F477568

General Info

Members Datasets Scaffolds Average Seq Length
724 294 1448 151

Family's Representative Sequence

Representative Sequence 3300041507|Ga0451851_1184046|Ga0451851_1184046_40_558
Length 172
Sequence VVVGIPIGELSRRSGVSQSALRFYERQGLIAAERTDGNQRRYPGVTLRRVALIQAGKAAGIPLERIKQALDTLPSGKSPTKRDWARLSSSWRKELDERIETLEAIRGRLTTCIGCGCLSLKTCALLNPADEAGQLGGGARYLRRVSPHERDLAVRAPRVHRDPLGQRRTGAP

Samples

Sample ID Description Type Environment
1 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
282 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
283 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
284 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
285 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
286 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
287 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
288 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
289 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
290 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
291 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
292 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
293 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
294 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.55
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 13.12
Rhizosphere 84.25
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451851_1184046 3300041507 Bacteria 779
2 Ga0070658_10024130 3300005327 Bacteria 4880
3 Ga0070658_10044295 3300005327 Bacteria 3596
4 Ga0070683_100013654 3300005329 Bacteria 7091
5 Ga0070683_100048113 3300005329 Bacteria 3942
6 Ga0070683_100197248 3300005329 Bacteria 1912
7 Ga0070683_100515396 3300005329 Bacteria 1143
8 Ga0070683_100520440 3300005329 Bacteria 1137
9 Ga0070680_100012266 3300005336 Bacteria 6656
10 Ga0070680_100037889 3300005336 Bacteria 3897
11 Ga0070680_100046397 3300005336 Bacteria 3534
12 Ga0070682_100023546 3300005337 Bacteria 3656
13 Ga0070682_100042155 3300005337 Bacteria 2816
14 Ga0068868_100173315 3300005338 Bacteria 1787
15 Ga0068868_100201358 3300005338 Bacteria 1660
16 Ga0068868_100950570 3300005338 Bacteria 784
17 Ga0070660_100010569 3300005339 Bacteria 6523
18 Ga0070660_100033834 3300005339 Bacteria 3856
19 Ga0070687_100454337 3300005343 Bacteria 853
20 Ga0070661_100084331 3300005344 Bacteria 2347
21 Ga0070661_100185037 3300005344 Bacteria 1586
22 Ga0070661_100428688 3300005344 Bacteria 1049
23 Ga0070692_10338708 3300005345 Unclassified 931
24 Ga0070668_100338890 3300005347 Bacteria 1270
25 Ga0070669_100453975 3300005353 Bacteria 1057
26 Ga0070671_101331747 3300005355 Bacteria 634
27 Ga0070674_101133532 3300005356 Bacteria 692
28 Ga0070673_100630166 3300005364 Bacteria 980
29 Ga0070659_100078346 3300005366 Bacteria 2636
30 Ga0070659_100317361 3300005366 Bacteria 1302
31 Ga0070667_100549080 3300005367 Bacteria 1062
32 Ga0070703_10171642 3300005406 Bacteria 831
33 Ga0070709_10453267 3300005434 Bacteria 967
34 Ga0070709_11085532 3300005434 Bacteria 640
35 Ga0070714_100046885 3300005435 Bacteria 3668
36 Ga0070714_100254827 3300005435 Bacteria 1624
37 Ga0070714_100417590 3300005435 Bacteria 1270
38 Ga0070714_100573797 3300005435 Bacteria 1082
39 Ga0070714_101024548 3300005435 Bacteria 804
