_bacteria 2515075009 2515113883 340
103 iso_pu_bacteria 2515154113 2515634756 340
104 iso_pu_bacteria 2515154114 2515645942 340
105 iso_pu_bacteria 2515154116 2515656823 340
106 iso_pu_bacteria 2516653085 2517077798 340
107 iso_pu_bacteria 2517093000 2517096597 340
108 iso_pu_bacteria 2517287029 2517410312 340
109 iso_pu_bacteria 2519899620 2520381283 340
110 iso_pu_bacteria 2529292951 2530646908 340
111 iso_pu_bacteria 2537561587 2537872902 340
112 iso_pu_bacteria 2554235003 2554245183 340
113 iso_pu_bacteria 2558860242 2559296987 340
114 iso_pu_bacteria 2582581308 2585280347 340
115 iso_pu_bacteria 2582581316 2585330738 340
116 iso_pu_bacteria 2582581867 2585402167 340
117 iso_pu_bacteria 2585427527 2585532577 340
118 iso_pu_bacteria 2585427528 2585541063 340
119 iso_pu_bacteria 2585427530 2585554407 340
120 iso_pu_bacteria 2585427590 2585822533 340
121 iso_pu_bacteria 2585427593 2585839825 340
122 iso_pu_bacteria 2585427634 2586001695 340
123 iso_pu_bacteria 2599185210 2599604688 340
124 iso_pu_bacteria 2599185236 2599724129 340
125 iso_pu_bacteria 2600255279 2601611166 340
126 iso_pu_bacteria 2600255308 2601747939 340
127 iso_pu_bacteria 2615840624 2616295511 340
128 iso_pu_bacteria 2615840626 2616307352 340
129 iso_pu_bacteria 2615840698 2616554896 340
130 iso_pu_bacteria 2617270742 2617383568 340
131 iso_pu_bacteria 2643221558 2643813208 340
132 iso_pu_bacteria 2643221582 2643916907 340
133 iso_pu_bacteria 2643221693 2644521229 340
134 iso_pu_bacteria 2718217882 2719182553 340
135 iso_pu_bacteria 2718217927 2719387224 340
136 iso_pu_bacteria 2718218009 2719733272 340
137 iso_pu_bacteria 2718218363 2721148666 340
138 iso_pu_bacteria 2718218365 2721160052 340
139 iso_pu_bacteria 2718218366 2721165480 340
140 iso_pu_bacteria 2718218423 2721400859 340
141 iso_pu_bacteria 2721755514 2722841650 340
142 iso_pu_bacteria 2721755809 2724039672 340
143 iso_pu_bacteria 2721755810 2724046028 340
144 iso_pu_bacteria 2728369365 2730165788 340
145 iso_pu_bacteria 2728369397 2730299684 340
146 iso_pu_bacteria 2738541333 2739035616 340
147 iso_pu_bacteria 2775507049 2776914514 340
148 iso_pu_bacteria 2775507266 2778175962 340
149 iso_pu_bacteria 2791355256 2793293693 340
150 iso_pu_bacteria 2791355259 2793313117 340
151 iso_pu_bacteria 2791355260 2793319765 340
152 iso_pu_bacteria 2791355261 2793327729 340
153 iso_pu_bacteria 2791355262 2793333321 340
154 iso_pu_bacteria 2791355263 2793344263 340
155 iso_pu_bacteria 2791355264 2793347327 340
156 iso_pu_bacteria 2791355265 2793353651 340
157 iso_pu_bacteria 2791355267 2793369497 340
158 iso_pu_bacteria 2802429605 2805930541 340
159 iso_pu_bacteria 2802429606 2805934279 340
160 iso_pu_bacteria 2802429633 2806044604 340
161 iso_pu_bacteria 2802429634 2806052804 340
162 iso_pu_bacteria 2802429635 2806059104 340
163 iso_pu_bacteria 2802429636 2806068233 340
164 iso_pu_bacteria 2802429637 2806074353 340
165 iso_pu_bacteria 2808606387 2808989053 340
166 iso_pu_bacteria 2818991439 2819557180 340
167 iso_pu_bacteria 2818991448 2819609649 340
168 iso_pu_bacteria 2818991453 2819639746 340
169 iso_pu_bacteria 2838016132 2838019061 340
170 iso_pu_bacteria 2838022645 2838024344 340
171 iso_pu_bacteria 2838029111 2838033084 340
172 iso_pu_bacteria 2838035591 2838040718 340
173 iso_pu_bacteria 2838042994 2838046300 340
174 iso_pu_bacteria 2838048938 2838051221 340
175 iso_pu_bacteria 2838061910 2838063803 340
176 iso_pu_bacteria 2838068647 2838073286 340
177 iso_pu_bacteria 2838661181 2838664895 340
178 iso_pu_bacteria 2838668709 2838671189 340
179 iso_pu_bacteria 2838675328 2838678280 340
180 iso_pu_bacteria 2838680041 2838685005 340
181 iso_pu_bacteria 2838686498 2838691368 340
182 iso_pu_bacteria 2838694306 2838699158 340
183 iso_pu_bacteria 2838701080 2838703631 340
184 iso_pu_bacteria 2838707686 2838712639 340
185 iso_pu_bacteria 2838714209 2838716814 340
186 iso_pu_bacteria 2838719591 2838722576 340
187 iso_pu_bacteria 2838724970 2838727563 340
188 iso_pu_bacteria 2838729681 2838733327 340
189 iso_pu_bacteria 2838742623 2838746101 340
190 iso_pu_bacteria 2841846520 2841849169 340
191 iso_pu_bacteria 2841851746 2841853813 340
192 iso_pu_bacteria 2841859092 2841861771 340
193 iso_pu_bacteria 2841864319 2841868218 340
194 iso_pu_bacteria 2842077413 2842082116 340
195 iso_pu_bacteria 2842110456 2842113482 340
196 iso_pu_bacteria 2842118031 2842123038 340
197 iso_pu_bacteria 2842124991 2842128082 340
198 iso_pu_bacteria 2842130223 2842133173 340
