F477568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 724 | 294 | 1448 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300041507|Ga0451851_1184046|Ga0451851_1184046_40_558 |
| Length | 172 |
| Sequence | VVVGIPIGELSRRSGVSQSALRFYERQGLIAAERTDGNQRRYPGVTLRRVALIQAGKAAGIPLERIKQALDTLPSGKSPTKRDWARLSSSWRKELDERIETLEAIRGRLTTCIGCGCLSLKTCALLNPADEAGQLGGGARYLRRVSPHERDLAVRAPRVHRDPLGQRRTGAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 143 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 145 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 158 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 161 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 181 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 185 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 186 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 187 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 188 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 272 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 283 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 284 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 285 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 286 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 287 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 288 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 289 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 290 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 291 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 292 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 293 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 294 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 0.55 |
| Isolates | 1.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.1 |
| Nodule | 0 |
| Rhizoplane | 13.12 |
| Rhizosphere | 84.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451851_1184046 | 3300041507 | Bacteria | 779 |
| 2 | Ga0070658_10024130 | 3300005327 | Bacteria | 4880 |
| 3 | Ga0070658_10044295 | 3300005327 | Bacteria | 3596 |
| 4 | Ga0070683_100013654 | 3300005329 | Bacteria | 7091 |
| 5 | Ga0070683_100048113 | 3300005329 | Bacteria | 3942 |
| 6 | Ga0070683_100197248 | 3300005329 | Bacteria | 1912 |
| 7 | Ga0070683_100515396 | 3300005329 | Bacteria | 1143 |
| 8 | Ga0070683_100520440 | 3300005329 | Bacteria | 1137 |
| 9 | Ga0070680_100012266 | 3300005336 | Bacteria | 6656 |
| 10 | Ga0070680_100037889 | 3300005336 | Bacteria | 3897 |
| 11 | Ga0070680_100046397 | 3300005336 | Bacteria | 3534 |
| 12 | Ga0070682_100023546 | 3300005337 | Bacteria | 3656 |
| 13 | Ga0070682_100042155 | 3300005337 | Bacteria | 2816 |
| 14 | Ga0068868_100173315 | 3300005338 | Bacteria | 1787 |
| 15 | Ga0068868_100201358 | 3300005338 | Bacteria | 1660 |
| 16 | Ga0068868_100950570 | 3300005338 | Bacteria | 784 |
| 17 | Ga0070660_100010569 | 3300005339 | Bacteria | 6523 |
| 18 | Ga0070660_100033834 | 3300005339 | Bacteria | 3856 |
| 19 | Ga0070687_100454337 | 3300005343 | Bacteria | 853 |
| 20 | Ga0070661_100084331 | 3300005344 | Bacteria | 2347 |
| 21 | Ga0070661_100185037 | 3300005344 | Bacteria | 1586 |
| 22 | Ga0070661_100428688 | 3300005344 | Bacteria | 1049 |
| 23 | Ga0070692_10338708 | 3300005345 | Unclassified | 931 |
| 24 | Ga0070668_100338890 | 3300005347 | Bacteria | 1270 |
| 25 | Ga0070669_100453975 | 3300005353 | Bacteria | 1057 |
| 26 | Ga0070671_101331747 | 3300005355 | Bacteria | 634 |
| 27 | Ga0070674_101133532 | 3300005356 | Bacteria | 692 |
| 28 | Ga0070673_100630166 | 3300005364 | Bacteria | 980 |
| 29 | Ga0070659_100078346 | 3300005366 | Bacteria | 2636 |
| 30 | Ga0070659_100317361 | 3300005366 | Bacteria | 1302 |
| 31 | Ga0070667_100549080 | 3300005367 | Bacteria | 1062 |
| 32 | Ga0070703_10171642 | 3300005406 | Bacteria | 831 |
| 33 | Ga0070709_10453267 | 3300005434 | Bacteria | 967 |
| 34 | Ga0070709_11085532 | 3300005434 | Bacteria | 640 |
| 35 | Ga0070714_100046885 | 3300005435 | Bacteria | 3668 |
| 36 | Ga0070714_100254827 | 3300005435 | Bacteria | 1624 |
| 37 | Ga0070714_100417590 | 3300005435 | Bacteria | 1270 |
| 38 | Ga0070714_100573797 | 3300005435 | Bacteria | 1082 |
| 39 | Ga0070714_101024548 | 3300005435 | Bacteria | 804 |
| 40 | Ga0070714_101530655 | 3300005435 | Bacteria | 652 |
| 41 | Ga0070713_100173940 | 3300005436 | Bacteria | 1930 |
| 42 | Ga0070701_10342747 | 3300005438 | Bacteria | 931 |
| 43 | Ga0070711_100040739 | 3300005439 | Bacteria | 3134 |
| 44 | Ga0070711_100172278 | 3300005439 | Bacteria | 1650 |
| 45 | Ga0070711_100416372 | 3300005439 | Bacteria | 1094 |
| 46 | Ga0070711_100642206 | 3300005439 | Bacteria | 889 |
| 47 | Ga0070711_100778783 | 3300005439 | Unclassified | 810 |
| 48 | Ga0070711_101137539 | 3300005439 | Bacteria | 674 |
| 49 | Ga0070705_100624006 | 3300005440 | Bacteria | 837 |
| 50 | Ga0070700_100887576 | 3300005441 | Bacteria | 725 |
| 51 | Ga0070708_100642482 | 3300005445 | Bacteria | 1000 |
| 52 | Ga0070708_101293802 | 3300005445 | Bacteria | 681 |
| 53 | Ga0070678_100008917 | 3300005456 | Bacteria | 6039 |
| 54 | Ga0070678_101131806 | 3300005456 | Bacteria | 724 |
| 55 | Ga0070678_102192367 | 3300005456 | Bacteria | 524 |
| 56 | Ga0070662_100453930 | 3300005457 | Bacteria | 1064 |
| 57 | Ga0070681_10006989 | 3300005458 | Bacteria | 10987 |
| 58 | Ga0070681_10078229 | 3300005458 | Bacteria | 3264 |
| 59 | Ga0070681_10084144 | 3300005458 | Bacteria | 3134 |
| 60 | Ga0070681_10276750 | 3300005458 | Bacteria | 1589 |
| 61 | Ga0070681_10518818 | 3300005458 | Bacteria | 1105 |
| 62 | Ga0068867_101645742 | 3300005459 | Bacteria | 601 |
| 63 | Ga0070685_10762853 | 3300005466 | Bacteria | 710 |
| 64 | Ga0070685_11332219 | 3300005466 | Bacteria | 549 |
| 65 | Ga0070706_100260564 | 3300005467 | Bacteria | 1618 |
| 66 | Ga0070706_100506742 | 3300005467 | Bacteria | 1123 |
| 67 | Ga0070706_101005280 | 3300005467 | Bacteria | 769 |
| 68 | Ga0070707_100000633 | 3300005468 | Bacteria | 35138 |
| 69 | Ga0070707_101675994 | 3300005468 | Bacteria | 603 |
| 70 | Ga0070698_100142629 | 3300005471 | Bacteria | 2346 |
| 71 | Ga0070698_100214595 | 3300005471 | Bacteria | 1859 |
| 72 | Ga0070679_100001973 | 3300005530 | Bacteria | 18408 |
| 73 | Ga0070679_100102120 | 3300005530 | Bacteria | 2854 |
| 74 | Ga0070679_100141147 | 3300005530 | Bacteria | 2388 |
| 75 | Ga0070679_100233708 | 3300005530 | Bacteria | 1797 |
| 76 | Ga0070679_100386805 | 3300005530 | Bacteria | 1345 |
| 77 | Ga0070679_101658155 | 3300005530 | Bacteria | 587 |
| 78 | Ga0070684_100000226 | 3300005535 | Bacteria | 39137 |
| 79 | Ga0070684_100305941 | 3300005535 | Bacteria | 1459 |
| 80 | Ga0070684_101494644 | 3300005535 | Bacteria | 636 |
| 81 | Ga0068853_100897320 | 3300005539 | Bacteria | 851 |
| 82 | Ga0070672_100628367 | 3300005543 | Bacteria | 937 |
| 83 | Ga0070672_100823159 | 3300005543 | Bacteria | 818 |
| 84 | Ga0070686_100636626 | 3300005544 | Bacteria | 844 |
| 85 | Ga0070695_100421850 | 3300005545 | Bacteria | 1016 |
| 86 | Ga0070695_101693288 | 3300005545 | Bacteria | 529 |
| 87 | Ga0070696_100211738 | 3300005546 | Bacteria | 1451 |
| 88 | Ga0070693_100945050 | 3300005547 | Bacteria | 649 |
| 89 | Ga0070665_101229078 | 3300005548 | Bacteria | 760 |
| 90 | Ga0070704_100059042 | 3300005549 | Bacteria | 2735 |
| 91 | Ga0070704_100818874 | 3300005549 | Bacteria | 833 |
| 92 | Ga0068855_100057638 | 3300005563 | Bacteria | 4552 |
| 93 | Ga0068857_100619284 | 3300005577 | Bacteria | 1024 |
| 94 | Ga0068854_100103423 | 3300005578 | Bacteria | 2138 |
| 95 | Ga0068856_100053920 | 3300005614 | Bacteria | 3965 |
| 96 | Ga0068856_100066521 | 3300005614 | Bacteria | 3561 |
| 97 | Ga0068856_100067956 | 3300005614 | Bacteria | 3522 |
| 98 | Ga0068856_101397505 | 3300005614 | Bacteria | 714 |
| 99 | Ga0068856_101574173 | 3300005614 | Bacteria | 670 |
| 100 | Ga0068859_100695999 | 3300005617 | Bacteria | 1107 |
| 101 | Ga0068859_101748025 | 3300005617 | Bacteria | 687 |
| 102 | Ga0068859_102880967 | 3300005617 | Bacteria | 527 |
| 103 | Ga0068864_101759057 | 3300005618 | Bacteria | 625 |
| 104 | Ga0068866_10274746 | 3300005718 | Bacteria | 1041 |
| 105 | Ga0068861_100188587 | 3300005719 | Bacteria | 1722 |
| 106 | Ga0068863_100452639 | 3300005841 | Bacteria | 1260 |
| 107 | Ga0081455_10291275 | 3300005937 | Bacteria | 1175 |
| 108 | Ga0070717_10005163 | 3300006028 | Bacteria | 9520 |
| 109 | Ga0070717_10009227 | 3300006028 | Bacteria | 7414 |
| 110 | Ga0070717_10011053 | 3300006028 | Bacteria | 6838 |
| 111 | Ga0070717_10277950 | 3300006028 | Bacteria | 1484 |
| 112 | Ga0070717_10468632 | 3300006028 | Bacteria | 1136 |
| 113 | Ga0070717_10470056 | 3300006028 | Bacteria | 1135 |
| 114 | Ga0070717_11418801 | 3300006028 | Bacteria | 630 |
| 115 | Ga0070717_11724913 | 3300006028 | Bacteria | 566 |
| 116 | Ga0075365_10500006 | 3300006038 | Bacteria | 859 |