40 Ga0070714_101530655 3300005435 Bacteria 652
41 Ga0070713_100173940 3300005436 Bacteria 1930
42 Ga0070701_10342747 3300005438 Bacteria 931
43 Ga0070711_100040739 3300005439 Bacteria 3134
44 Ga0070711_100172278 3300005439 Bacteria 1650
45 Ga0070711_100416372 3300005439 Bacteria 1094
46 Ga0070711_100642206 3300005439 Bacteria 889
47 Ga0070711_100778783 3300005439 Unclassified 810
48 Ga0070711_101137539 3300005439 Bacteria 674
49 Ga0070705_100624006 3300005440 Bacteria 837
50 Ga0070700_100887576 3300005441 Bacteria 725
51 Ga0070708_100642482 3300005445 Bacteria 1000
52 Ga0070708_101293802 3300005445 Bacteria 681
53 Ga0070678_100008917 3300005456 Bacteria 6039
54 Ga0070678_101131806 3300005456 Bacteria 724
55 Ga0070678_102192367 3300005456 Bacteria 524
56 Ga0070662_100453930 3300005457 Bacteria 1064
57 Ga0070681_10006989 3300005458 Bacteria 10987
58 Ga0070681_10078229 3300005458 Bacteria 3264
59 Ga0070681_10084144 3300005458 Bacteria 3134
60 Ga0070681_10276750 3300005458 Bacteria 1589
61 Ga0070681_10518818 3300005458 Bacteria 1105
62 Ga0068867_101645742 3300005459 Bacteria 601
63 Ga0070685_10762853 3300005466 Bacteria 710
64 Ga0070685_11332219 3300005466 Bacteria 549
65 Ga0070706_100260564 3300005467 Bacteria 1618
66 Ga0070706_100506742 3300005467 Bacteria 1123
67 Ga0070706_101005280 3300005467 Bacteria 769
68 Ga0070707_100000633 3300005468 Bacteria 35138
69 Ga0070707_101675994 3300005468 Bacteria 603
70 Ga0070698_100142629 3300005471 Bacteria 2346
71 Ga0070698_100214595 3300005471 Bacteria 1859
72 Ga0070679_100001973 3300005530 Bacteria 18408
73 Ga0070679_100102120 3300005530 Bacteria 2854
74 Ga0070679_100141147 3300005530 Bacteria 2388
75 Ga0070679_100233708 3300005530 Bacteria 1797
76 Ga0070679_100386805 3300005530 Bacteria 1345
77 Ga0070679_101658155 3300005530 Bacteria 587
78 Ga0070684_100000226 3300005535 Bacteria 39137
79 Ga0070684_100305941 3300005535 Bacteria 1459
80 Ga0070684_101494644 3300005535 Bacteria 636
81 Ga0068853_100897320 3300005539 Bacteria 851
82 Ga0070672_100628367 3300005543 Bacteria 937
83 Ga0070672_100823159 3300005543 Bacteria 818
84 Ga0070686_100636626 3300005544 Bacteria 844
85 Ga0070695_100421850 3300005545 Bacteria 1016
86 Ga0070695_101693288 3300005545 Bacteria 529
87 Ga0070696_100211738 3300005546 Bacteria 1451
88 Ga0070693_100945050 3300005547 Bacteria 649
89 Ga0070665_101229078 3300005548 Bacteria 760
90 Ga0070704_100059042 3300005549 Bacteria 2735
91 Ga0070704_100818874 3300005549 Bacteria 833
92 Ga0068855_100057638 3300005563 Bacteria 4552
93 Ga0068857_100619284 3300005577 Bacteria 1024
94 Ga0068854_100103423 3300005578 Bacteria 2138
95 Ga0068856_100053920 3300005614 Bacteria 3965
96 Ga0068856_100066521 3300005614 Bacteria 3561
97 Ga0068856_100067956 3300005614 Bacteria 3522
98 Ga0068856_101397505 3300005614 Bacteria 714
99 Ga0068856_101574173 3300005614 Bacteria 670
100 Ga0068859_100695999 3300005617 Bacteria 1107
101 Ga0068859_101748025 3300005617 Bacteria 687
102 Ga0068859_102880967 3300005617 Bacteria 527
103 Ga0068864_101759057 3300005618 Bacteria 625
104 Ga0068866_10274746 3300005718 Bacteria 1041
105 Ga0068861_100188587 3300005719 Bacteria 1722
106 Ga0068863_100452639 3300005841 Bacteria 1260
107 Ga0081455_10291275 3300005937 Bacteria 1175