199 iso_pu_bacteria 2842146304 2842149367 340
200 iso_pu_bacteria 2842152218 2842155167 340
201 iso_pu_bacteria 2842156927 2842162180 340
202 iso_pu_bacteria 2842163707 2842169735 340
203 iso_pu_bacteria 2842170452 2842173666 340
204 iso_pu_bacteria 2842175837 2842178788 340
205 iso_pu_bacteria 2842180545 2842185106 340
206 iso_pu_bacteria 2842187318 2842189921 340
207 iso_pu_bacteria 2842192696 2842198305 340
208 iso_pu_bacteria 2842198810 2842199887 340
209 iso_pu_bacteria 2842205361 2842208255 340
210 iso_pu_bacteria 2842211629 2842214235 340
211 iso_pu_bacteria 2842217011 2842220124 340
212 iso_pu_bacteria 2842224351 2842226954 340
213 iso_pu_bacteria 2842229732 2842233544 340
214 iso_pu_bacteria 2842237096 2842242059 340
215 iso_pu_bacteria 2842243621 2842247637 340
216 iso_pu_bacteria 2842250916 2842253995 340
217 iso_pu_bacteria 2842257432 2842262095 340
218 iso_pu_bacteria 2842264693 2842266566 340
219 iso_pu_bacteria 2842271015 2842275842 340
220 iso_pu_bacteria 2842278818 2842281736 340
221 iso_pu_bacteria 2842285085 2842288843 340
222 iso_pu_bacteria 2842291075 2842296116 340
223 iso_pu_bacteria 2842304105 2842308174 340
224 iso_pu_bacteria 2842311132 2842315552 340
225 iso_pu_bacteria 2842317721 2842321441 340
226 iso_pu_bacteria 2842341865 2842344954 340
227 iso_pu_bacteria 2842363717 2842370002 340
228 iso_pu_bacteria 2842370503 2842375683 340
229 iso_pu_bacteria 2842377471 2842382515 340
230 iso_pu_bacteria 2842384541 2842389916 340
231 iso_pu_bacteria 2842395702 2842398566 340
232 iso_pu_bacteria 2842402390 2842406490 340
233 iso_pu_bacteria 2842409023 2842413083 340
234 iso_pu_bacteria 2842415677 2842419726 340
235 iso_pu_bacteria 2842422224 2842426920 340
236 iso_pu_bacteria 2842428310 2842429885 340
237 iso_pu_bacteria 2842434925 2842436455 340
238 iso_pu_bacteria 2842441272 2842444158 340
239 iso_pu_bacteria 2842447887 2842450984 340
240 iso_pu_bacteria 2842462802 2842464306 340
241 iso_pu_bacteria 2842469257 2842470784 340
242 iso_pu_bacteria 2842475841 2842479817 340
243 iso_pu_bacteria 2842482326 2842483437 340
244 iso_pu_bacteria 2842489311 2842493225 340
245 iso_pu_bacteria 2842495871 2842499207 340
246 iso_pu_bacteria 2842502639 2842506993 340
247 iso_pu_bacteria 2842515876 2842517963 340
248 iso_pu_bacteria 2844454524 2844457542 340
249 iso_pu_bacteria 2854896431 2854900288 340
250 iso_pu_bacteria 2854916844 2854919544 340
251 iso_pu_bacteria 2857516855 2857518949 340
252 iso_pu_bacteria 2891048133 2891051330 340
253 iso_pu_bacteria 2899792073 2899792861 340
254 iso_pu_bacteria 2899845264 2899845415 340
255 iso_pu_bacteria 2919114240 2919117005 340
256 iso_pu_bacteria 2919171160 2919173343 340
257 iso_pu_bacteria 2919408235 2919410630 340
258 iso_pu_bacteria 2920760137 2920760816 340
259 iso_pu_bacteria 2923556063 2923562500 340
260 iso_pu_bacteria 2926754445 2926758518 340
261 iso_pu_bacteria 2926760298 2926763950 340
262 iso_pu_bacteria 2933006813 2933009454 340
263 iso_pu_bacteria 2933011516 2933013592 340
264 iso_pu_bacteria 2933570622 2933574623 340
265 iso_pu_bacteria 2933594066 2933598155 340
266 iso_pu_bacteria 2935894831 2935899780 340
267 iso_pu_bacteria 2936367885 2936374916 340
268 iso_pu_bacteria 2936375103 2936380607 340
269 iso_pu_bacteria 2936381700 2936382217 340
270 iso_pu_bacteria 2979089926 2979090952 340
271 iso_pu_bacteria 2979095461 2979096477 340
272 iso_pu_bacteria 2979100975 2979102212 340
273 iso_pu_bacteria 2984509177 2984509840 340
274 iso_pu_bacteria 2984518228 2984519463 340
275 iso_pu_bacteria 2984537506 2984538179 340
276 iso_pu_bacteria 2984601300 2984604931 340
277 iso_pu_bacteria 2995392953 2995395468 340
278 iso_pu_bacteria 3005409236 3005415542 340
279 iso_pu_bacteria 3005416602 3005418534 340
280 iso_pu_bacteria 639633055 639649954 340
281 iso_pu_bacteria 650716007 650843408 340
282 iso_pu_bacteria 8003570095 8003573005 340
283 iso_pu_bacteria 8005275841 8005281954 340
284 iso_pu_bacteria 8005289223 8005294316 340
285 iso_pu_bacteria 8005301065 8005306723 340
286 iso_pu_bacteria 8005314921 8005318574 340
287 iso_pu_bacteria 8005376324 8005382835 340
288 iso_pu_bacteria 8005460587 8005464570 340
289 iso_pu_bacteria 8005570704 8005574990 340
290 iso_pu_bacteria 8005645114 8005649010 340
291 iso_pu_bacteria 8005688590 8005693582 340
292 iso_pu_bacteria 8005695170 8005700810 340
293 iso_pu_bacteria 8018127388 8018133661 340
294 iso_pu_bacteria 8018150411 8018155282 340
295 iso_pu_bacteria 8018176218 8018178512 340