| 117 | Ga0075364_10350466 | 3300006051 | Bacteria | 1006 |
| 118 | Ga0070716_101346109 | 3300006173 | Bacteria | 579 |
| 119 | Ga0070712_100050005 | 3300006175 | Bacteria | 2906 |
| 120 | Ga0070712_100301139 | 3300006175 | Bacteria | 1298 |
| 121 | Ga0070712_100516575 | 3300006175 | Bacteria | 1003 |
| 122 | Ga0070712_100547046 | 3300006175 | Bacteria | 975 |
| 123 | Ga0070712_100549566 | 3300006175 | Bacteria | 973 |
| 124 | Ga0070712_100666252 | 3300006175 | Bacteria | 885 |
| 125 | Ga0070712_101204804 | 3300006175 | Bacteria | 659 |
| 126 | Ga0075367_10571294 | 3300006178 | Bacteria | 718 |
| 127 | Ga0097621_100432036 | 3300006237 | Bacteria | 1184 |
| 128 | Ga0075370_10051939 | 3300006353 | Bacteria | 2325 |
| 129 | Ga0068871_100942453 | 3300006358 | Bacteria | 802 |
| 130 | Ga0068871_101722270 | 3300006358 | Unclassified | 595 |
| 131 | Ga0075430_100578150 | 3300006846 | Bacteria | 927 |
| 132 | Ga0075433_10970269 | 3300006852 | Bacteria | 741 |
| 133 | Ga0075434_100010482 | 3300006871 | Bacteria | 8689 |
| 134 | Ga0075434_100474267 | 3300006871 | Bacteria | 1273 |
| 135 | Ga0075434_101513365 | 3300006871 | Bacteria | 680 |
| 136 | Ga0068865_101096509 | 3300006881 | Bacteria | 701 |
| 137 | Ga0075436_100310780 | 3300006914 | Bacteria | 1131 |
| 138 | Ga0075436_100530828 | 3300006914 | Bacteria | 863 |
| 139 | Ga0097620_100696027 | 3300006931 | Bacteria | 1107 |
| 140 | Ga0097620_101747532 | 3300006931 | Bacteria | 687 |
| 141 | Ga0097620_102880359 | 3300006931 | Bacteria | 527 |
| 142 | Ga0075435_100073084 | 3300007076 | Bacteria | 2803 |
| 143 | Ga0105244_10066873 | 3300009036 | Bacteria | 1799 |
| 144 | Ga0105244_10067876 | 3300009036 | Bacteria | 1783 |
| 145 | Ga0105244_10244746 | 3300009036 | Bacteria | 837 |
| 146 | Ga0105244_10254047 | 3300009036 | Bacteria | 819 |
| 147 | Ga0105244_10295608 | 3300009036 | Bacteria | 750 |
| 148 | Ga0105240_10137719 | 3300009093 | Bacteria | 2921 |
| 149 | Ga0105240_10143402 | 3300009093 | Bacteria | 2853 |
| 150 | Ga0105245_10050785 | 3300009098 | Bacteria | 3718 |
| 151 | Ga0105245_10206250 | 3300009098 | Bacteria | 1890 |
| 152 | Ga0105245_10850356 | 3300009098 | Bacteria | 952 |
| 153 | Ga0105245_10963770 | 3300009098 | Bacteria | 896 |
| 154 | Ga0105245_11710653 | 3300009098 | Bacteria | 681 |
| 155 | Ga0114129_10678794 | 3300009147 | Bacteria | 1326 |
| 156 | Ga0114129_11356756 | 3300009147 | Bacteria | 879 |
| 157 | Ga0105243_10235565 | 3300009148 | Bacteria | 1626 |
| 158 | Ga0105243_10347438 | 3300009148 | Bacteria | 1361 |
| 159 | Ga0105241_11131327 | 3300009174 | Bacteria | 739 |
| 160 | Ga0105249_10777399 | 3300009553 | Bacteria | 1021 |
| 161 | Ga0099796_10079320 | 3300010159 | Bacteria | 1201 |
| 162 | Ga0105239_10087646 | 3300010375 | Bacteria | 3432 |
| 163 | Ga0105239_10280211 | 3300010375 | Bacteria | 1877 |
| 164 | Ga0105239_10442865 | 3300010375 | Bacteria | 1473 |
| 165 | Ga0105239_10663907 | 3300010375 | Bacteria | 1191 |
| 166 | Ga0105246_10106845 | 3300011119 | Bacteria | 2048 |
| 167 | Ga0157373_10092954 | 3300013100 | Bacteria | 2124 |
| 168 | Ga0157373_10333166 | 3300013100 | Bacteria | 1081 |
| 169 | Ga0157370_10232952 | 3300013104 | Bacteria | 1704 |
| 170 | Ga0157370_10635829 | 3300013104 | Bacteria | 976 |
| 171 | Ga0157369_10001705 | 3300013105 | Bacteria | 26767 |
| 172 | Ga0157369_10083907 | 3300013105 | Bacteria | 3406 |
| 173 | Ga0157369_10881608 | 3300013105 | Bacteria | 918 |
| 174 | Ga0157369_11473599 | 3300013105 | Bacteria | 692 |
| 175 | Ga0157374_10398806 | 3300013296 | Bacteria | 1372 |
| 176 | Ga0157374_10603194 | 3300013296 | Bacteria | 1108 |
| 177 | Ga0157374_10796494 | 3300013296 | Bacteria | 961 |
| 178 | Ga0157378_10696848 | 3300013297 | Bacteria | 1035 |
| 179 | Ga0163162_10111189 | 3300013306 | Bacteria | 2837 |
| 180 | Ga0163162_10280707 | 3300013306 | Bacteria | 1797 |
| 181 | Ga0157372_10514212 | 3300013307 | Bacteria | 1396 |
| 182 | Ga0157372_10518521 | 3300013307 | Bacteria | 1389 |
| 183 | Ga0157372_10545351 | 3300013307 | Bacteria | 1352 |
| 184 | Ga0157372_12743535 | 3300013307 | Bacteria | 565 |
| 185 | Ga0157375_10157691 | 3300013308 | Bacteria | 2409 |
| 186 | Ga0157375_11747635 | 3300013308 | Bacteria | 737 |
| 187 | Ga0157375_12432569 | 3300013308 | Bacteria | 625 |
| 188 | Ga0163163_10135311 | 3300014325 | Bacteria | 2506 |
| 189 | Ga0182008_10001466 | 3300014497 | Bacteria | 15780 |
| 190 | Ga0182008_10097424 | 3300014497 | Bacteria | 1452 |
| 191 | Ga0182008_10114716 | 3300014497 | Bacteria | 1336 |
| 192 | Ga0182008_10207292 | 3300014497 | Bacteria | 999 |
| 193 | Ga0182008_10863289 | 3300014497 | Bacteria | 530 |
| 194 | Ga0157377_10144771 | 3300014745 | Unclassified | 1464 |
| 195 | Ga0157379_10130266 | 3300014968 | Bacteria | 2264 |
| 196 | Ga0157379_10132046 | 3300014968 | Bacteria | 2248 |
| 197 | Ga0157376_10029224 | 3300014969 | Bacteria | 4390 |
| 198 | Ga0157376_10592602 | 3300014969 | Bacteria | 1102 |
| 199 | Ga0182006_1007203 | 3300015261 | Bacteria | 5108 |
| 200 | Ga0182007_10004451 | 3300015262 | Bacteria | 6349 |
| 201 | Ga0206356_11611016 | 3300020070 | Bacteria | 2457 |
| 202 | Ga0206353_10273639 | 3300020082 | Bacteria | 925 |
| 203 | Ga0206353_11455085 | 3300020082 | Bacteria | 1905 |
| 204 | Ga0206353_11561108 | 3300020082 | Bacteria | 2178 |
| 205 | Ga0213874_10111245 | 3300021377 | Bacteria | 921 |
| 206 | Ga0213876_10062078 | 3300021384 | Bacteria | 1972 |
| 207 | Ga0209051_1007701 | 3300025303 | Bacteria | 5843 |
| 208 | Ga0207697_10026395 | 3300025315 | Bacteria | 2374 |
| 209 | Ga0207655_1022908 | 3300025728 | Bacteria | 3113 |
| 210 | Ga0207655_1149994 | 3300025728 | Bacteria | 738 |
| 211 | Ga0207692_10298891 | 3300025898 | Bacteria | 979 |
| 212 | Ga0207699_10100419 | 3300025906 | Bacteria | 1835 |
| 213 | Ga0207699_10332785 | 3300025906 | Bacteria | 1068 |
| 214 | Ga0207699_10447098 | 3300025906 | Bacteria | 926 |
| 215 | Ga0207699_11085582 | 3300025906 | Bacteria | 592 |
| 216 | Ga0207705_10459886 | 3300025909 | Bacteria | 987 |
| 217 | Ga0207684_10446897 | 3300025910 | Bacteria | 1110 |
| 218 | Ga0207654_10266740 | 3300025911 | Bacteria | 1153 |
| 219 | Ga0207654_10507839 | 3300025911 | Bacteria | 852 |
| 220 | Ga0207707_10021653 | 3300025912 | Bacteria | 5618 |
| 221 | Ga0207707_10049626 | 3300025912 | Bacteria | 3656 |
| 222 | Ga0207707_10093154 | 3300025912 | Bacteria | 2632 |
| 223 | Ga0207707_10224920 | 3300025912 | Bacteria | 1633 |
| 224 | Ga0207707_10411547 | 3300025912 | Bacteria | 1160 |
| 225 | Ga0207707_11482503 | 3300025912 | Bacteria | 538 |
| 226 | Ga0207695_10051170 | 3300025913 | Bacteria | 4339 |
| 227 | Ga0207693_10001153 | 3300025915 | Bacteria | 23583 |
| 228 | Ga0207693_10186864 | 3300025915 | Bacteria | 1631 |
| 229 | Ga0207693_10251905 | 3300025915 | Bacteria | 1385 |
| 230 | Ga0207693_10436574 | 3300025915 | Bacteria | 1023 |
| 231 | Ga0207693_10481581 | 3300025915 | Bacteria | 969 |
| 232 | Ga0207663_10210069 | 3300025916 | Bacteria | 1410 |
| 233 | Ga0207660_10012489 | 3300025917 | Bacteria | 5558 |
| 234 | Ga0207660_10224532 | 3300025917 | Bacteria | 1475 |
| 235 | Ga0207660_10296727 | 3300025917 | Bacteria | 1286 |
| 236 | Ga0207660_10644210 | 3300025917 | Bacteria | 864 |
| 237 | Ga0207657_10001428 | 3300025919 | Bacteria | 25498 |
| 238 | Ga0207657_10001687 | 3300025919 | Bacteria | 23810 |
| 239 | Ga0207657_10007626 | 3300025919 | Bacteria | 11074 |
| 240 | Ga0207657_10683601 | 3300025919 | Bacteria | 798 |
| 241 | Ga0207649_10195631 | 3300025920 | Bacteria | 1425 |
| 242 | Ga0207649_10612145 | 3300025920 | Bacteria | 838 |
| 243 | Ga0207652_10005412 | 3300025921 | Bacteria | 10355 |
| 244 | Ga0207652_10087174 | 3300025921 | Bacteria | 2738 |
| 245 | Ga0207652_10356170 | 3300025921 | Bacteria | 1321 |
| 246 | Ga0207646_10001749 | 3300025922 | Bacteria | 26367 |
| 247 | Ga0207646_10287354 | 3300025922 | Bacteria | 1486 |
| 248 | Ga0207694_10647648 | 3300025924 | Bacteria | 890 |
| 249 | Ga0207687_10012917 | 3300025927 | Bacteria | 5457 |
| 250 | Ga0207687_10038612 | 3300025927 | Bacteria | 3264 |
| 251 | Ga0207687_10110279 | 3300025927 | Bacteria | 2040 |
| 252 | Ga0207700_10551032 | 3300025928 | Bacteria | 1024 |
| 253 | Ga0207700_10778778 | 3300025928 | Bacteria | 855 |
| 254 | Ga0207664_10247144 | 3300025929 | Bacteria | 1555 |
| 255 | Ga0207664_10294721 | 3300025929 | Bacteria | 1426 |
| 256 | Ga0207664_10395005 | 3300025929 | Bacteria | 1229 |
| 257 | Ga0207664_10411009 | 3300025929 | Bacteria | 1204 |
| 258 | Ga0207664_10430610 | 3300025929 | Bacteria | 1176 |
| 259 | Ga0207664_10441026 | 3300025929 | Bacteria | 1161 |
| 260 | Ga0207664_10504307 | 3300025929 | Bacteria | 1084 |
| 261 | Ga0207664_10608614 | 3300025929 | Bacteria | 981 |
| 262 | Ga0207644_10417302 | 3300025931 | Bacteria | 1099 |
| 263 | Ga0207690_10086348 | 3300025932 | Bacteria | 2205 |