108 Ga0070717_10005163 3300006028 Bacteria 9520
109 Ga0070717_10009227 3300006028 Bacteria 7414
110 Ga0070717_10011053 3300006028 Bacteria 6838
111 Ga0070717_10277950 3300006028 Bacteria 1484
112 Ga0070717_10468632 3300006028 Bacteria 1136
113 Ga0070717_10470056 3300006028 Bacteria 1135
114 Ga0070717_11418801 3300006028 Bacteria 630
115 Ga0070717_11724913 3300006028 Bacteria 566
116 Ga0075365_10500006 3300006038 Bacteria 859
117 Ga0075364_10350466 3300006051 Bacteria 1006
118 Ga0070716_101346109 3300006173 Bacteria 579
119 Ga0070712_100050005 3300006175 Bacteria 2906
120 Ga0070712_100301139 3300006175 Bacteria 1298
121 Ga0070712_100516575 3300006175 Bacteria 1003
122 Ga0070712_100547046 3300006175 Bacteria 975
123 Ga0070712_100549566 3300006175 Bacteria 973
124 Ga0070712_100666252 3300006175 Bacteria 885
125 Ga0070712_101204804 3300006175 Bacteria 659
126 Ga0075367_10571294 3300006178 Bacteria 718
127 Ga0097621_100432036 3300006237 Bacteria 1184
128 Ga0075370_10051939 3300006353 Bacteria 2325
129 Ga0068871_100942453 3300006358 Bacteria 802
130 Ga0068871_101722270 3300006358 Unclassified 595
131 Ga0075430_100578150 3300006846 Bacteria 927
132 Ga0075433_10970269 3300006852 Bacteria 741
133 Ga0075434_100010482 3300006871 Bacteria 8689
134 Ga0075434_100474267 3300006871 Bacteria 1273
135 Ga0075434_101513365 3300006871 Bacteria 680
136 Ga0068865_101096509 3300006881 Bacteria 701
137 Ga0075436_100310780 3300006914 Bacteria 1131
138 Ga0075436_100530828 3300006914 Bacteria 863
139 Ga0097620_100696027 3300006931 Bacteria 1107
140 Ga0097620_101747532 3300006931 Bacteria 687
141 Ga0097620_102880359 3300006931 Bacteria 527
142 Ga0075435_100073084 3300007076 Bacteria 2803
143 Ga0105244_10066873 3300009036 Bacteria 1799
144 Ga0105244_10067876 3300009036 Bacteria 1783
145 Ga0105244_10244746 3300009036 Bacteria 837
146 Ga0105244_10254047 3300009036 Bacteria 819
147 Ga0105244_10295608 3300009036 Bacteria 750
148 Ga0105240_10137719 3300009093 Bacteria 2921
149 Ga0105240_10143402 3300009093 Bacteria 2853
150 Ga0105245_10050785 3300009098 Bacteria 3718
151 Ga0105245_10206250 3300009098 Bacteria 1890
152 Ga0105245_10850356 3300009098 Bacteria 952
153 Ga0105245_10963770 3300009098 Bacteria 896
154 Ga0105245_11710653 3300009098 Bacteria 681
155 Ga0114129_10678794 3300009147 Bacteria 1326
156 Ga0114129_11356756 3300009147 Bacteria 879
157 Ga0105243_10235565 3300009148 Bacteria 1626
158 Ga0105243_10347438 3300009148 Bacteria 1361
159 Ga0105241_11131327 3300009174 Bacteria 739
160 Ga0105249_10777399 3300009553 Bacteria 1021
161 Ga0099796_10079320 3300010159 Bacteria 1201
162 Ga0105239_10087646 3300010375 Bacteria 3432
163 Ga0105239_10280211 3300010375 Bacteria 1877
164 Ga0105239_10442865 3300010375 Bacteria 1473
165 Ga0105239_10663907 3300010375 Bacteria 1191
166 Ga0105246_10106845 3300011119 Bacteria 2048
167 Ga0157373_10092954 3300013100 Bacteria 2124
168 Ga0157373_10333166 3300013100 Bacteria 1081
169 Ga0157370_10232952 3300013104 Bacteria 1704
170 Ga0157370_10635829 3300013104 Bacteria 976
171 Ga0157369_10001705 3300013105 Bacteria 26767
172 Ga0157369_10083907 3300013105 Bacteria 3406
173 Ga0157369_10881608 3300013105 Bacteria 918
174 Ga0157369_11473599 3300013105 Bacteria 692
175 Ga0157374_10398806 3300013296 Bacteria 1372