296 iso_pu_bacteria 8023680758 8023687597 340
297 iso_pu_bacteria 8024479707 8024481732 340
298 iso_pu_bacteria 8024501048 8024505992 340
299 iso_pu_bacteria 8056375014 8056381537 340
300 iso_pu_bacteria 8056382006 8056386970 340
301 3300005347 Ga0070668_100320340 Ga0070668_1003203401 341
302 3300031911 Ga0307412_10005928 Ga0307412_100059287 341
303 3300046522 Ga0495643_0077826 Ga0495643_0077826_423_1451 341
304 iso_pu_bacteria 2534681796 2535519491 341
305 iso_pu_bacteria 2582581294 2585202522 341
306 iso_pu_bacteria 2582581304 2585257761 341
307 iso_pu_bacteria 2585427594 2585845288 341
308 iso_pu_bacteria 2643221599 2644006352 341
309 iso_pu_bacteria 2643221634 2644195831 341
310 iso_pu_bacteria 2643221643 2644241812 341
311 iso_pu_bacteria 2738541293 2738800506 341
312 iso_pu_bacteria 2996887358 2996890608 341
313 iso_pu_bacteria 3005452660 3005455496 341
314 iso_pu_bacteria 8005258706 8005264273 341
315 iso_pu_bacteria 8005321885 8005325135 341
316 iso_pu_bacteria 8005542996 8005547184 341
317 3300025230 Ga0209563_110339 Ga0209563_1103392 342
318 iso_pu_bacteria 2838074704 2838077395 342
319 iso_pu_bacteria 2894817345 2894818566 342
320 iso_pu_bacteria 2896384573 2896386408 342
321 3300002739 JGI25158J39367_1000696 JGI25158J39367_10006962 343
322 3300002773 JGI25152J39213_1004430 JGI25152J39213_10044301 343
323 3300002987 JGI25159J45721_1000470 JGI25159J45721_100047010 343
324 3300003215 JGI25153J46596_10005117 JGI25153J46596_100051175 343
325 3300003374 JGI25161J50226_1000114 JGI25161J50226_100011452 343
326 3300003771 Ga0055526_1008512 Ga0055526_10085126 343
327 3300003775 Ga0055524_1006116 Ga0055524_10061162 343
328 3300003790 Ga0055528_1002081 Ga0055528_100208112 343
329 3300003792 Ga0055540_1015541 Ga0055540_10155413 343
330 3300004625 Ga0055543_1000077 Ga0055543_100007747 343
331 3300005262 Ga0065165_1004996 Ga0065165_10049968 343
332 3300005337 Ga0070682_100274618 Ga0070682_1002746181 343
333 3300006186 Ga0075369_10013535 Ga0075369_100135352 343
334 3300025208 Ga0209436_100050 Ga0209436_10005052 343
335 3300025245 Ga0207425_1001972 Ga0207425_10019723 343
336 3300025258 Ga0209129_1001669 Ga0209129_10016698 343
337 3300025258 Ga0209129_1003444 Ga0209129_10034443 343
338 3300025258 Ga0209129_1004836 Ga0209129_10048364 343
339 3300025273 Ga0209673_1002522 Ga0209673_10025222 343
340 3300025284 Ga0209130_1000030 Ga0209130_1000030214 343
341 3300025294 Ga0209025_1008127 Ga0209025_10081275 343
342 3300025295 Ga0209564_1000281 Ga0209564_10002818 343
343 3300025297 Ga0209758_1000357 Ga0209758_100035720 343
344 3300025297 Ga0209758_1001459 Ga0209758_10014596 343
345 3300025297 Ga0209758_1006040 Ga0209758_10060405 343
346 3300025297 Ga0209758_1057874 Ga0209758_10578741 343
347 3300025299 Ga0209256_1002788 Ga0209256_10027881 343
348 3300025302 Ga0207426_1000047 Ga0207426_1000047187 343
349 3300025304 Ga0209257_1040076 Ga0209257_10400762 343
350 3300028379 Ga0268266_10135150 Ga0268266_101351502 343
351 3300041413 Ga0439465_0040609 Ga0439465_0040609_458_1489 343
352 3300044683 Ga0466965_0110038 Ga0466965_0110038_346_1377 343
353 3300046507 Ga0495606_0027778 Ga0495606_0027778_1722_2765 343
354 3300046512 Ga0495610_0028550 Ga0495610_0028550_113_1144 343
355 3300046694 Ga0495649_0018488 Ga0495649_0018488_1081_2112 343
356 3300048903 Ga0496100_0258262 Ga0496100_0258262_211_1254 343
357 3300048919 Ga0496116_0088217 Ga0496116_0088217_852_1883 343
358 3300048927 Ga0496124_0204854 Ga0496124_0204854_20_1051 343
359 3300048928 Ga0496125_0022698 Ga0496125_0022698_1131_2162 343
360 3300049568 Ga0501031_0031265 Ga0501031_0031265_1109_2140 343
361 3300049571 Ga0501034_0104444 Ga0501034_0104444_135_1166 343
362 3300049572 Ga0501036_0080467 Ga0501036_0080467_396_1427 343
363 3300049574 Ga0501038_0073737 Ga0501038_0073737_687_1718 343
364 3300049744 Ga0501083_0031059 Ga0501083_0031059_1006_2037 343
365 3300049823 Ga0501044_0044843 Ga0501044_0044843_1334_2365 343
366 3300049824 Ga0501045_0204822 Ga0501045_0204822_266_1297 343
367 3300053139 Ga0500568_0017012 Ga0500568_0017012_1064_2095 343
368 3300053156 Ga0500622_0001717 Ga0500622_0001717_3828_4859 343
369 3300001979 JGI24740J21852_10000449 JGI24740J21852_100004495 344
370 3300002704 JGI25155J39150_1000007 JGI25155J39150_100000750 344
371 3300002705 JGI25156J39149_1000215 JGI25156J39149_100021526 344
372 3300002737 JGI25162J39368_1000449 JGI25162J39368_100044925 344
373 3300002738 JGI25154J39366_1000169 JGI25154J39366_100016935 344
374 3300002741 JGI25157J39369_1000226 JGI25157J39369_100022614 344