| 264 | Ga0207690_11076895 | 3300025932 | Bacteria | 670 |
| 265 | Ga0207706_11357169 | 3300025933 | Unclassified | 585 |
| 266 | Ga0207686_10066329 | 3300025934 | Bacteria | 2305 |
| 267 | Ga0207686_10179216 | 3300025934 | Bacteria | 1501 |
| 268 | Ga0207709_10291626 | 3300025935 | Bacteria | 1209 |
| 269 | Ga0207669_10127478 | 3300025937 | Bacteria | 1742 |
| 270 | Ga0207665_10229432 | 3300025939 | Bacteria | 1364 |
| 271 | Ga0207665_10335294 | 3300025939 | Bacteria | 1138 |
| 272 | Ga0207665_11091640 | 3300025939 | Bacteria | 636 |
| 273 | Ga0207691_10284355 | 3300025940 | Bacteria | 1423 |
| 274 | Ga0207661_10010057 | 3300025944 | Bacteria | 6798 |
| 275 | Ga0207661_10217090 | 3300025944 | Bacteria | 1689 |
| 276 | Ga0207661_10582051 | 3300025944 | Bacteria | 1027 |
| 277 | Ga0207661_10610915 | 3300025944 | Bacteria | 1001 |
| 278 | Ga0207667_10170076 | 3300025949 | Bacteria | 2240 |
| 279 | Ga0207667_11915290 | 3300025949 | Bacteria | 555 |
| 280 | Ga0207651_10354739 | 3300025960 | Bacteria | 1236 |
| 281 | Ga0207640_10060215 | 3300025981 | Bacteria | 2509 |
| 282 | Ga0207640_10187737 | 3300025981 | Bacteria | 1555 |
| 283 | Ga0207658_10981288 | 3300025986 | Bacteria | 770 |
| 284 | Ga0207677_10053006 | 3300026023 | Bacteria | 2759 |
| 285 | Ga0207639_10732602 | 3300026041 | Bacteria | 918 |
| 286 | Ga0207639_11252790 | 3300026041 | Bacteria | 696 |
| 287 | Ga0207702_10006575 | 3300026078 | Bacteria | 9992 |
| 288 | Ga0207702_10047637 | 3300026078 | Bacteria | 3613 |
| 289 | Ga0207702_10153290 | 3300026078 | Bacteria | 2098 |
| 290 | Ga0207702_10376836 | 3300026078 | Bacteria | 1364 |
| 291 | Ga0207674_10059519 | 3300026116 | Bacteria | 3865 |
| 292 | Ga0207674_10329595 | 3300026116 | Bacteria | 1476 |
| 293 | Ga0207674_11635587 | 3300026116 | Bacteria | 612 |
| 294 | Ga0207683_10011493 | 3300026121 | Bacteria | 7557 |
| 295 | Ga0207683_11091440 | 3300026121 | Bacteria | 740 |
| 296 | Ga0207683_11128835 | 3300026121 | Bacteria | 727 |
| 297 | Ga0207698_10499511 | 3300026142 | Bacteria | 1183 |
| 298 | Ga0207428_10277835 | 3300027907 | Bacteria | 1244 |
| 299 | Ga0265337_1077255 | 3300028556 | Bacteria | 912 |
| 300 | Ga0265318_10054781 | 3300028577 | Bacteria | 1494 |
| 301 | Ga0265336_10085283 | 3300028666 | Bacteria | 942 |
| 302 | Ga0307515_10075561 | 3300028794 | Bacteria | 4487 |
| 303 | Ga0265338_10556829 | 3300028800 | Bacteria | 802 |
| 304 | Ga0265339_10053110 | 3300031249 | Bacteria | 2204 |
| 305 | Ga0265339_10103998 | 3300031249 | Bacteria | 1475 |
| 306 | Ga0265331_10297922 | 3300031250 | Bacteria | 722 |
| 307 | Ga0265327_10000019 | 3300031251 | Bacteria | 427653 |
| 308 | Ga0265327_10082755 | 3300031251 | Bacteria | 1581 |
| 309 | Ga0265316_10678566 | 3300031344 | Bacteria | 727 |
| 310 | Ga0265313_10024742 | 3300031595 | Bacteria | 3199 |
| 311 | Ga0265313_10106139 | 3300031595 | Bacteria | 1240 |
| 312 | Ga0307410_10165272 | 3300031852 | Bacteria | 1662 |
| 313 | Ga0307410_10575153 | 3300031852 | Bacteria | 937 |
| 314 | Ga0307410_11948196 | 3300031852 | Bacteria | 524 |
| 315 | Ga0307412_10222624 | 3300031911 | Bacteria | 1447 |
| 316 | Ga0307409_101371724 | 3300031995 | Bacteria | 733 |
| 317 | Ga0307415_100281302 | 3300032126 | Bacteria | 1368 |
| 318 | Ga0373938_0005377 | 3300034957 | Bacteria | 2176 |
| 319 | Ga0373941_0306021 | 3300035115 | Bacteria | 636 |
| 320 | Ga0373957_0136891 | 3300035120 | Bacteria | 1000 |
| 321 | Ga0373943_0168160 | 3300035170 | Bacteria | 1198 |
| 322 | Ga0373955_0256220 | 3300035172 | Bacteria | 1050 |
| 323 | Ga0373924_0294272 | 3300035410 | Bacteria | 721 |
| 324 | Ga0373931_0199791 | 3300035691 | Bacteria | 1194 |
| 325 | Ga0373937_0000447 | 3300036401 | Bacteria | 38075 |
| 326 | Ga0373937_0359013 | 3300036401 | Bacteria | 1381 |
| 327 | Ga0373937_0766363 | 3300036401 | Bacteria | 912 |
| 328 | Ga0373925_0807104 | 3300037068 | Bacteria | 774 |
| 329 | Ga0395899_0036333 | 3300037312 | Bacteria | 3696 |
| 330 | Ga0395899_0355945 | 3300037312 | Bacteria | 978 |
| 331 | Ga0395900_0087940 | 3300037418 | Bacteria | 3194 |
| 332 | Ga0395900_0161246 | 3300037418 | Bacteria | 2287 |
| 333 | Ga0395900_0173599 | 3300037418 | Bacteria | 2193 |
| 334 | Ga0395900_1604034 | 3300037418 | Bacteria | 562 |
| 335 | Ga0395898_0138416 | 3300037466 | Bacteria | 2331 |
| 336 | Ga0395898_0213814 | 3300037466 | Unclassified | 1839 |
| 337 | Ga0395898_0254767 | 3300037466 | Bacteria | 1674 |
| 338 | Ga0395898_0755068 | 3300037466 | Bacteria | 914 |
| 339 | Ga0395898_1637765 | 3300037466 | Bacteria | 567 |
| 340 | Ga0395898_1641664 | 3300037466 | Bacteria | 566 |
| 341 | Ga0395905_0059446 | 3300037471 | Bacteria | 3573 |
| 342 | Ga0395905_0260892 | 3300037471 | Bacteria | 1618 |
| 343 | Ga0395905_1777294 | 3300037471 | Bacteria | 522 |
| 344 | Ga0436364_1204968 | 3300037853 | Bacteria | 1039 |
| 345 | Ga0395901_0019380 | 3300038443 | Bacteria | 6956 |
| 346 | Ga0395901_0190108 | 3300038443 | Bacteria | 2153 |
| 347 | Ga0395901_0660297 | 3300038443 | Bacteria | 1048 |
| 348 | Ga0395901_0793231 | 3300038443 | Bacteria | 937 |
| 349 | Ga0436365_0960298 | 3300039437 | Bacteria | 2175 |
| 350 | Ga0436360_0782260 | 3300039438 | Bacteria | 2005 |
| 351 | Ga0436363_0412008 | 3300039450 | Bacteria | 1072 |
| 352 | Ga0436363_0850823 | 3300039450 | Bacteria | 1076 |
| 353 | Ga0439458_0076481 | 3300042157 | Bacteria | 850 |
| 354 | Ga0451577_0338639 | 3300042876 | Bacteria | 1364 |
| 355 | Ga0466965_0104936 | 3300044683 | Bacteria | 1448 |
| 356 | Ga0466965_0417980 | 3300044683 | Bacteria | 743 |
| 357 | Ga0466966_0016294 | 3300044684 | Bacteria | 4915 |
| 358 | Ga0466961_0027058 | 3300044693 | Bacteria | 3687 |
| 359 | Ga0466961_0037049 | 3300044693 | Bacteria | 3130 |
| 360 | Ga0466961_0188676 | 3300044693 | Bacteria | 1278 |
| 361 | Ga0466961_0189804 | 3300044693 | Bacteria | 1274 |
| 362 | Ga0466963_0000619 | 3300044694 | Bacteria | 17041 |
| 363 | Ga0466963_0000941 | 3300044694 | Bacteria | 14889 |
| 364 | Ga0466963_0002309 | 3300044694 | Bacteria | 10613 |
| 365 | Ga0466963_0009360 | 3300044694 | Bacteria | 5898 |
| 366 | Ga0466963_0010180 | 3300044694 | Bacteria | 5685 |
| 367 | Ga0466963_0017156 | 3300044694 | Bacteria | 4509 |
| 368 | Ga0466963_0018386 | 3300044694 | Bacteria | 4369 |
| 369 | Ga0466963_0041717 | 3300044694 | Bacteria | 3010 |
| 370 | Ga0466963_0045895 | 3300044694 | Bacteria | 2879 |
| 371 | Ga0466963_0047009 | 3300044694 | Bacteria | 2848 |
| 372 | Ga0466963_0114958 | 3300044694 | Bacteria | 1849 |
| 373 | Ga0466963_0133894 | 3300044694 | Bacteria | 1714 |
| 374 | Ga0466963_0146303 | 3300044694 | Bacteria | 1639 |
| 375 | Ga0466963_0430317 | 3300044694 | Bacteria | 931 |
| 376 | Ga0466963_0546250 | 3300044694 | Bacteria | 818 |
| 377 | Ga0466963_0692644 | 3300044694 | Bacteria | 719 |
| 378 | Ga0466964_0010167 | 3300044706 | Bacteria | 3547 |
| 379 | Ga0466964_0061509 | 3300044706 | Bacteria | 1564 |
| 380 | Ga0466964_0125804 | 3300044706 | Bacteria | 1161 |
| 381 | Ga0466964_0128977 | 3300044706 | Bacteria | 1149 |
| 382 | Ga0466964_0214264 | 3300044706 | Bacteria | 932 |
| 383 | Ga0466964_0231695 | 3300044706 | Bacteria | 902 |
| 384 | Ga0466964_0391712 | 3300044706 | Bacteria | 724 |
| 385 | Ga0466964_0602837 | 3300044706 | Bacteria | 602 |
| 386 | Ga0466971_0023171 | 3300044719 | Bacteria | 2767 |
| 387 | Ga0466971_0049863 | 3300044719 | Bacteria | 1884 |
| 388 | Ga0466971_0110788 | 3300044719 | Bacteria | 1266 |
| 389 | Ga0466971_0292237 | 3300044719 | Bacteria | 781 |
| 390 | Ga0466968_0008788 | 3300044735 | Bacteria | 3875 |
| 391 | Ga0466968_0035404 | 3300044735 | Bacteria | 2089 |
| 392 | Ga0466968_0062218 | 3300044735 | Bacteria | 1611 |
| 393 | Ga0466968_0075890 | 3300044735 | Bacteria | 1470 |
| 394 | Ga0466968_0337128 | 3300044735 | Bacteria | 731 |
| 395 | Ga0466970_0352271 | 3300044765 | Unclassified | 835 |
| 396 | Ga0466970_0364527 | 3300044765 | Bacteria | 821 |
| 397 | Ga0466957_0003145 | 3300044842 | Bacteria | 8992 |
| 398 | Ga0466957_0005881 | 3300044842 | Bacteria | 6914 |
| 399 | Ga0466957_0006804 | 3300044842 | Bacteria | 6458 |
| 400 | Ga0466957_0668594 | 3300044842 | Bacteria | 731 |
| 401 | Ga0466957_0721657 | 3300044842 | Bacteria | 704 |
| 402 | Ga0466957_1413363 | 3300044842 | Bacteria | 507 |
| 403 | Ga0466960_0126969 | 3300044901 | Bacteria | 1342 |
| 404 | Ga0466960_0168758 | 3300044901 | Bacteria | 1180 |
| 405 | Ga0466960_0290699 | 3300044901 | Bacteria | 918 |
| 406 | Ga0466960_0402595 | 3300044901 | Bacteria | 789 |
| 407 | Ga0466959_0010855 | 3300045049 | Bacteria | 6530 |
| 408 | Ga0466959_0028656 | 3300045049 | Bacteria | 4129 |
| 409 | Ga0466959_0113440 | 3300045049 | Bacteria | 1932 |
| 410 | Ga0466959_0400227 | 3300045049 | Bacteria | 933 |
| 411 | Ga0466958_0000905 | 3300045836 | Bacteria | 13318 |
| 412 | Ga0466958_0025112 | 3300045836 | Bacteria | 3509 |