176 Ga0157374_10603194 3300013296 Bacteria 1108
177 Ga0157374_10796494 3300013296 Bacteria 961
178 Ga0157378_10696848 3300013297 Bacteria 1035
179 Ga0163162_10111189 3300013306 Bacteria 2837
180 Ga0163162_10280707 3300013306 Bacteria 1797
181 Ga0157372_10514212 3300013307 Bacteria 1396
182 Ga0157372_10518521 3300013307 Bacteria 1389
183 Ga0157372_10545351 3300013307 Bacteria 1352
184 Ga0157372_12743535 3300013307 Bacteria 565
185 Ga0157375_10157691 3300013308 Bacteria 2409
186 Ga0157375_11747635 3300013308 Bacteria 737
187 Ga0157375_12432569 3300013308 Bacteria 625
188 Ga0163163_10135311 3300014325 Bacteria 2506
189 Ga0182008_10001466 3300014497 Bacteria 15780
190 Ga0182008_10097424 3300014497 Bacteria 1452
191 Ga0182008_10114716 3300014497 Bacteria 1336
192 Ga0182008_10207292 3300014497 Bacteria 999
193 Ga0182008_10863289 3300014497 Bacteria 530
194 Ga0157377_10144771 3300014745 Unclassified 1464
195 Ga0157379_10130266 3300014968 Bacteria 2264
196 Ga0157379_10132046 3300014968 Bacteria 2248
197 Ga0157376_10029224 3300014969 Bacteria 4390
198 Ga0157376_10592602 3300014969 Bacteria 1102
199 Ga0182006_1007203 3300015261 Bacteria 5108
200 Ga0182007_10004451 3300015262 Bacteria 6349
201 Ga0206356_11611016 3300020070 Bacteria 2457
202 Ga0206353_10273639 3300020082 Bacteria 925
203 Ga0206353_11455085 3300020082 Bacteria 1905
204 Ga0206353_11561108 3300020082 Bacteria 2178
205 Ga0213874_10111245 3300021377 Bacteria 921
206 Ga0213876_10062078 3300021384 Bacteria 1972
207 Ga0209051_1007701 3300025303 Bacteria 5843
208 Ga0207697_10026395 3300025315 Bacteria 2374
209 Ga0207655_1022908 3300025728 Bacteria 3113
210 Ga0207655_1149994 3300025728 Bacteria 738
211 Ga0207692_10298891 3300025898 Bacteria 979
212 Ga0207699_10100419 3300025906 Bacteria 1835
213 Ga0207699_10332785 3300025906 Bacteria 1068
214 Ga0207699_10447098 3300025906 Bacteria 926
215 Ga0207699_11085582 3300025906 Bacteria 592
216 Ga0207705_10459886 3300025909 Bacteria 987
217 Ga0207684_10446897 3300025910 Bacteria 1110
218 Ga0207654_10266740 3300025911 Bacteria 1153
219 Ga0207654_10507839 3300025911 Bacteria 852
220 Ga0207707_10021653 3300025912 Bacteria 5618
221 Ga0207707_10049626 3300025912 Bacteria 3656
222 Ga0207707_10093154 3300025912 Bacteria 2632
223 Ga0207707_10224920 3300025912 Bacteria 1633
224 Ga0207707_10411547 3300025912 Bacteria 1160
225 Ga0207707_11482503 3300025912 Bacteria 538
226 Ga0207695_10051170 3300025913 Bacteria 4339
227 Ga0207693_10001153 3300025915 Bacteria 23583
228 Ga0207693_10186864 3300025915 Bacteria 1631
229 Ga0207693_10251905 3300025915 Bacteria 1385
230 Ga0207693_10436574 3300025915 Bacteria 1023
231 Ga0207693_10481581 3300025915 Bacteria 969
232 Ga0207663_10210069 3300025916 Bacteria 1410
233 Ga0207660_10012489 3300025917 Bacteria 5558
234 Ga0207660_10224532 3300025917 Bacteria 1475
235 Ga0207660_10296727 3300025917 Bacteria 1286
236 Ga0207660_10644210 3300025917 Bacteria 864
237 Ga0207657_10001428 3300025919 Bacteria 25498
238 Ga0207657_10001687 3300025919 Bacteria 23810
239 Ga0207657_10007626 3300025919 Bacteria 11074
240 Ga0207657_10683601 3300025919 Bacteria 798
241 Ga0207649_10195631 3300025920 Bacteria 1425
242 Ga0207649_10612145 3300025920 Bacteria 838
243 Ga0207652_10005412 3300025921 Bacteria 10355