375 3300002773 JGI25152J39213_1001612 JGI25152J39213_100161210 344
376 3300002773 JGI25152J39213_1009983 JGI25152J39213_10099832 344
377 3300002773 JGI25152J39213_1011464 JGI25152J39213_10114642 344
378 3300002774 JGI25150J39212_1000142 JGI25150J39212_100014210 344
379 3300003187 JGI25151J46595_10000031 JGI25151J46595_10000031118 344
380 3300003187 JGI25151J46595_10001034 JGI25151J46595_100010349 344
381 3300003187 JGI25151J46595_10018268 JGI25151J46595_100182682 344
382 3300003214 JGI25165J46597_1001071 JGI25165J46597_100107110 344
383 3300003214 JGI25165J46597_1004692 JGI25165J46597_10046923 344
384 3300003215 JGI25153J46596_10002913 JGI25153J46596_100029131 344
385 3300003215 JGI25153J46596_10008222 JGI25153J46596_100082223 344
386 3300003322 rootL2_10087167 rootL2_100871672 344
387 3300003323 rootH1_10079668 rootH1_100796682 344
388 3300003354 JGI25160J50197_1002798 JGI25160J50197_10027985 344
389 3300003354 JGI25160J50197_1012499 JGI25160J50197_10124993 344
390 3300003771 Ga0055526_1002079 Ga0055526_100207910 344
391 3300003771 Ga0055526_1006902 Ga0055526_10069024 344
392 3300003775 Ga0055524_1001259 Ga0055524_10012594 344
393 3300003775 Ga0055524_1006544 Ga0055524_10065443 344
394 3300003775 Ga0055524_1015065 Ga0055524_10150652 344
395 3300003790 Ga0055528_1000485 Ga0055528_10004852 344
396 3300003790 Ga0055528_1002316 Ga0055528_10023165 344
397 3300003790 Ga0055528_1005600 Ga0055528_10056002 344
398 3300003790 Ga0055528_1007750 Ga0055528_10077503 344
399 3300003791 Ga0055530_10028178 Ga0055530_100281782 344
400 3300003792 Ga0055540_1000537 Ga0055540_100053719 344
401 3300003792 Ga0055540_1026343 Ga0055540_10263431 344
402 3300003856 Ga0058692_1000707 Ga0058692_10007077 344
403 3300003856 Ga0058692_1000793 Ga0058692_10007936 344
404 3300005262 Ga0065165_1007567 Ga0065165_10075672 344
405 3300005262 Ga0065165_1008608 Ga0065165_10086084 344
406 3300005335 Ga0070666_10024598 Ga0070666_100245982 344
407 3300005339 Ga0070660_100119509 Ga0070660_1001195092 344
408 3300005344 Ga0070661_100149984 Ga0070661_1001499841 344
409 3300005355 Ga0070671_100152820 Ga0070671_1001528202 344
410 3300005366 Ga0070659_100012696 Ga0070659_1000126966 344
411 3300005455 Ga0070663_100069237 Ga0070663_1000692374 344
412 3300005539 Ga0068853_100297259 Ga0068853_1002972591 344
413 3300005545 Ga0070695_100045274 Ga0070695_1000452741 344
414 3300005547 Ga0070693_100044026 Ga0070693_1000440262 344
415 3300005548 Ga0070665_100072296 Ga0070665_1000722962 344
416 3300005548 Ga0070665_100118058 Ga0070665_1001180582 344
417 3300005563 Ga0068855_100042187 Ga0068855_1000421875 344
418 3300005614 Ga0068856_100312433 Ga0068856_1003124332 344
419 3300005616 Ga0068852_100014145 Ga0068852_1000141456 344
420 3300005834 Ga0068851_10048993 Ga0068851_100489932 344
421 3300005834 Ga0068851_10187512 Ga0068851_101875121 344
422 3300005843 Ga0068860_100276088 Ga0068860_1002760882 344
423 3300006038 Ga0075365_10000532 Ga0075365_1000053211 344
424 3300006042 Ga0075368_10015988 Ga0075368_100159882 344
425 3300006042 Ga0075368_10038994 Ga0075368_100389942 344
426 3300006042 Ga0075368_10066149 Ga0075368_100661492 344
427 3300006051 Ga0075364_10025268 Ga0075364_100252684 344
428 3300006177 Ga0075362_10001609 Ga0075362_100016095 344
429 3300006177 Ga0075362_10024294 Ga0075362_100242942 344
430 3300006178 Ga0075367_10000139 Ga0075367_1000013913 344
431 3300006178 Ga0075367_10018640 Ga0075367_100186402 344
432 3300006178 Ga0075367_10126927 Ga0075367_101269272 344
433 3300006186 Ga0075369_10003084 Ga0075369_100030846 344
434 3300006186 Ga0075369_10057582 Ga0075369_100575821 344
435 3300006195 Ga0075366_10006995 Ga0075366_100069952 344
436 3300006195 Ga0075366_10013156 Ga0075366_100131563 344
437 3300006353 Ga0075370_10013497 Ga0075370_100134972 344
438 3300006948 Ga0099826_10000059 Ga0099826_100000593 344
439 3300006948 Ga0099826_10048187 Ga0099826_100481872 344
440 3300009098 Ga0105245_10076453 Ga0105245_100764533 344
441 3300009177 Ga0105248_10221046 Ga0105248_102210462 344
442 3300009545 Ga0105237_10002680 Ga0105237_100026802 344
443 3300009545 Ga0105237_10173975 Ga0105237_101739752 344
444 3300009553 Ga0105249_10313447 Ga0105249_103134472 344
445 3300009766 Ga0123342_1007669 Ga0123342_100766910 344
446 3300010375 Ga0105239_10002581 Ga0105239_100025812 344
447 3300012490 Ga0157322_1001304 Ga0157322_10013041 344
448 3300013100 Ga0157373_10060519 Ga0157373_100605193 344
449 3300013102 Ga0157371_10000002 Ga0157371_1000000261 344