| 413 | Ga0466958_0027856 | 3300045836 | Bacteria | 3345 |
| 414 | Ga0466958_0032128 | 3300045836 | Bacteria | 3122 |
| 415 | Ga0466958_0047069 | 3300045836 | Bacteria | 2603 |
| 416 | Ga0466958_0175988 | 3300045836 | Bacteria | 1356 |
| 417 | Ga0466958_0814503 | 3300045836 | Bacteria | 609 |
| 418 | Ga0466967_0000047 | 3300045976 | Bacteria | 43648 |
| 419 | Ga0466967_0003348 | 3300045976 | Bacteria | 10425 |
| 420 | Ga0466967_0009506 | 3300045976 | Bacteria | 7218 |
| 421 | Ga0466967_0015841 | 3300045976 | Bacteria | 5925 |
| 422 | Ga0466967_0027857 | 3300045976 | Bacteria | 4707 |
| 423 | Ga0466967_0081915 | 3300045976 | Bacteria | 2915 |
| 424 | Ga0466967_0083772 | 3300045976 | Bacteria | 2884 |
| 425 | Ga0466967_0088224 | 3300045976 | Bacteria | 2814 |
| 426 | Ga0466967_0094609 | 3300045976 | Bacteria | 2721 |
| 427 | Ga0466967_0099927 | 3300045976 | Bacteria | 2650 |
| 428 | Ga0466967_0133760 | 3300045976 | Bacteria | 2304 |
| 429 | Ga0466967_0161527 | 3300045976 | Bacteria | 2103 |
| 430 | Ga0466967_0174191 | 3300045976 | Bacteria | 2026 |
| 431 | Ga0466967_0206357 | 3300045976 | Bacteria | 1863 |
| 432 | Ga0466967_0225011 | 3300045976 | Bacteria | 1784 |
| 433 | Ga0466967_0233958 | 3300045976 | Bacteria | 1750 |
| 434 | Ga0466967_0247582 | 3300045976 | Bacteria | 1701 |
| 435 | Ga0466967_0254254 | 3300045976 | Bacteria | 1679 |
| 436 | Ga0466967_0315804 | 3300045976 | Bacteria | 1506 |
| 437 | Ga0466967_0365638 | 3300045976 | Bacteria | 1398 |
| 438 | Ga0466967_0420787 | 3300045976 | Bacteria | 1302 |
| 439 | Ga0466967_0423043 | 3300045976 | Bacteria | 1298 |
| 440 | Ga0466967_0471780 | 3300045976 | Bacteria | 1228 |
| 441 | Ga0466967_0567025 | 3300045976 | Bacteria | 1118 |
| 442 | Ga0466967_0607760 | 3300045976 | Bacteria | 1079 |
| 443 | Ga0466967_0677697 | 3300045976 | Bacteria | 1020 |
| 444 | Ga0466967_0760020 | 3300045976 | Bacteria | 961 |
| 445 | Ga0466967_0985161 | 3300045976 | Bacteria | 839 |
| 446 | Ga0466967_0994936 | 3300045976 | Bacteria | 835 |
| 447 | Ga0466967_1574578 | 3300045976 | Bacteria | 654 |
| 448 | Ga0495592_0000124 | 3300046454 | Bacteria | 68396 |
| 449 | Ga0495592_0005934 | 3300046454 | Bacteria | 9068 |
| 450 | Ga0495629_0018477 | 3300046459 | Bacteria | 4990 |
| 451 | Ga0495629_0054231 | 3300046459 | Bacteria | 2804 |
| 452 | Ga0495629_0091290 | 3300046459 | Bacteria | 2125 |
| 453 | Ga0495629_0119877 | 3300046459 | Bacteria | 1833 |
| 454 | Ga0495641_0061747 | 3300046461 | Bacteria | 1691 |
| 455 | Ga0495641_0167076 | 3300046461 | Bacteria | 984 |
| 456 | Ga0495641_0490213 | 3300046461 | Bacteria | 560 |
| 457 | Ga0495651_0000011 | 3300046462 | Bacteria | 147193 |
| 458 | Ga0495651_0051489 | 3300046462 | Bacteria | 3174 |
| 459 | Ga0495653_0001296 | 3300046463 | Bacteria | 19369 |
| 460 | Ga0495653_0029348 | 3300046463 | Bacteria | 4392 |
| 461 | Ga0495653_0088373 | 3300046463 | Bacteria | 2274 |
| 462 | Ga0495653_0429942 | 3300046463 | Bacteria | 834 |
| 463 | Ga0495653_0836853 | 3300046463 | Bacteria | 551 |
| 464 | Ga0495582_0044089 | 3300046473 | Bacteria | 2457 |
| 465 | Ga0495582_0044325 | 3300046473 | Bacteria | 2450 |
| 466 | Ga0495582_0703280 | 3300046473 | Bacteria | 585 |
| 467 | Ga0495605_0057857 | 3300046474 | Bacteria | 1865 |
| 468 | Ga0495662_0277897 | 3300046476 | Bacteria | 824 |
| 469 | Ga0495664_0026457 | 3300046477 | Bacteria | 3378 |
| 470 | Ga0495664_0086913 | 3300046477 | Bacteria | 1878 |
| 471 | Ga0495664_0193177 | 3300046477 | Bacteria | 1234 |
| 472 | Ga0495584_0033026 | 3300046491 | Bacteria | 2618 |
| 473 | Ga0495584_0054947 | 3300046491 | Bacteria | 2004 |
| 474 | Ga0495596_0081735 | 3300046500 | Bacteria | 1254 |
| 475 | Ga0495607_0073552 | 3300046501 | Bacteria | 1899 |
| 476 | Ga0495608_0002975 | 3300046511 | Bacteria | 12113 |
| 477 | Ga0495608_0674450 | 3300046511 | Bacteria | 616 |
| 478 | Ga0495618_0001100 | 3300046514 | Bacteria | 18323 |
| 479 | Ga0495618_0405186 | 3300046514 | Bacteria | 833 |
| 480 | Ga0495628_0000024 | 3300046516 | Bacteria | 130196 |
| 481 | Ga0495628_0007684 | 3300046516 | Bacteria | 9321 |
| 482 | Ga0495628_0657831 | 3300046516 | Bacteria | 743 |
| 483 | Ga0495630_0007053 | 3300046517 | Bacteria | 8007 |
| 484 | Ga0495630_0305053 | 3300046517 | Bacteria | 1217 |
| 485 | Ga0495630_0361031 | 3300046517 | Bacteria | 1112 |
| 486 | Ga0495630_0765446 | 3300046517 | Bacteria | 738 |
| 487 | Ga0495644_0162856 | 3300046523 | Bacteria | 855 |
| 488 | Ga0495652_0000050 | 3300046529 | Bacteria | 120480 |
| 489 | Ga0495652_0551437 | 3300046529 | Bacteria | 792 |
| 490 | Ga0495652_0629466 | 3300046529 | Bacteria | 729 |
| 491 | Ga0495640_0035591 | 3300046533 | Bacteria | 3523 |
| 492 | Ga0495640_0132257 | 3300046533 | Bacteria | 1614 |
| 493 | Ga0495586_0217644 | 3300046535 | Bacteria | 1085 |
| 494 | Ga0495587_0000084 | 3300046536 | Bacteria | 72926 |
| 495 | Ga0495587_0284945 | 3300046536 | Bacteria | 925 |
| 496 | Ga0495587_0384105 | 3300046536 | Bacteria | 781 |
| 497 | Ga0495645_0000067 | 3300046543 | Bacteria | 73037 |
| 498 | Ga0495645_0018585 | 3300046543 | Bacteria | 4994 |
| 499 | Ga0495645_0168116 | 3300046543 | Bacteria | 1511 |
| 500 | Ga0495645_0826044 | 3300046543 | Bacteria | 554 |
| 501 | Ga0495667_0040389 | 3300046559 | Bacteria | 3098 |
| 502 | Ga0495667_0211639 | 3300046559 | Bacteria | 1239 |
| 503 | Ga0495667_0270481 | 3300046559 | Bacteria | 1080 |
| 504 | Ga0495667_0320907 | 3300046559 | Bacteria | 980 |
| 505 | Ga0495656_0070587 | 3300046615 | Bacteria | 1550 |
| 506 | Ga0495668_0478916 | 3300046616 | Bacteria | 686 |
| 507 | Ga0495634_0010896 | 3300046642 | Bacteria | 6638 |
| 508 | Ga0495634_0117873 | 3300046642 | Bacteria | 1702 |
| 509 | Ga0495635_0085700 | 3300046663 | Bacteria | 2155 |
| 510 | Ga0495635_0188271 | 3300046663 | Bacteria | 1401 |
| 511 | Ga0495635_0394940 | 3300046663 | Bacteria | 919 |
| 512 | Ga0495635_0562334 | 3300046663 | Bacteria | 747 |
| 513 | Ga0495588_0363789 | 3300046674 | Bacteria | 760 |
| 514 | Ga0495657_0049553 | 3300046675 | Bacteria | 2828 |
| 515 | Ga0495657_0207180 | 3300046675 | Bacteria | 1193 |
| 516 | Ga0495657_0217952 | 3300046675 | Bacteria | 1158 |
| 517 | Ga0495657_0526864 | 3300046675 | Bacteria | 687 |
| 518 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 519 | Ga0495599_0561272 | 3300046678 | Bacteria | 668 |
| 520 | Ga0495599_0661612 | 3300046678 | Bacteria | 604 |
| 521 | Ga0495623_0000219 | 3300046679 | Bacteria | 36687 |
| 522 | Ga0495623_0134609 | 3300046679 | Bacteria | 1476 |
| 523 | Ga0495646_0015895 | 3300046680 | Bacteria | 4777 |
| 524 | Ga0495647_0032452 | 3300046681 | Bacteria | 1946 |
| 525 | Ga0495647_0094057 | 3300046681 | Bacteria | 1233 |
| 526 | Ga0495658_0085513 | 3300046683 | Bacteria | 1859 |
| 527 | Ga0495658_0126474 | 3300046683 | Bacteria | 1551 |
| 528 | Ga0495658_0734553 | 3300046683 | Bacteria | 632 |
| 529 | Ga0495613_0000613 | 3300046689 | Bacteria | 28456 |
| 530 | Ga0495613_0446093 | 3300046689 | Bacteria | 877 |
| 531 | Ga0495613_0742844 | 3300046689 | Bacteria | 643 |
| 532 | Ga0495624_0091606 | 3300046690 | Bacteria | 1875 |
| 533 | Ga0495624_0235883 | 3300046690 | Bacteria | 1107 |
| 534 | Ga0495670_0042596 | 3300046691 | Bacteria | 2265 |
| 535 | Ga0495671_0314823 | 3300046692 | Bacteria | 752 |
| 536 | Ga0495589_0056674 | 3300046794 | Bacteria | 1929 |
| 537 | Ga0495600_0012552 | 3300046809 | Bacteria | 5301 |
| 538 | Ga0495600_0121076 | 3300046809 | Bacteria | 1702 |
| 539 | Ga0495600_0149478 | 3300046809 | Bacteria | 1513 |
| 540 | Ga0495600_0265626 | 3300046809 | Bacteria | 1089 |
| 541 | Ga0495604_0000334 | 3300047317 | Bacteria | 42026 |
| 542 | Ga0495604_0350213 | 3300047317 | Bacteria | 981 |
| 543 | Ga0495636_0087069 | 3300047318 | Bacteria | 1352 |
| 544 | Ga0495674_0156774 | 3300047319 | Bacteria | 1907 |
| 545 | Ga0495674_0203737 | 3300047319 | Bacteria | 1641 |
| 546 | Ga0495674_0244002 | 3300047319 | Bacteria | 1479 |
| 547 | Ga0495674_0514853 | 3300047319 | Bacteria | 956 |
| 548 | Ga0495676_0042115 | 3300047321 | Bacteria | 3752 |
| 549 | Ga0495680_0008157 | 3300047322 | Bacteria | 9546 |
| 550 | Ga0495680_0035105 | 3300047322 | Bacteria | 4042 |
| 551 | Ga0495680_0062832 | 3300047322 | Bacteria | 2853 |
| 552 | Ga0495680_0156897 | 3300047322 | Bacteria | 1655 |
| 553 | Ga0495680_0754260 | 3300047322 | Bacteria | 639 |
| 554 | Ga0495683_0229159 | 3300047323 | Bacteria | 825 |
| 555 | Ga0495675_0000757 | 3300047444 | Bacteria | 20228 |
| 556 | Ga0495684_0053089 | 3300047471 | Bacteria | 3092 |
| 557 | Ga0495593_0202275 | 3300047673 | Bacteria | 998 |
| 558 | Ga0495602_0001847 | 3300048088 | Bacteria | 21195 |
| 559 | Ga0495602_0149854 | 3300048088 | Bacteria | 1835 |
| 560 | Ga0495602_0176094 | 3300048088 | Bacteria | 1655 |
| 561 | Ga0496100_0002976 | 3300048903 | Bacteria | 8721 |
| 562 | Ga0496100_0206325 | 3300048903 | Bacteria | 1435 |
| 563 | Ga0496100_0248537 | 3300048903 | Bacteria | 1315 |
| 564 | Ga0496100_0285056 | 3300048903 | Bacteria | 1232 |
| 565 | Ga0496100_0372859 | 3300048903 | Bacteria | 1083 |
| 566 | Ga0496100_0720752 | 3300048903 | Bacteria | 779 |
| 567 | Ga0496101_0007083 | 3300048904 | Bacteria | 7249 |
| 568 | Ga0496101_0052526 | 3300048904 | Bacteria | 2939 |
| 569 | Ga0496101_0089536 | 3300048904 | Bacteria | 2287 |
| 570 | Ga0496101_0218574 | 3300048904 | Bacteria | 1478 |
| 571 | Ga0496101_0388948 | 3300048904 | Bacteria | 1098 |
| 572 | Ga0496102_0007907 | 3300048905 | Bacteria | 9089 |
| 573 | Ga0496102_0288785 | 3300048905 | Bacteria | 1546 |
| 574 | Ga0496102_0696246 | 3300048905 | Bacteria | 939 |
| 575 | Ga0496103_0008543 | 3300048906 | Bacteria | 6086 |
| 576 | Ga0496103_0084990 | 3300048906 | Bacteria | 1994 |
| 577 | Ga0496103_0156749 | 3300048906 | Bacteria | 1460 |
| 578 | Ga0496103_0238836 | 3300048906 | Bacteria | 1169 |
| 579 | Ga0496104_0000444 | 3300048907 | Bacteria | 35985 |
| 580 | Ga0496104_0001528 | 3300048907 | Bacteria | 19957 |
| 581 | Ga0496104_0022323 | 3300048907 | Bacteria | 5813 |
| 582 | Ga0496104_0046686 | 3300048907 | Bacteria | 4080 |
| 583 | Ga0496104_0104066 | 3300048907 | Bacteria | 2720 |
| 584 | Ga0496104_0478634 | 3300048907 | Bacteria | 1156 |
| 585 | Ga0496104_0777201 | 3300048907 | Bacteria | 864 |
| 586 | Ga0496105_0000200 | 3300048908 | Bacteria | 39964 |
| 587 | Ga0496105_0052506 | 3300048908 | Bacteria | 3367 |
| 588 | Ga0496105_0095255 | 3300048908 | Bacteria | 2459 |
| 589 | Ga0496105_0142684 | 3300048908 | Bacteria | 1971 |
| 590 | Ga0496105_0151863 | 3300048908 | Bacteria | 1903 |
| 591 | Ga0496105_0229459 | 3300048908 | Bacteria | 1509 |
| 592 | Ga0496105_0638261 | 3300048908 | Bacteria | 823 |
| 593 | Ga0496106_0018932 | 3300048909 | Bacteria | 5101 |
| 594 | Ga0496106_0025838 | 3300048909 | Bacteria | 4369 |
| 595 | Ga0496106_0052460 | 3300048909 | Bacteria | 3077 |
| 596 | Ga0496106_0100951 | 3300048909 | Bacteria | 2238 |
| 597 | Ga0496106_0131114 | 3300048909 | Bacteria | 1966 |
| 598 | Ga0496107_0090984 | 3300048910 | Bacteria | 2229 |
| 599 | Ga0496107_0169638 | 3300048910 | Bacteria | 1619 |
| 600 | Ga0496108_0002894 | 3300048911 | Bacteria | 13785 |
| 601 | Ga0496108_0012840 | 3300048911 | Bacteria | 6821 |
| 602 | Ga0496108_0020580 | 3300048911 | Bacteria | 5422 |
| 603 | Ga0496108_0034422 | 3300048911 | Bacteria | 4209 |
| 604 | Ga0496108_0091425 | 3300048911 | Bacteria | 2587 |
| 605 | Ga0496108_0101142 | 3300048911 | Bacteria | 2459 |
| 606 | Ga0496108_1033869 | 3300048911 | Bacteria | 700 |
| 607 | Ga0496108_1292132 | 3300048911 | Bacteria | 614 |
| 608 | Ga0496109_0000461 | 3300048912 | Bacteria | 34811 |
| 609 | Ga0496109_0002306 | 3300048912 | Bacteria | 15879 |
| 610 | Ga0496109_0063284 | 3300048912 | Bacteria | 3384 |
| 611 | Ga0496109_0080750 | 3300048912 | Bacteria | 2996 |
| 612 | Ga0496109_0085944 | 3300048912 | Bacteria | 2904 |
| 613 | Ga0496109_0153756 | 3300048912 | Bacteria | 2155 |
| 614 | Ga0496109_0189563 | 3300048912 | Bacteria | 1932 |
| 615 | Ga0496109_0214079 | 3300048912 | Bacteria | 1812 |
| 616 | Ga0496109_0266632 | 3300048912 | Bacteria | 1613 |
| 617 | Ga0496109_0328224 | 3300048912 | Bacteria | 1444 |
| 618 | Ga0496109_1019582 | 3300048912 | Bacteria | 765 |
| 619 | Ga0496110_0001896 | 3300048913 | Bacteria | 15452 |
| 620 | Ga0496110_0002454 | 3300048913 | Bacteria | 13884 |
| 621 | Ga0496110_0025742 | 3300048913 | Bacteria | 5029 |
| 622 | Ga0496110_0055376 | 3300048913 | Bacteria | 3490 |
| 623 | Ga0496110_0066298 | 3300048913 | Bacteria | 3193 |
| 624 | Ga0496110_0099727 | 3300048913 | Bacteria | 2604 |
| 625 | Ga0496110_0130824 | 3300048913 | Bacteria | 2266 |
| 626 | Ga0496110_0833227 | 3300048913 | Bacteria | 827 |
| 627 | Ga0496111_0000113 | 3300048914 | Bacteria | 35668 |
| 628 | Ga0496111_0001148 | 3300048914 | Bacteria | 14704 |
| 629 | Ga0496111_0046713 | 3300048914 | Bacteria | 3118 |
| 630 | Ga0496111_0095951 | 3300048914 | Bacteria | 2176 |
| 631 | Ga0496111_0103571 | 3300048914 | Bacteria | 2093 |
| 632 | Ga0496111_0712775 | 3300048914 | Bacteria | 729 |
| 633 | Ga0496112_0007214 | 3300048915 | Bacteria | 9852 |
| 634 | Ga0496112_0021708 | 3300048915 | Bacteria | 6108 |
| 635 | Ga0496112_0043655 | 3300048915 | Bacteria | 4390 |
| 636 | Ga0496112_0059375 | 3300048915 | Bacteria | 3768 |
| 637 | Ga0496112_0087049 | 3300048915 | Bacteria | 3091 |
| 638 | Ga0496112_0218378 | 3300048915 | Bacteria | 1863 |
| 639 | Ga0496112_0552302 | 3300048915 | Bacteria | 1085 |
| 640 | Ga0496112_0759456 | 3300048915 | Unclassified | 895 |
| 641 | Ga0496112_0769607 | 3300048915 | Bacteria | 888 |
| 642 | Ga0496113_0011013 | 3300048916 | Bacteria | 6010 |
| 643 | Ga0496113_0114155 | 3300048916 | Bacteria | 2106 |
| 644 | Ga0496113_0270762 | 3300048916 | Bacteria | 1357 |
| 645 | Ga0496113_0544535 | 3300048916 | Bacteria | 931 |
| 646 | Ga0496114_0006544 | 3300048917 | Bacteria | 9183 |
| 647 | Ga0496114_0017599 | 3300048917 | Bacteria | 5771 |
| 648 | Ga0496114_0063433 | 3300048917 | Bacteria | 3094 |
| 649 | Ga0496114_0282377 | 3300048917 | Bacteria | 1464 |
| 650 | Ga0496114_0284551 | 3300048917 | Bacteria | 1458 |
| 651 | Ga0496114_0367705 | 3300048917 | Bacteria | 1273 |
| 652 | Ga0496115_0026438 | 3300048918 | Bacteria | 4530 |
| 653 | Ga0496115_0135763 | 3300048918 | Bacteria | 2028 |
| 654 | Ga0496115_0372805 | 3300048918 | Bacteria | 1162 |
| 655 | Ga0496115_0836236 | 3300048918 | Bacteria | 714 |
| 656 | Ga0501032_0008374 | 3300049569 | Bacteria | 7540 |
| 657 | Ga0501034_0000066 | 3300049571 | Bacteria | 184727 |
| 658 | Ga0501034_0006648 | 3300049571 | Bacteria | 12406 |
| 659 | Ga0501037_0031239 | 3300049573 | Bacteria | 3932 |
| 660 | Ga0501039_0545472 | 3300049575 | Bacteria | 910 |
| 661 | Ga0501039_0972832 | 3300049575 | Bacteria | 660 |
| 662 | Ga0501043_0036713 | 3300049579 | Bacteria | 3855 |
| 663 | Ga0501067_0031664 | 3300049583 | Bacteria | 2934 |
| 664 | Ga0501067_0058209 | 3300049583 | Bacteria | 2140 |
| 665 | Ga0501067_0550439 | 3300049583 | Bacteria | 646 |
| 666 | Ga0501068_0183019 | 3300049584 | Bacteria | 1325 |
| 667 | Ga0501068_0391891 | 3300049584 | Bacteria | 895 |
| 668 | Ga0501069_0031128 | 3300049585 | Bacteria | 2933 |
| 669 | Ga0501072_0070348 | 3300049588 | Bacteria | 2763 |
| 670 | Ga0501074_0033384 | 3300049590 | Bacteria | 3729 |
| 671 | Ga0501074_0067418 | 3300049590 | Bacteria | 2574 |
| 672 | Ga0501075_0291100 | 3300049591 | Bacteria | 1244 |
| 673 | Ga0501077_0034255 | 3300049593 | Bacteria | 3232 |
| 674 | Ga0501079_0006416 | 3300049741 | Bacteria | 8831 |
| 675 | Ga0501080_0014355 | 3300049742 | Bacteria | 7293 |
| 676 | Ga0501080_0099693 | 3300049742 | Bacteria | 2695 |
| 677 | Ga0501081_0038156 | 3300049743 | Bacteria | 3280 |
| 678 | Ga0501083_0004631 | 3300049744 | Bacteria | 9713 |
| 679 | nmdc:mga0yw44_449785_c1 | 3300050492 | Bacteria | 873 |
| 680 | nmdc:mga04h51_245862_c1 | 3300050495 | Bacteria | 715 |
| 681 | nmdc:mga07m45_181143_c1 | 3300050496 | Bacteria | 1225 |
| 682 | nmdc:mga0n895_1570166_c1 | 3300050512 | Bacteria | 623 |
| 683 | nmdc:mga0n895_1616808_c1 | 3300050512 | Bacteria | 612 |
| 684 | nmdc:mga0n895_467221_c1 | 3300050512 | Bacteria | 1273 |
| 685 | nmdc:mga0n895_76263_c1 | 3300050512 | Bacteria | 3334 |
| 686 | nmdc:mga0rr50_248895_c1 | 3300050513 | Bacteria | 1475 |
| 687 | nmdc:mga0rr50_64322_c1 | 3300050513 | Bacteria | 2774 |
| 688 | nmdc:mga0rr50_990573_c1 | 3300050513 | Bacteria | 716 |
| 689 | nmdc:mga08x19_426101_c1 | 3300050514 | Bacteria | 932 |
| 690 | nmdc:mga08x19_503318_c1 | 3300050514 | Bacteria | 855 |
| 691 | nmdc:mga0a205_612791_c1 | 3300050515 | Bacteria | 941 |
| 692 | Ga0495601_0000487 | 3300053077 | Bacteria | 20805 |
| 693 | Ga0495601_0104519 | 3300053077 | Bacteria | 1831 |
| 694 | Ga0495601_0110078 | 3300053077 | Bacteria | 1783 |
| 695 | Ga0495601_0142711 | 3300053077 | Bacteria | 1562 |
| 696 | Ga0495601_0372463 | 3300053077 | Bacteria | 927 |
| 697 | Ga0495601_0571321 | 3300053077 | Bacteria | 727 |
| 698 | Ga0495595_0007262 | 3300053084 | Bacteria | 4530 |
| 699 | Ga0495595_0011324 | 3300053084 | Bacteria | 3725 |
| 700 | Ga0495595_0072429 | 3300053084 | Bacteria | 1630 |
| 701 | Ga0495595_0209284 | 3300053084 | Bacteria | 972 |
| 702 | Ga0495619_0005343 | 3300053085 | Bacteria | 8130 |
| 703 | Ga0495619_0005609 | 3300053085 | Bacteria | 7962 |
| 704 | Ga0495619_0011965 | 3300053085 | Bacteria | 5466 |
| 705 | Ga0495619_0078682 | 3300053085 | Bacteria | 2217 |
| 706 | Ga0495619_0917387 | 3300053085 | Bacteria | 589 |
| 707 | Ga0501084_0036203 | 3300054114 | Bacteria | 4123 |
| 708 | Ga0501082_0230874 | 3300060353 | Bacteria | 1610 |
| 709 | Ga0501082_1068632 | 3300060353 | Bacteria | 706 |
| 710 | Ga0466962_0010130 | 3300061719 | Bacteria | 4526 |