450 3300013102 Ga0157371_10005871 Ga0157371_100058719 344
451 3300013104 Ga0157370_10000246 Ga0157370_1000024613 344
452 3300013104 Ga0157370_10003061 Ga0157370_1000306113 344
453 3300013104 Ga0157370_10048311 Ga0157370_100483112 344
454 3300013308 Ga0157375_10089455 Ga0157375_100894552 344
455 3300015262 Ga0182007_10003089 Ga0182007_100030895 344
456 3300015265 Ga0182005_1014497 Ga0182005_10144972 344
457 3300025206 Ga0209435_100005 Ga0209435_100005203 344
458 3300025207 Ga0209760_103135 Ga0209760_1031351 344
459 3300025228 Ga0209672_104327 Ga0209672_1043272 344
460 3300025233 Ga0209437_100291 Ga0209437_10029110 344
461 3300025245 Ga0207425_1000070 Ga0207425_1000070101 344
462 3300025245 Ga0207425_1011352 Ga0207425_10113522 344
463 3300025246 Ga0209646_1000011 Ga0209646_1000011203 344
464 3300025246 Ga0209646_1015564 Ga0209646_10155641 344
465 3300025250 Ga0209026_1000008 Ga0209026_1000008203 344
466 3300025253 Ga0209677_100524 Ga0209677_10052414 344
467 3300025256 Ga0209759_1000004 Ga0209759_1000004203 344
468 3300025258 Ga0209129_1000232 Ga0209129_100023260 344
469 3300025258 Ga0209129_1001959 Ga0209129_10019594 344
470 3300025258 Ga0209129_1004393 Ga0209129_10043932 344
471 3300025261 Ga0209233_1000192 Ga0209233_100019268 344
472 3300025261 Ga0209233_1000194 Ga0209233_100019465 344
473 3300025272 Ga0209455_1013492 Ga0209455_10134922 344
474 3300025273 Ga0209673_1000037 Ga0209673_1000037200 344
475 3300025273 Ga0209673_1000060 Ga0209673_1000060165 344
476 3300025273 Ga0209673_1000312 Ga0209673_100031249 344
477 3300025273 Ga0209673_1000439 Ga0209673_100043935 344
478 3300025273 Ga0209673_1001082 Ga0209673_100108230 344
479 3300025273 Ga0209673_1025044 Ga0209673_10250442 344
480 3300025284 Ga0209130_1010025 Ga0209130_10100252 344
481 3300025284 Ga0209130_1025664 Ga0209130_10256641 344
482 3300025292 Ga0209676_1005631 Ga0209676_10056313 344
483 3300025292 Ga0209676_1014588 Ga0209676_10145882 344
484 3300025294 Ga0209025_1000083 Ga0209025_1000083162 344
485 3300025294 Ga0209025_1000255 Ga0209025_100025587 344
486 3300025294 Ga0209025_1000389 Ga0209025_100038952 344
487 3300025294 Ga0209025_1012044 Ga0209025_10120444 344
488 3300025294 Ga0209025_1018547 Ga0209025_10185473 344
489 3300025295 Ga0209564_1000116 Ga0209564_1000116165 344
490 3300025295 Ga0209564_1000125 Ga0209564_100012537 344
491 3300025295 Ga0209564_1011173 Ga0209564_10111734 344
492 3300025295 Ga0209564_1013081 Ga0209564_10130814 344
493 3300025297 Ga0209758_1000090 Ga0209758_1000090101 344
494 3300025297 Ga0209758_1000621 Ga0209758_10006217 344
495 3300025297 Ga0209758_1000657 Ga0209758_100065721 344
496 3300025297 Ga0209758_1004007 Ga0209758_10040078 344
497 3300025298 Ga0209050_1006103 Ga0209050_10061034 344
498 3300025298 Ga0209050_1010608 Ga0209050_10106084 344
499 3300025299 Ga0209256_1000854 Ga0209256_100085433 344
500 3300025299 Ga0209256_1002625 Ga0209256_10026256 344
501 3300025299 Ga0209256_1004253 Ga0209256_10042533 344
502 3300025299 Ga0209256_1006696 Ga0209256_10066964 344
503 3300025299 Ga0209256_1012609 Ga0209256_10126092 344
504 3300025302 Ga0207426_1000268 Ga0207426_100026882 344
505 3300025302 Ga0207426_1000984 Ga0207426_100098410 344
506 3300025303 Ga0209051_1000874 Ga0209051_10008743 344
507 3300025303 Ga0209051_1005608 Ga0209051_10056084 344
508 3300025303 Ga0209051_1010356 Ga0209051_10103562 344
509 3300025303 Ga0209051_1016099 Ga0209051_10160994 344
510 3300025303 Ga0209051_1036235 Ga0209051_10362352 344
511 3300025304 Ga0209257_1005500 Ga0209257_10055004 344
512 3300025304 Ga0209257_1013064 Ga0209257_10130644 344
513 3300025321 Ga0207656_10059638 Ga0207656_100596381 344
514 3300025903 Ga0207680_10092178 Ga0207680_100921782 344
515 3300025904 Ga0207647_10021766 Ga0207647_100217662 344
516 3300025912 Ga0207707_10037615 Ga0207707_100376152 344
517 3300025913 Ga0207695_10000049 Ga0207695_10000049209 344
518 3300025914 Ga0207671_10000860 Ga0207671_1000086018 344
519 3300025914 Ga0207671_10080763 Ga0207671_100807632 344
520 3300025919 Ga0207657_10015996 Ga0207657_100159961 344
521 3300025919 Ga0207657_10073644 Ga0207657_100736441 344
522 3300025925 Ga0207650_10003669 Ga0207650_100036697 344
523 3300025927 Ga0207687_10044723 Ga0207687_100447233 344
524 3300025931 Ga0207644_10205387 Ga0207644_102053871 344
525 3300025932 Ga0207690_10102075 Ga0207690_101020752 344
526 3300025942 Ga0207689_10025480 Ga0207689_100254804 344
527 3300025949 Ga0207667_10037727 Ga0207667_100377272 344