| 711 | Ga0466962_0022021 | 3300061719 | Bacteria | 3061 |
| 712 | Ga0466962_0107571 | 3300061719 | Bacteria | 1342 |
| 713 | 2739364832 | 2738543034 | Bacteria | 6084756 |
| 714 | 2852649742 | 2852646457 | Bacteria | 3408613 |
| 715 | 2904779147 | 2904776348 | Bacteria | 4658726 |
| 716 | 2910811905 | 2910809715 | Bacteria | 4982797 |
| 717 | 2919061423 | 2919059106 | Bacteria | 4991624 |
| 718 | 2932429924 | 2932426870 | Bacteria | 4547726 |
| 719 | 2933419361 | 2933418574 | Bacteria | 4476724 |
| 720 | 2939650757 | 2939647034 | Bacteria | 4681660 |
| 721 | 2939675791 | 2939674588 | Bacteria | 4844420 |
| 722 | 2945969873 | 2945968032 | Bacteria | 4111363 |
| 723 | 2946027119 | 2946024296 | Bacteria | 3508095 |
| 724 | 8033689448 | 8033684223 | Bacteria | 6906479 |
| 725 | Ga0451851_1184046 | |||
| 726 | Ga0070658_10024130 | |||
| 727 | Ga0070658_10044295 | |||
| 728 | Ga0070683_100013654 | |||
| 729 | Ga0070683_100048113 | |||
| 730 | Ga0070683_100197248 | |||
| 731 | Ga0070683_100515396 | |||
| 732 | Ga0070683_100520440 | |||
| 733 | Ga0070680_100012266 | |||
| 734 | Ga0070680_100037889 | |||
| 735 | Ga0070680_100046397 | |||
| 736 | Ga0070682_100023546 | |||
| 737 | Ga0070682_100042155 | |||
| 738 | Ga0068868_100173315 | |||
| 739 | Ga0068868_100201358 | |||
| 740 | Ga0068868_100950570 | |||
| 741 | Ga0070660_100010569 | |||
| 742 | Ga0070660_100033834 | |||
| 743 | Ga0070687_100454337 | |||
| 744 | Ga0070661_100084331 | |||
| 745 | Ga0070661_100185037 | |||
| 746 | Ga0070661_100428688 | |||
| 747 | Ga0070692_10338708 | |||
| 748 | Ga0070668_100338890 | |||
| 749 | Ga0070669_100453975 | |||
| 750 | Ga0070671_101331747 | |||
| 751 | Ga0070674_101133532 | |||
| 752 | Ga0070673_100630166 | |||
| 753 | Ga0070659_100078346 | |||
| 754 | Ga0070659_100317361 | |||
| 755 | Ga0070667_100549080 | |||
| 756 | Ga0070703_10171642 | |||
| 757 | Ga0070709_10453267 | |||
| 758 | Ga0070709_11085532 | |||
| 759 | Ga0070714_100046885 | |||
| 760 | Ga0070714_100254827 | |||
| 761 | Ga0070714_100417590 | |||
| 762 | Ga0070714_100573797 | |||
| 763 | Ga0070714_101024548 | |||
| 764 | Ga0070714_101530655 | |||
| 765 | Ga0070713_100173940 | |||
| 766 | Ga0070701_10342747 | |||
| 767 | Ga0070711_100040739 | |||
| 768 | Ga0070711_100172278 | |||
| 769 | Ga0070711_100416372 | |||
| 770 | Ga0070711_100642206 | |||
| 771 | Ga0070711_100778783 | |||
| 772 | Ga0070711_101137539 | |||
| 773 | Ga0070705_100624006 | |||
| 774 | Ga0070700_100887576 | |||
| 775 | Ga0070708_100642482 | |||
| 776 | Ga0070708_101293802 | |||
| 777 | Ga0070678_100008917 | |||
| 778 | Ga0070678_101131806 | |||
| 779 | Ga0070678_102192367 | |||
| 780 | Ga0070662_100453930 | |||
| 781 | Ga0070681_10006989 | |||
| 782 | Ga0070681_10078229 | |||
| 783 | Ga0070681_10084144 | |||
| 784 | Ga0070681_10276750 | |||
| 785 | Ga0070681_10518818 | |||
| 786 | Ga0068867_101645742 | |||
| 787 | Ga0070685_10762853 | |||
| 788 | Ga0070685_11332219 | |||
| 789 | Ga0070706_100260564 | |||
| 790 | Ga0070706_100506742 | |||
| 791 | Ga0070706_101005280 | |||
| 792 | Ga0070707_100000633 | |||
| 793 | Ga0070707_101675994 | |||
| 794 | Ga0070698_100142629 | |||
| 795 | Ga0070698_100214595 | |||
| 796 | Ga0070679_100001973 | |||
| 797 | Ga0070679_100102120 | |||
| 798 | Ga0070679_100141147 | |||
| 799 | Ga0070679_100233708 | |||
| 800 | Ga0070679_100386805 | |||
| 801 | Ga0070679_101658155 | |||
| 802 | Ga0070684_100000226 | |||
| 803 | Ga0070684_100305941 | |||
| 804 | Ga0070684_101494644 | |||
| 805 | Ga0068853_100897320 | |||
| 806 | Ga0070672_100628367 | |||
| 807 | Ga0070672_100823159 | |||
| 808 | Ga0070686_100636626 | |||
| 809 | Ga0070695_100421850 | |||
| 810 | Ga0070695_101693288 | |||
| 811 | Ga0070696_100211738 | |||
| 812 | Ga0070693_100945050 | |||
| 813 | Ga0070665_101229078 | |||
| 814 | Ga0070704_100059042 | |||
| 815 | Ga0070704_100818874 | |||
| 816 | Ga0068855_100057638 | |||
| 817 | Ga0068857_100619284 | |||
| 818 | Ga0068854_100103423 | |||
| 819 | Ga0068856_100053920 | |||
| 820 | Ga0068856_100066521 | |||
| 821 | Ga0068856_100067956 | |||
| 822 | Ga0068856_101397505 | |||
| 823 | Ga0068856_101574173 | |||
| 824 | Ga0068859_100695999 | |||
| 825 | Ga0068859_101748025 | |||
| 826 | Ga0068859_102880967 | |||
| 827 | Ga0068864_101759057 | |||
| 828 | Ga0068866_10274746 | |||
| 829 | Ga0068861_100188587 | |||
| 830 | Ga0068863_100452639 | |||
| 831 | Ga0081455_10291275 | |||
| 832 | Ga0070717_10005163 | |||
| 833 | Ga0070717_10009227 | |||
| 834 | Ga0070717_10011053 | |||
| 835 | Ga0070717_10277950 | |||
| 836 | Ga0070717_10468632 | |||
| 837 | Ga0070717_10470056 | |||
| 838 | Ga0070717_11418801 | |||
| 839 | Ga0070717_11724913 | |||
| 840 | Ga0075365_10500006 | |||
| 841 | Ga0075364_10350466 | |||
| 842 | Ga0070716_101346109 | |||
| 843 | Ga0070712_100050005 | |||
| 844 | Ga0070712_100301139 | |||
| 845 | Ga0070712_100516575 | |||
| 846 | Ga0070712_100547046 | |||
| 847 | Ga0070712_100549566 | |||
| 848 | Ga0070712_100666252 | |||
| 849 | Ga0070712_101204804 | |||
| 850 | Ga0075367_10571294 | |||
| 851 | Ga0097621_100432036 | |||
| 852 | Ga0075370_10051939 | |||
| 853 | Ga0068871_100942453 | |||
| 854 | Ga0068871_101722270 | |||
| 855 | Ga0075430_100578150 | |||
| 856 | Ga0075433_10970269 | |||
| 857 | Ga0075434_100010482 | |||
| 858 | Ga0075434_100474267 | |||
| 859 | Ga0075434_101513365 | |||
| 860 | Ga0068865_101096509 | |||
| 861 | Ga0075436_100310780 | |||
| 862 | Ga0075436_100530828 | |||
| 863 | Ga0097620_100696027 | |||
| 864 | Ga0097620_101747532 | |||
| 865 | Ga0097620_102880359 | |||
| 866 | Ga0075435_100073084 | |||
| 867 | Ga0105244_10066873 | |||
| 868 | Ga0105244_10067876 | |||
| 869 | Ga0105244_10244746 | |||
| 870 | Ga0105244_10254047 | |||
| 871 | Ga0105244_10295608 | |||
| 872 | Ga0105240_10137719 | |||
| 873 | Ga0105240_10143402 | |||
| 874 | Ga0105245_10050785 | |||
| 875 | Ga0105245_10206250 | |||
| 876 | Ga0105245_10850356 | |||
| 877 | Ga0105245_10963770 | |||
| 878 | Ga0105245_11710653 | |||
| 879 | Ga0114129_10678794 | |||
| 880 | Ga0114129_11356756 | |||
| 881 | Ga0105243_10235565 | |||
| 882 | Ga0105243_10347438 | |||
| 883 | Ga0105241_11131327 | |||
| 884 | Ga0105249_10777399 | |||
| 885 | Ga0099796_10079320 | |||
| 886 | Ga0105239_10087646 | |||
| 887 | Ga0105239_10280211 | |||
| 888 | Ga0105239_10442865 | |||
| 889 | Ga0105239_10663907 | |||
| 890 | Ga0105246_10106845 | |||
| 891 | Ga0157373_10092954 | |||
| 892 | Ga0157373_10333166 | |||
| 893 | Ga0157370_10232952 | |||
| 894 | Ga0157370_10635829 | |||
| 895 | Ga0157369_10001705 | |||
| 896 | Ga0157369_10083907 | |||
| 897 | Ga0157369_10881608 | |||
| 898 | Ga0157369_11473599 | |||
| 899 | Ga0157374_10398806 | |||
| 900 | Ga0157374_10603194 | |||
| 901 | Ga0157374_10796494 | |||
| 902 | Ga0157378_10696848 | |||
| 903 | Ga0163162_10111189 | |||
| 904 | Ga0163162_10280707 | |||
| 905 | Ga0157372_10514212 | |||
| 906 | Ga0157372_10518521 | |||
| 907 | Ga0157372_10545351 | |||
| 908 | Ga0157372_12743535 | |||
| 909 | Ga0157375_10157691 | |||
| 910 | Ga0157375_11747635 | |||
| 911 | Ga0157375_12432569 | |||
| 912 | Ga0163163_10135311 | |||
| 913 | Ga0182008_10001466 | |||
| 914 | Ga0182008_10097424 | |||
| 915 | Ga0182008_10114716 | |||
| 916 | Ga0182008_10207292 | |||
| 917 | Ga0182008_10863289 | |||
| 918 | Ga0157377_10144771 | |||
| 919 | Ga0157379_10130266 | |||
| 920 | Ga0157379_10132046 | |||
| 921 | Ga0157376_10029224 | |||
| 922 | Ga0157376_10592602 | |||
| 923 | Ga0182006_1007203 | |||
| 924 | Ga0182007_10004451 | |||
| 925 | Ga0206356_11611016 | |||
| 926 | Ga0206353_10273639 | |||
| 927 | Ga0206353_11455085 | |||
| 928 | Ga0206353_11561108 | |||
| 929 | Ga0213874_10111245 | |||
| 930 | Ga0213876_10062078 | |||
| 931 | Ga0209051_1007701 | |||
| 932 | Ga0207697_10026395 | |||
| 933 | Ga0207655_1022908 | |||
| 934 | Ga0207655_1149994 | |||
| 935 | Ga0207692_10298891 | |||
| 936 | Ga0207699_10100419 | |||
| 937 | Ga0207699_10332785 | |||
| 938 | Ga0207699_10447098 | |||
| 939 | Ga0207699_11085582 | |||
| 940 | Ga0207705_10459886 | |||
| 941 | Ga0207684_10446897 | |||
| 942 | Ga0207654_10266740 | |||
| 943 | Ga0207654_10507839 | |||
| 944 | Ga0207707_10021653 | |||
| 945 | Ga0207707_10049626 | |||
| 946 | Ga0207707_10093154 | |||
| 947 | Ga0207707_10224920 | |||
| 948 | Ga0207707_10411547 | |||
| 949 | Ga0207707_11482503 | |||
| 950 | Ga0207695_10051170 | |||
| 951 | Ga0207693_10001153 | |||
| 952 | Ga0207693_10186864 | |||
| 953 | Ga0207693_10251905 | |||
| 954 | Ga0207693_10436574 | |||
| 955 | Ga0207693_10481581 | |||
| 956 | Ga0207663_10210069 | |||
| 957 | Ga0207660_10012489 | |||
| 958 | Ga0207660_10224532 | |||
| 959 | Ga0207660_10296727 | |||
| 960 | Ga0207660_10644210 | |||
| 961 | Ga0207657_10001428 | |||
| 962 | Ga0207657_10001687 | |||
| 963 | Ga0207657_10007626 | |||
| 964 | Ga0207657_10683601 | |||
| 965 | Ga0207649_10195631 | |||
| 966 | Ga0207649_10612145 | |||
| 967 | Ga0207652_10005412 | |||
| 968 | Ga0207652_10087174 | |||
| 969 | Ga0207652_10356170 | |||
| 970 | Ga0207646_10001749 | |||
| 971 | Ga0207646_10287354 | |||
| 972 | Ga0207694_10647648 | |||
| 973 | Ga0207687_10012917 | |||
| 974 | Ga0207687_10038612 | |||
| 975 | Ga0207687_10110279 | |||
| 976 | Ga0207700_10551032 | |||
| 977 | Ga0207700_10778778 | |||
| 978 | Ga0207664_10247144 | |||
| 979 | Ga0207664_10294721 | |||
| 980 | Ga0207664_10395005 | |||
| 981 | Ga0207664_10411009 | |||
| 982 | Ga0207664_10430610 | |||
| 983 | Ga0207664_10441026 | |||
| 984 | Ga0207664_10504307 | |||
| 985 | Ga0207664_10608614 | |||
| 986 | Ga0207644_10417302 | |||
| 987 | Ga0207690_10086348 | |||
| 988 | Ga0207690_11076895 | |||
| 989 | Ga0207706_11357169 | |||
| 990 | Ga0207686_10066329 | |||
| 991 | Ga0207686_10179216 | |||
| 992 | Ga0207709_10291626 | |||
| 993 | Ga0207669_10127478 | |||
| 994 | Ga0207665_10229432 | |||
| 995 | Ga0207665_10335294 | |||
| 996 | Ga0207665_11091640 | |||
| 997 | Ga0207691_10284355 | |||
| 998 | Ga0207661_10010057 | |||
| 999 | Ga0207661_10217090 | |||
| 1000 | Ga0207661_10582051 | |||
| 1001 | Ga0207661_10610915 | |||
| 1002 | Ga0207667_10170076 | |||
| 1003 | Ga0207667_11915290 | |||
| 1004 | Ga0207651_10354739 | |||
| 1005 | Ga0207640_10060215 | |||
| 1006 | Ga0207640_10187737 | |||
| 1007 | Ga0207658_10981288 | |||
| 1008 | Ga0207677_10053006 | |||
| 1009 | Ga0207639_10732602 | |||
| 1010 | Ga0207639_11252790 | |||
| 1011 | Ga0207702_10006575 | |||
| 1012 | Ga0207702_10047637 | |||
| 1013 | Ga0207702_10153290 | |||
| 1014 | Ga0207702_10376836 | |||
| 1015 | Ga0207674_10059519 | |||
| 1016 | Ga0207674_10329595 | |||
| 1017 | Ga0207674_11635587 | |||
| 1018 | Ga0207683_10011493 | |||
| 1019 | Ga0207683_11091440 | |||
| 1020 | Ga0207683_11128835 | |||
| 1021 | Ga0207698_10499511 | |||
| 1022 | Ga0207428_10277835 | |||
| 1023 | Ga0265337_1077255 | |||
| 1024 | Ga0265318_10054781 | |||
| 1025 | Ga0265336_10085283 | |||
| 1026 | Ga0307515_10075561 | |||
| 1027 | Ga0265338_10556829 | |||
| 1028 | Ga0265339_10053110 | |||
| 1029 | Ga0265339_10103998 | |||
| 1030 | Ga0265331_10297922 | |||
| 1031 | Ga0265327_10000019 | |||
| 1032 | Ga0265327_10082755 | |||
| 1033 | Ga0265316_10678566 | |||
| 1034 | Ga0265313_10024742 | |||
| 1035 | Ga0265313_10106139 | |||
| 1036 | Ga0307410_10165272 | |||
| 1037 | Ga0307410_10575153 | |||
| 1038 | Ga0307410_11948196 | |||
| 1039 | Ga0307412_10222624 | |||
| 1040 | Ga0307409_101371724 | |||
| 1041 | Ga0307415_100281302 | |||
| 1042 | Ga0373938_0005377 | |||
| 1043 | Ga0373941_0306021 | |||
| 1044 | Ga0373957_0136891 | |||
| 1045 | Ga0373943_0168160 | |||
| 1046 | Ga0373955_0256220 | |||
| 1047 | Ga0373924_0294272 | |||
| 1048 | Ga0373931_0199791 | |||
| 1049 | Ga0373937_0000447 | |||
| 1050 | Ga0373937_0359013 | |||
| 1051 | Ga0373937_0766363 | |||
| 1052 | Ga0373925_0807104 | |||
| 1053 | Ga0395899_0036333 | |||
| 1054 | Ga0395899_0355945 | |||
| 1055 | Ga0395900_0087940 | |||
| 1056 | Ga0395900_0161246 | |||
| 1057 | Ga0395900_0173599 | |||
| 1058 | Ga0395900_1604034 | |||
| 1059 | Ga0395898_0138416 | |||
| 1060 | Ga0395898_0213814 | |||
| 1061 | Ga0395898_0254767 | |||
| 1062 | Ga0395898_0755068 | |||
| 1063 | Ga0395898_1637765 | |||
| 1064 | Ga0395898_1641664 | |||
| 1065 | Ga0395905_0059446 | |||
| 1066 | Ga0395905_0260892 | |||
| 1067 | Ga0395905_1777294 | |||
| 1068 | Ga0436364_1204968 | |||
| 1069 | Ga0395901_0019380 | |||
| 1070 | Ga0395901_0190108 | |||
| 1071 | Ga0395901_0660297 | |||
| 1072 | Ga0395901_0793231 | |||
| 1073 | Ga0436365_0960298 | |||
| 1074 | Ga0436360_0782260 | |||
| 1075 | Ga0436363_0412008 | |||
| 1076 | Ga0436363_0850823 | |||
| 1077 | Ga0439458_0076481 | |||
| 1078 | Ga0451577_0338639 | |||
| 1079 | Ga0466965_0104936 | |||
| 1080 | Ga0466965_0417980 | |||
| 1081 | Ga0466966_0016294 | |||
| 1082 | Ga0466961_0027058 | |||
| 1083 | Ga0466961_0037049 | |||
| 1084 | Ga0466961_0188676 | |||
| 1085 | Ga0466961_0189804 | |||
| 1086 | Ga0466963_0000619 | |||
| 1087 | Ga0466963_0000941 | |||
| 1088 | Ga0466963_0002309 | |||
| 1089 | Ga0466963_0009360 | |||
| 1090 | Ga0466963_0010180 | |||
| 1091 | Ga0466963_0017156 | |||
| 1092 | Ga0466963_0018386 | |||
| 1093 | Ga0466963_0041717 | |||
| 1094 | Ga0466963_0045895 | |||
| 1095 | Ga0466963_0047009 | |||
| 1096 | Ga0466963_0114958 | |||
| 1097 | Ga0466963_0133894 | |||
| 1098 | Ga0466963_0146303 | |||
| 1099 | Ga0466963_0430317 | |||
| 1100 | Ga0466963_0546250 | |||
| 1101 | Ga0466963_0692644 | |||
| 1102 | Ga0466964_0010167 | |||
| 1103 | Ga0466964_0061509 | |||
| 1104 | Ga0466964_0125804 | |||
| 1105 | Ga0466964_0128977 | |||
| 1106 | Ga0466964_0214264 | |||
| 1107 | Ga0466964_0231695 | |||
| 1108 | Ga0466964_0391712 | |||
| 1109 | Ga0466964_0602837 | |||
| 1110 | Ga0466971_0023171 | |||
| 1111 | Ga0466971_0049863 | |||
| 1112 | Ga0466971_0110788 | |||
| 1113 | Ga0466971_0292237 | |||
| 1114 | Ga0466968_0008788 | |||
| 1115 | Ga0466968_0035404 | |||
| 1116 | Ga0466968_0062218 | |||
| 1117 | Ga0466968_0075890 | |||
| 1118 | Ga0466968_0337128 | |||
| 1119 | Ga0466970_0352271 | |||
| 1120 | Ga0466970_0364527 | |||
| 1121 | Ga0466957_0003145 | |||
| 1122 | Ga0466957_0005881 | |||
| 1123 | Ga0466957_0006804 | |||
| 1124 | Ga0466957_0668594 | |||
| 1125 | Ga0466957_0721657 | |||
| 1126 | Ga0466957_1413363 | |||
| 1127 | Ga0466960_0126969 | |||
| 1128 | Ga0466960_0168758 | |||
| 1129 | Ga0466960_0290699 | |||
| 1130 | Ga0466960_0402595 | |||
| 1131 | Ga0466959_0010855 | |||
| 1132 | Ga0466959_0028656 | |||
| 1133 | Ga0466959_0113440 | |||
| 1134 | Ga0466959_0400227 | |||
| 1135 | Ga0466958_0000905 | |||
| 1136 | Ga0466958_0025112 | |||
| 1137 | Ga0466958_0027856 | |||
| 1138 | Ga0466958_0032128 | |||
| 1139 | Ga0466958_0047069 | |||
| 1140 | Ga0466958_0175988 | |||
| 1141 | Ga0466958_0814503 | |||
| 1142 | Ga0466967_0000047 | |||
| 1143 | Ga0466967_0003348 | |||
| 1144 | Ga0466967_0009506 | |||
| 1145 | Ga0466967_0015841 | |||
| 1146 | Ga0466967_0027857 | |||
| 1147 | Ga0466967_0081915 | |||
| 1148 | Ga0466967_0083772 | |||
| 1149 | Ga0466967_0088224 | |||
| 1150 | Ga0466967_0094609 | |||
| 1151 | Ga0466967_0099927 | |||
| 1152 | Ga0466967_0133760 | |||
| 1153 | Ga0466967_0161527 | |||
| 1154 | Ga0466967_0174191 | |||
| 1155 | Ga0466967_0206357 | |||
| 1156 | Ga0466967_0225011 | |||
| 1157 | Ga0466967_0233958 | |||
| 1158 | Ga0466967_0247582 | |||
| 1159 | Ga0466967_0254254 | |||
| 1160 | Ga0466967_0315804 | |||
| 1161 | Ga0466967_0365638 | |||
| 1162 | Ga0466967_0420787 | |||
| 1163 | Ga0466967_0423043 | |||
| 1164 | Ga0466967_0471780 | |||
| 1165 | Ga0466967_0567025 | |||
| 1166 | Ga0466967_0607760 | |||
| 1167 | Ga0466967_0677697 | |||
| 1168 | Ga0466967_0760020 | |||
| 1169 | Ga0466967_0985161 | |||
| 1170 | Ga0466967_0994936 | |||
| 1171 | Ga0466967_1574578 | |||
| 1172 | Ga0495592_0000124 | |||
| 1173 | Ga0495592_0005934 | |||
| 1174 | Ga0495629_0018477 | |||
| 1175 | Ga0495629_0054231 | |||
| 1176 | Ga0495629_0091290 | |||
| 1177 | Ga0495629_0119877 | |||
| 1178 | Ga0495641_0061747 | |||
| 1179 | Ga0495641_0167076 | |||
| 1180 | Ga0495641_0490213 | |||
| 1181 | Ga0495651_0000011 | |||
| 1182 | Ga0495651_0051489 | |||
| 1183 | Ga0495653_0001296 | |||
| 1184 | Ga0495653_0029348 | |||
| 1185 | Ga0495653_0088373 | |||
| 1186 | Ga0495653_0429942 | |||
| 1187 | Ga0495653_0836853 | |||
| 1188 | Ga0495582_0044089 | |||
| 1189 | Ga0495582_0044325 | |||
| 1190 | Ga0495582_0703280 | |||
| 1191 | Ga0495605_0057857 | |||
| 1192 | Ga0495662_0277897 | |||
| 1193 | Ga0495664_0026457 | |||
| 1194 | Ga0495664_0086913 | |||
| 1195 | Ga0495664_0193177 | |||
| 1196 | Ga0495584_0033026 | |||
| 1197 | Ga0495584_0054947 | |||
| 1198 | Ga0495596_0081735 | |||
| 1199 | Ga0495607_0073552 | |||
| 1200 | Ga0495608_0002975 | |||
| 1201 | Ga0495608_0674450 | |||
| 1202 | Ga0495618_0001100 | |||
| 1203 | Ga0495618_0405186 | |||
| 1204 | Ga0495628_0000024 | |||
| 1205 | Ga0495628_0007684 | |||
| 1206 | Ga0495628_0657831 | |||
| 1207 | Ga0495630_0007053 | |||
| 1208 | Ga0495630_0305053 | |||
| 1209 | Ga0495630_0361031 | |||
| 1210 | Ga0495630_0765446 | |||
| 1211 | Ga0495644_0162856 | |||
| 1212 | Ga0495652_0000050 | |||
| 1213 | Ga0495652_0551437 | |||
| 1214 | Ga0495652_0629466 | |||
| 1215 | Ga0495640_0035591 | |||
| 1216 | Ga0495640_0132257 | |||
| 1217 | Ga0495586_0217644 | |||
| 1218 | Ga0495587_0000084 | |||
| 1219 | Ga0495587_0284945 | |||
| 1220 | Ga0495587_0384105 | |||
| 1221 | Ga0495645_0000067 | |||
| 1222 | Ga0495645_0018585 | |||
| 1223 | Ga0495645_0168116 | |||
| 1224 | Ga0495645_0826044 | |||
| 1225 | Ga0495667_0040389 | |||
| 1226 | Ga0495667_0211639 | |||
| 1227 | Ga0495667_0270481 | |||
| 1228 | Ga0495667_0320907 | |||
| 1229 | Ga0495656_0070587 | |||