528 3300025949 Ga0207667_10139161 Ga0207667_101391613 344
529 3300025972 Ga0207668_10141275 Ga0207668_101412751 344
530 3300026041 Ga0207639_10019140 Ga0207639_100191404 344
531 3300026067 Ga0207678_10000550 Ga0207678_100005507 344
532 3300026078 Ga0207702_10249571 Ga0207702_102495712 344
533 3300026142 Ga0207698_10177876 Ga0207698_101778762 344
534 3300027312 Ga0209371_1000003 Ga0209371_1000003802 344
535 3300027312 Ga0209371_1001136 Ga0209371_100113612 344
536 3300027312 Ga0209371_1007452 Ga0209371_10074522 344
537 3300027666 Ga0209282_1000870 Ga0209282_10008707 344
538 3300027666 Ga0209282_1040982 Ga0209282_10409822 344
539 3300027866 Ga0209813_10025623 Ga0209813_100256231 344
540 3300028379 Ga0268266_10032423 Ga0268266_100324232 344
541 3300028379 Ga0268266_10152845 Ga0268266_101528452 344
542 3300028381 Ga0268264_10209087 Ga0268264_102090872 344
543 3300028794 Ga0307515_10027931 Ga0307515_100279317 344
544 3300028794 Ga0307515_10224392 Ga0307515_102243922 344
545 3300030500 Ga0268256_1000004 Ga0268256_1000004248 344
546 3300030500 Ga0268256_1005571 Ga0268256_10055713 344
547 3300030500 Ga0268256_1007669 Ga0268256_10076692 344
548 3300031456 Ga0307513_10015647 Ga0307513_100156478 344
549 3300031731 Ga0307405_10015099 Ga0307405_100150993 344
550 3300038443 Ga0395901_0005041 Ga0395901_0005041_5163_6203 344
551 3300041404 Ga0439436_0015315 Ga0439436_0015315_809_1843 344
552 3300041441 Ga0451787_099781 Ga0451787_099781_162_1196 344
553 3300041492 Ga0451835_0662584 Ga0451835_0662584_612_1646 344
554 3300041501 Ga0451845_0285652 Ga0451845_0285652_328_1362 344
555 3300041512 Ga0451853_2728515 Ga0451853_2728515_1299_2333 344
556 3300042435 Ga0439434_0051168 Ga0439434_0051168_172_1206 344
557 3300044765 Ga0466970_0003151 Ga0466970_0003151_3438_4472 344
558 3300045836 Ga0466958_0037901 Ga0466958_0037901_1817_2851 344
559 3300045976 Ga0466967_0106530 Ga0466967_0106530_1048_2082 344
560 3300046460 Ga0495638_0000377 Ga0495638_0000377_43483_44538 344
561 3300046474 Ga0495605_0001620 Ga0495605_0001620_9969_11024 344
562 3300046476 Ga0495662_0005387 Ga0495662_0005387_3353_4387 344
563 3300046501 Ga0495607_0044034 Ga0495607_0044034_1394_2449 344
564 3300046507 Ga0495606_0070168 Ga0495606_0070168_745_1800 344
565 3300046512 Ga0495610_0001475 Ga0495610_0001475_15772_16809 344
566 3300046512 Ga0495610_0014975 Ga0495610_0014975_1834_2868 344
567 3300046515 Ga0495620_0033584 Ga0495620_0033584_401_1435 344
568 3300046518 Ga0495631_0008609 Ga0495631_0008609_751_1806 344
569 3300046518 Ga0495631_0070163 Ga0495631_0070163_219_1253 344
570 3300046519 Ga0495632_0034121 Ga0495632_0034121_1190_2224 344
571 3300046522 Ga0495643_0032005 Ga0495643_0032005_458_1492 344
572 3300046522 Ga0495643_0072095 Ga0495643_0072095_123_1178 344
573 3300046615 Ga0495656_0026555 Ga0495656_0026555_696_1733 344
574 3300046616 Ga0495668_0009593 Ga0495668_0009593_3403_4458 344
575 3300046642 Ga0495634_0058790 Ga0495634_0058790_1308_2342 344
576 3300046660 Ga0495625_0003727 Ga0495625_0003727_9968_11023 344
577 3300046660 Ga0495625_0042603 Ga0495625_0042603_1961_2995 344
578 3300046674 Ga0495588_0008129 Ga0495588_0008129_3372_4406 344
579 3300046683 Ga0495658_0037360 Ga0495658_0037360_416_1450 344
580 3300046692 Ga0495671_0098571 Ga0495671_0098571_311_1345 344
581 3300047317 Ga0495604_0033731 Ga0495604_0033731_795_1829 344
582 3300047472 Ga0495686_0002535 Ga0495686_0002535_1766_2800 344
583 3300047472 Ga0495686_0023756 Ga0495686_0023756_1108_2142 344
584 3300047472 Ga0495686_0027582 Ga0495686_0027582_335_1369 344
585 3300048903 Ga0496100_0042154 Ga0496100_0042154_316_1377 344
586 3300048904 Ga0496101_0058413 Ga0496101_0058413_476_1546 344
587 3300048905 Ga0496102_0007586 Ga0496102_0007586_1717_2787 344
588 3300048905 Ga0496102_0103717 Ga0496102_0103717_278_1345 344
589 3300048905 Ga0496102_0121941 Ga0496102_0121941_416_1453 344
590 3300048906 Ga0496103_0004542 Ga0496103_0004542_6024_7094 344
591 3300048907 Ga0496104_0161886 Ga0496104_0161886_435_1472 344
592 3300048909 Ga0496106_0060447 Ga0496106_0060447_1750_2811 344
593 3300048909 Ga0496106_0110579 Ga0496106_0110579_173_1210 344
594 3300048910 Ga0496107_0015667 Ga0496107_0015667_906_1967 344
595 3300048913 Ga0496110_0113746 Ga0496110_0113746_670_1707 344
596 3300048918 Ga0496115_0001918 Ga0496115_0001918_13417_14478 344
597 3300048919 Ga0496116_0000416 Ga0496116_0000416_17402_18451 344
598 3300048919 Ga0496116_0007605 Ga0496116_0007605_6459_7496 344
599 3300048919 Ga0496116_0013724 Ga0496116_0013724_605_1675 344
600 3300048919 Ga0496116_0065329 Ga0496116_0065329_683_1720 344
601 3300048919 Ga0496116_0070494 Ga0496116_0070494_97_1131 344
602 3300048919 Ga0496116_0086342 Ga0496116_0086342_804_1841 344
603 3300048920 Ga0496117_0000052 Ga0496117_0000052_88489_89595 344
604 3300048920 Ga0496117_0002487 Ga0496117_0002487_3610_4680 344
605 3300048920 Ga0496117_0022286 Ga0496117_0022286_1971_3008 344
606 3300048920 Ga0496117_0065671 Ga0496117_0065671_469_1506 344
607 3300048920 Ga0496117_0133688 Ga0496117_0133688_153_1187 344
608 3300048921 Ga0496118_0000709 Ga0496118_0000709_38374_39480 344
609 3300048921 Ga0496118_0001701 Ga0496118_0001701_29737_30807 344
610 3300048921 Ga0496118_0043408 Ga0496118_0043408_1532_2569 344
611 3300048921 Ga0496118_0078286 Ga0496118_0078286_807_1841 344
612 3300048922 Ga0496119_0002975 Ga0496119_0002975_16431_17501 344
613 3300048922 Ga0496119_0015606 Ga0496119_0015606_1937_3043 344
614 3300048922 Ga0496119_0016179 Ga0496119_0016179_4397_5431 344
615 3300048922 Ga0496119_0056450 Ga0496119_0056450_1019_2056 344
616 3300048923 Ga0496120_0000019 Ga0496120_0000019_88489_89595 344
617 3300048923 Ga0496120_0160398 Ga0496120_0160398_36_1070 344
618 3300048924 Ga0496121_0001407 Ga0496121_0001407_35971_37041 344
619 3300048924 Ga0496121_0002413 Ga0496121_0002413_13392_14459 344
620 3300048924 Ga0496121_0015646 Ga0496121_0015646_39_1076 344
621 3300048924 Ga0496121_0023490 Ga0496121_0023490_39_1076 344
622 3300048924 Ga0496121_0037803 Ga0496121_0037803_899_1933 344
623 3300048924 Ga0496121_0093221 Ga0496121_0093221_45_1079 344
624 3300048925 Ga0496122_0000053 Ga0496122_0000053_88489_89595 344
625 3300048925 Ga0496122_0008551 Ga0496122_0008551_9604_10689 344
626 3300048925 Ga0496122_0012297 Ga0496122_0012297_4006_5076 344
627 3300048925 Ga0496122_0032355 Ga0496122_0032355_838_1875 344
628 3300048925 Ga0496122_0038204 Ga0496122_0038204_1532_2569 344
629 3300048925 Ga0496122_0061320 Ga0496122_0061320_604_1641 344
630 3300048926 Ga0496123_0000038 Ga0496123_0000038_88489_89595 344
631 3300048926 Ga0496123_0007192 Ga0496123_0007192_3447_4517 344
632 3300048926 Ga0496123_0009360 Ga0496123_0009360_796_1833 344
633 3300048927 Ga0496124_0011012 Ga0496124_0011012_6047_7117 344
634 3300048927 Ga0496124_0019729 Ga0496124_0019729_2071_3108 344
635 3300048927 Ga0496124_0023919 Ga0496124_0023919_2428_3465 344
636 3300048927 Ga0496124_0025622 Ga0496124_0025622_917_2023 344
637 3300048927 Ga0496124_0030872 Ga0496124_0030872_2959_4044 344
638 3300048927 Ga0496124_0066214 Ga0496124_0066214_859_1896 344
639 3300048927 Ga0496124_0107517 Ga0496124_0107517_688_1725 344
640 3300048927 Ga0496124_0145291 Ga0496124_0145291_777_1811 344
641 3300048928 Ga0496125_0020651 Ga0496125_0020651_4494_5528 344
642 3300048928 Ga0496125_0022456 Ga0496125_0022456_1643_2713 344
643 3300048928 Ga0496125_0025949 Ga0496125_0025949_3386_4423 344
644 3300048928 Ga0496125_0053748 Ga0496125_0053748_1372_2478 344
645 3300048928 Ga0496125_0071888 Ga0496125_0071888_1063_2100 344
646 3300048929 Ga0496126_0000763 Ga0496126_0000763_38757_39806 344
647 3300048929 Ga0496126_0071589 Ga0496126_0071589_1285_2322 344
648 3300048929 Ga0496126_0123878 Ga0496126_0123878_381_1487 344
649 3300049459 Ga0495678_016971 Ga0495678_016971_1943_2998 344
650 3300049570 Ga0501033_0001374 Ga0501033_0001374_7110_8219 344
651 3300049571 Ga0501034_0100772 Ga0501034_0100772_1568_2704 344
652 3300049581 Ga0501047_0066334 Ga0501047_0066334_1723_2802 344
653 3300049585 Ga0501069_0044423 Ga0501069_0044423_1269_2348 344
654 3300049586 Ga0501070_0096813 Ga0501070_0096813_53_1132 344
655 3300049586 Ga0501070_0112839 Ga0501070_0112839_710_1822 344
656 3300049590 Ga0501074_0034080 Ga0501074_0034080_726_1805 344
657 3300049822 Ga0501035_0001667 Ga0501035_0001667_7542_8654 344
658 3300049822 Ga0501035_0005583 Ga0501035_0005583_8699_9808 344
659 3300049823 Ga0501044_0013231 Ga0501044_0013231_323_1435 344
660 3300049823 Ga0501044_0209921 Ga0501044_0209921_632_1666 344
661 3300050490 nmdc:mga03n38_145_c1 nmdc:mga03n38_145_c1_12413_13519 344
662 3300050491 nmdc:mga00v17_55_c1 nmdc:mga00v17_55_c1_12209_13315 344
663 3300050492 nmdc:mga0yw44_1441_c2 nmdc:mga0yw44_1441_c2_694_1728 344
664 3300050492 nmdc:mga0yw44_24399_c1 nmdc:mga0yw44_24399_c1_1547_2653 344
665 3300050493 nmdc:mga0k408_3360_c1 nmdc:mga0k408_3360_c1_482_1588 344
666 3300050516 nmdc:mga0sz30_10334_c1 nmdc:mga0sz30_10334_c1_1450_2484 344
667 3300050516 nmdc:mga0sz30_586_c1 nmdc:mga0sz30_586_c1_11565_12671 344