| 1230 | Ga0495668_0478916 | |||
| 1231 | Ga0495634_0010896 | |||
| 1232 | Ga0495634_0117873 | |||
| 1233 | Ga0495635_0085700 | |||
| 1234 | Ga0495635_0188271 | |||
| 1235 | Ga0495635_0394940 | |||
| 1236 | Ga0495635_0562334 | |||
| 1237 | Ga0495588_0363789 | |||
| 1238 | Ga0495657_0049553 | |||
| 1239 | Ga0495657_0207180 | |||
| 1240 | Ga0495657_0217952 | |||
| 1241 | Ga0495657_0526864 | |||
| 1242 | Ga0495599_0000009 | |||
| 1243 | Ga0495599_0561272 | |||
| 1244 | Ga0495599_0661612 | |||
| 1245 | Ga0495623_0000219 | |||
| 1246 | Ga0495623_0134609 | |||
| 1247 | Ga0495646_0015895 | |||
| 1248 | Ga0495647_0032452 | |||
| 1249 | Ga0495647_0094057 | |||
| 1250 | Ga0495658_0085513 | |||
| 1251 | Ga0495658_0126474 | |||
| 1252 | Ga0495658_0734553 | |||
| 1253 | Ga0495613_0000613 | |||
| 1254 | Ga0495613_0446093 | |||
| 1255 | Ga0495613_0742844 | |||
| 1256 | Ga0495624_0091606 | |||
| 1257 | Ga0495624_0235883 | |||
| 1258 | Ga0495670_0042596 | |||
| 1259 | Ga0495671_0314823 | |||
| 1260 | Ga0495589_0056674 | |||
| 1261 | Ga0495600_0012552 | |||
| 1262 | Ga0495600_0121076 | |||
| 1263 | Ga0495600_0149478 | |||
| 1264 | Ga0495600_0265626 | |||
| 1265 | Ga0495604_0000334 | |||
| 1266 | Ga0495604_0350213 | |||
| 1267 | Ga0495636_0087069 | |||
| 1268 | Ga0495674_0156774 | |||
| 1269 | Ga0495674_0203737 | |||
| 1270 | Ga0495674_0244002 | |||
| 1271 | Ga0495674_0514853 | |||
| 1272 | Ga0495676_0042115 | |||
| 1273 | Ga0495680_0008157 | |||
| 1274 | Ga0495680_0035105 | |||
| 1275 | Ga0495680_0062832 | |||
| 1276 | Ga0495680_0156897 | |||
| 1277 | Ga0495680_0754260 | |||
| 1278 | Ga0495683_0229159 | |||
| 1279 | Ga0495675_0000757 | |||
| 1280 | Ga0495684_0053089 | |||
| 1281 | Ga0495593_0202275 | |||
| 1282 | Ga0495602_0001847 | |||
| 1283 | Ga0495602_0149854 | |||
| 1284 | Ga0495602_0176094 | |||
| 1285 | Ga0496100_0002976 | |||
| 1286 | Ga0496100_0206325 | |||
| 1287 | Ga0496100_0248537 | |||
| 1288 | Ga0496100_0285056 | |||
| 1289 | Ga0496100_0372859 | |||
| 1290 | Ga0496100_0720752 | |||
| 1291 | Ga0496101_0007083 | |||
| 1292 | Ga0496101_0052526 | |||
| 1293 | Ga0496101_0089536 | |||
| 1294 | Ga0496101_0218574 | |||
| 1295 | Ga0496101_0388948 | |||
| 1296 | Ga0496102_0007907 | |||
| 1297 | Ga0496102_0288785 | |||
| 1298 | Ga0496102_0696246 | |||
| 1299 | Ga0496103_0008543 | |||
| 1300 | Ga0496103_0084990 | |||
| 1301 | Ga0496103_0156749 | |||
| 1302 | Ga0496103_0238836 | |||
| 1303 | Ga0496104_0000444 | |||
| 1304 | Ga0496104_0001528 | |||
| 1305 | Ga0496104_0022323 | |||
| 1306 | Ga0496104_0046686 | |||
| 1307 | Ga0496104_0104066 | |||
| 1308 | Ga0496104_0478634 | |||
| 1309 | Ga0496104_0777201 | |||
| 1310 | Ga0496105_0000200 | |||
| 1311 | Ga0496105_0052506 | |||
| 1312 | Ga0496105_0095255 | |||
| 1313 | Ga0496105_0142684 | |||
| 1314 | Ga0496105_0151863 | |||
| 1315 | Ga0496105_0229459 | |||
| 1316 | Ga0496105_0638261 | |||
| 1317 | Ga0496106_0018932 | |||
| 1318 | Ga0496106_0025838 | |||
| 1319 | Ga0496106_0052460 | |||
| 1320 | Ga0496106_0100951 | |||
| 1321 | Ga0496106_0131114 | |||
| 1322 | Ga0496107_0090984 | |||
| 1323 | Ga0496107_0169638 | |||
| 1324 | Ga0496108_0002894 | |||
| 1325 | Ga0496108_0012840 | |||
| 1326 | Ga0496108_0020580 | |||
| 1327 | Ga0496108_0034422 | |||
| 1328 | Ga0496108_0091425 | |||
| 1329 | Ga0496108_0101142 | |||
| 1330 | Ga0496108_1033869 | |||
| 1331 | Ga0496108_1292132 | |||
| 1332 | Ga0496109_0000461 | |||
| 1333 | Ga0496109_0002306 | |||
| 1334 | Ga0496109_0063284 | |||
| 1335 | Ga0496109_0080750 | |||
| 1336 | Ga0496109_0085944 | |||
| 1337 | Ga0496109_0153756 | |||
| 1338 | Ga0496109_0189563 | |||
| 1339 | Ga0496109_0214079 | |||
| 1340 | Ga0496109_0266632 | |||
| 1341 | Ga0496109_0328224 | |||
| 1342 | Ga0496109_1019582 | |||
| 1343 | Ga0496110_0001896 | |||
| 1344 | Ga0496110_0002454 | |||
| 1345 | Ga0496110_0025742 | |||
| 1346 | Ga0496110_0055376 | |||
| 1347 | Ga0496110_0066298 | |||
| 1348 | Ga0496110_0099727 | |||
| 1349 | Ga0496110_0130824 | |||
| 1350 | Ga0496110_0833227 | |||
| 1351 | Ga0496111_0000113 | |||
| 1352 | Ga0496111_0001148 | |||
| 1353 | Ga0496111_0046713 | |||
| 1354 | Ga0496111_0095951 | |||
| 1355 | Ga0496111_0103571 | |||
| 1356 | Ga0496111_0712775 | |||
| 1357 | Ga0496112_0007214 | |||
| 1358 | Ga0496112_0021708 | |||
| 1359 | Ga0496112_0043655 | |||
| 1360 | Ga0496112_0059375 | |||
| 1361 | Ga0496112_0087049 | |||
| 1362 | Ga0496112_0218378 | |||
| 1363 | Ga0496112_0552302 | |||
| 1364 | Ga0496112_0759456 | |||
| 1365 | Ga0496112_0769607 | |||
| 1366 | Ga0496113_0011013 | |||
| 1367 | Ga0496113_0114155 | |||
| 1368 | Ga0496113_0270762 | |||
| 1369 | Ga0496113_0544535 | |||
| 1370 | Ga0496114_0006544 | |||
| 1371 | Ga0496114_0017599 | |||
| 1372 | Ga0496114_0063433 | |||
| 1373 | Ga0496114_0282377 | |||
| 1374 | Ga0496114_0284551 | |||
| 1375 | Ga0496114_0367705 | |||
| 1376 | Ga0496115_0026438 | |||
| 1377 | Ga0496115_0135763 | |||
| 1378 | Ga0496115_0372805 | |||
| 1379 | Ga0496115_0836236 | |||
| 1380 | Ga0501032_0008374 | |||
| 1381 | Ga0501034_0000066 | |||
| 1382 | Ga0501034_0006648 | |||
| 1383 | Ga0501037_0031239 | |||
| 1384 | Ga0501039_0545472 | |||
| 1385 | Ga0501039_0972832 | |||
| 1386 | Ga0501043_0036713 | |||
| 1387 | Ga0501067_0031664 | |||
| 1388 | Ga0501067_0058209 | |||
| 1389 | Ga0501067_0550439 | |||
| 1390 | Ga0501068_0183019 | |||
| 1391 | Ga0501068_0391891 | |||
| 1392 | Ga0501069_0031128 | |||
| 1393 | Ga0501072_0070348 | |||
| 1394 | Ga0501074_0033384 | |||
| 1395 | Ga0501074_0067418 | |||
| 1396 | Ga0501075_0291100 | |||
| 1397 | Ga0501077_0034255 | |||
| 1398 | Ga0501079_0006416 | |||
| 1399 | Ga0501080_0014355 | |||
| 1400 | Ga0501080_0099693 | |||
| 1401 | Ga0501081_0038156 | |||
| 1402 | Ga0501083_0004631 | |||
| 1403 | nmdc:mga0yw44_449785_c1 | |||
| 1404 | nmdc:mga04h51_245862_c1 | |||
| 1405 | nmdc:mga07m45_181143_c1 | |||
| 1406 | nmdc:mga0n895_1570166_c1 | |||
| 1407 | nmdc:mga0n895_1616808_c1 | |||
| 1408 | nmdc:mga0n895_467221_c1 | |||
| 1409 | nmdc:mga0n895_76263_c1 | |||
| 1410 | nmdc:mga0rr50_248895_c1 | |||
| 1411 | nmdc:mga0rr50_64322_c1 | |||
| 1412 | nmdc:mga0rr50_990573_c1 | |||
| 1413 | nmdc:mga08x19_426101_c1 | |||
| 1414 | nmdc:mga08x19_503318_c1 | |||
| 1415 | nmdc:mga0a205_612791_c1 | |||
| 1416 | Ga0495601_0000487 | |||
| 1417 | Ga0495601_0104519 | |||
| 1418 | Ga0495601_0110078 | |||
| 1419 | Ga0495601_0142711 | |||
| 1420 | Ga0495601_0372463 | |||
| 1421 | Ga0495601_0571321 | |||
| 1422 | Ga0495595_0007262 | |||
| 1423 | Ga0495595_0011324 | |||
| 1424 | Ga0495595_0072429 | |||
| 1425 | Ga0495595_0209284 | |||
| 1426 | Ga0495619_0005343 | |||
| 1427 | Ga0495619_0005609 | |||
| 1428 | Ga0495619_0011965 | |||
| 1429 | Ga0495619_0078682 | |||
| 1430 | Ga0495619_0917387 | |||
| 1431 | Ga0501084_0036203 | |||
| 1432 | Ga0501082_0230874 | |||
| 1433 | Ga0501082_1068632 | |||
| 1434 | Ga0466962_0010130 | |||
| 1435 | Ga0466962_0022021 | |||
| 1436 | Ga0466962_0107571 | |||
| 1437 | 2739364832 | |||
| 1438 | 2852649742 | |||
| 1439 | 2904779147 | |||
| 1440 | 2910811905 | |||
| 1441 | 2919061423 | |||
| 1442 | 2932429924 | |||
| 1443 | 2933419361 | |||
| 1444 | 2939650757 | |||
| 1445 | 2939675791 | |||
| 1446 | 2945969873 | |||
| 1447 | 2946027119 | |||
| 1448 | 8033689448 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r24-assembly1.cif.gz_B | complete dissection of b. subtilis nitrogen homeostatic circuitry | 0.9296 | 2 | 72 |
| 5i44-assembly4.cif.gz_E | structure of raca-dna complex; p21 form | 0.8963 | 4 | 64 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.8927 | 1 | 72 |
| 2dg6-assembly1.cif.gz_A-2 | crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) | 0.8865 | 5 | 70 |
| 5i41-assembly1.cif.gz_B | structure of the apo raca dna binding domain | 0.8776 | 3 | 64 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06302_4_79_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.926 | 2 | 68 | 1.10.1660.10 |
| 3hh0D01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9228 | 3 | 68 | 1.10.1660.10 |
| 4r22B00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9129 | 1 | 72 | 1.10.1660.10 |
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.91 | 3 | 71 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9033 | 3 | 70 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A127SKU8-F1-model_v4 | SoxR | 0.9928 | 4 | 74 |
GO:0003677
GO:0003700 GO:0006979 GO:0051537 |
| AF-A0A530M347-F1-model_v4 | MerR family transcriptional regulator | 0.9899 | 1 | 70 |
GO:0003677
GO:0003700 |
| AF-A0A2V8D952-F1-model_v4 | Redox-sensitive transcriptional activator SoxR | 0.9754 | 1 | 91 |
GO:0003677
GO:0003700 |
| AF-A0A353CDX2-F1-model_v4 | Redox-sensitive transcriptional activator SoxR | 0.9708 | 3 | 112 |
GO:0003677
GO:0003700 GO:0006979 GO:0051537 |
| AF-A0A141RI41-F1-model_v4 | SoxR | 0.9681 | 4 | 80 |
GO:0003677
GO:0003700 GO:0006979 GO:0051537 |