668 3300053107 Ga0500560_000247 Ga0500560_000247_54_1133 344
669 3300053118 Ga0500594_0003158 Ga0500594_0003158_697_1752 344
670 3300053125 Ga0500618_002367 Ga0500618_002367_3996_5030 344
671 3300053134 Ga0500658_0000067 Ga0500658_0000067_2200_3234 344
672 3300053137 Ga0500561_0000288 Ga0500561_0000288_7291_8397 344
673 3300053139 Ga0500568_0013936 Ga0500568_0013936_1937_2992 344
674 3300053153 Ga0500616_0010685 Ga0500616_0010685_2557_3612 344
675 3300053157 Ga0500624_000343 Ga0500624_000343_5697_6776 344
676 3300053161 Ga0500634_0015011 Ga0500634_0015011_2722_3801 344
677 3300059643 Ga0587072_000445 Ga0587072_000445_2877_3911 344
678 iso_pu_bacteria 2513237085 2513581278 344
679 iso_pu_bacteria 2513237093 2513631363 344
680 iso_pu_bacteria 2513237162 2514022380 344
681 iso_pu_bacteria 2515154134 2515743609 344
682 iso_pu_bacteria 2516653077 2517037499 344
683 iso_pu_bacteria 2585427526 2585530227 344
684 iso_pu_bacteria 2585427633 2585997094 344
685 iso_pu_bacteria 2599185170 2599420608 344
686 iso_pu_bacteria 2643221568 2643858204 344
687 iso_pu_bacteria 2671180139 2671695450 344
688 iso_pu_bacteria 2718217997 2719666865 344
689 iso_pu_bacteria 2718218199 2720493285 344
690 iso_pu_bacteria 2718218232 2720614759 344
691 iso_pu_bacteria 2718218233 2720621532 344
692 iso_pu_bacteria 2718218235 2720632860 344
693 iso_pu_bacteria 2718218269 2720776584 344
694 iso_pu_bacteria 2721755556 2723028172 344
695 iso_pu_bacteria 2721755684 2723561803 344
696 iso_pu_bacteria 2721755685 2723568432 344
697 iso_pu_bacteria 2721755819 2724091191 344
698 iso_pu_bacteria 2721755822 2724105697 344
699 iso_pu_bacteria 2721755823 2724111526 344
700 iso_pu_bacteria 2724679232 2725947785 344
701 iso_pu_bacteria 2728369352 2730109108 344
702 iso_pu_bacteria 2765235942 2766065366 344
703 iso_pu_bacteria 2791355266 2793359780 344
704 iso_pu_bacteria 2919166419 2919169831 344
705 iso_pu_bacteria 2933016740 2933021514 344
706 iso_pu_bacteria 2933586486 2933589228 344
707 iso_pu_bacteria 2933599457 2933603584 344
708 iso_pu_bacteria 2935901341 2935906944 344
709 iso_pu_bacteria 2978969890 2978972248 344
710 iso_pu_bacteria 2984587000 2984590480 344
711 iso_pu_bacteria 2996893221 2996896329 344
712 iso_pu_bacteria 8005282627 8005288942 344
713 iso_pu_bacteria 8005307578 8005311213 344
714 iso_pu_bacteria 8005395548 8005401214 344
715 iso_pu_bacteria 8005430974 8005434166 344
716 iso_pu_bacteria 8005497431 8005501616 344
717 iso_pu_bacteria 8005556819 8005558429 344
718 iso_pu_bacteria 8005563573 8005566727 344
719 iso_pu_bacteria 8005619151 8005622973 344
720 iso_pu_bacteria 8005626139 8005631724 344
721 iso_pu_bacteria 8005668836 8005673038 344
722 iso_pu_bacteria 8018163183 8018170171 344
723 iso_pu_bacteria 8045864390 8045867426 344
724 iso_pu_bacteria 8057874678 8057876778 344

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

53

374

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pnj-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.8596 16 341
3aqi-assembly1.cif.gz_B h240a variant of human ferrochelatase 0.8555 16 341
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.8549 16 341
4f4d-assembly1.cif.gz_B f337r variant of human ferrochelatase 0.8518 16 344
4kmm-assembly1.cif.gz_B m76h variant of human ferrochelatase 0.8498 16 344
ID Description Score Start End Superfamily
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9485 21 178 3.40.50.1400
af_P23871_6_161_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9252 21 178 3.40.50.1400
af_P23871_6_250_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9242 21 269 3.40.605.10
af_P23871_188_298_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9182 209 316 3.40.50.1400
af_Q8ID58_27_285_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9135 21 278 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A529FBU1-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.9728 15 138 GO:0004325
GO:0006783
AF-A0A529N520-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.967 26 166 GO:0004325
GO:0006783
AF-A0A529FBU1-F1-model_v4 Ferrochelatase (EC 4.99.1.1) 0.9574 15 138 GO:0004325
GO:0006783
AF-A0A537TXI1-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9558 78 344 GO:0004325
GO:0005737
GO:0006783
AF-A0A2A4N5E3-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.955 18 344 GO:0004325
GO:0005737
GO:0006783
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.08 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map