244 Ga0207652_10087174 3300025921 Bacteria 2738
245 Ga0207652_10356170 3300025921 Bacteria 1321
246 Ga0207646_10001749 3300025922 Bacteria 26367
247 Ga0207646_10287354 3300025922 Bacteria 1486
248 Ga0207694_10647648 3300025924 Bacteria 890
249 Ga0207687_10012917 3300025927 Bacteria 5457
250 Ga0207687_10038612 3300025927 Bacteria 3264
251 Ga0207687_10110279 3300025927 Bacteria 2040
252 Ga0207700_10551032 3300025928 Bacteria 1024
253 Ga0207700_10778778 3300025928 Bacteria 855
254 Ga0207664_10247144 3300025929 Bacteria 1555
255 Ga0207664_10294721 3300025929 Bacteria 1426
256 Ga0207664_10395005 3300025929 Bacteria 1229
257 Ga0207664_10411009 3300025929 Bacteria 1204
258 Ga0207664_10430610 3300025929 Bacteria 1176
259 Ga0207664_10441026 3300025929 Bacteria 1161
260 Ga0207664_10504307 3300025929 Bacteria 1084
261 Ga0207664_10608614 3300025929 Bacteria 981
262 Ga0207644_10417302 3300025931 Bacteria 1099
263 Ga0207690_10086348 3300025932 Bacteria 2205
264 Ga0207690_11076895 3300025932 Bacteria 670
265 Ga0207706_11357169 3300025933 Unclassified 585
266 Ga0207686_10066329 3300025934 Bacteria 2305
267 Ga0207686_10179216 3300025934 Bacteria 1501
268 Ga0207709_10291626 3300025935 Bacteria 1209
269 Ga0207669_10127478 3300025937 Bacteria 1742
270 Ga0207665_10229432 3300025939 Bacteria 1364
271 Ga0207665_10335294 3300025939 Bacteria 1138
272 Ga0207665_11091640 3300025939 Bacteria 636
273 Ga0207691_10284355 3300025940 Bacteria 1423
274 Ga0207661_10010057 3300025944 Bacteria 6798
275 Ga0207661_10217090 3300025944 Bacteria 1689
276 Ga0207661_10582051 3300025944 Bacteria 1027
277 Ga0207661_10610915 3300025944 Bacteria 1001
278 Ga0207667_10170076 3300025949 Bacteria 2240
279 Ga0207667_11915290 3300025949 Bacteria 555
280 Ga0207651_10354739 3300025960 Bacteria 1236
281 Ga0207640_10060215 3300025981 Bacteria 2509
282 Ga0207640_10187737 3300025981 Bacteria 1555
283 Ga0207658_10981288 3300025986 Bacteria 770
284 Ga0207677_10053006 3300026023 Bacteria 2759
285 Ga0207639_10732602 3300026041 Bacteria 918
286 Ga0207639_11252790 3300026041 Bacteria 696
287 Ga0207702_10006575 3300026078 Bacteria 9992
288 Ga0207702_10047637 3300026078 Bacteria 3613
289 Ga0207702_10153290 3300026078 Bacteria 2098
290 Ga0207702_10376836 3300026078 Bacteria 1364
291 Ga0207674_10059519 3300026116 Bacteria 3865
292 Ga0207674_10329595 3300026116 Bacteria 1476
293 Ga0207674_11635587 3300026116 Bacteria 612
294 Ga0207683_10011493 3300026121 Bacteria 7557
295 Ga0207683_11091440 3300026121 Bacteria 740
296 Ga0207683_11128835 3300026121 Bacteria 727
297 Ga0207698_10499511 3300026142 Bacteria 1183
298 Ga0207428_10277835 3300027907 Bacteria 1244
299 Ga0265337_1077255 3300028556 Bacteria 912
300 Ga0265318_10054781 3300028577 Bacteria 1494
301 Ga0265336_10085283 3300028666 Bacteria 942
302 Ga0307515_10075561 3300028794 Bacteria 4487
303 Ga0265338_10556829 3300028800 Bacteria 802
304 Ga0265339_10053110 3300031249 Bacteria 2204
305 Ga0265339_10103998 3300031249 Bacteria 1475
306 Ga0265331_10297922 3300031250 Bacteria 722
307 Ga0265327_10000019 3300031251 Bacteria 427653
308 Ga0265327_10082755 3300031251 Bacteria 1581
309 Ga0265316_10678566 3300031344 Bacteria 727
310 Ga0265313_10024742 3300031595 Bacteria 3199
311 Ga0265313_10106139 3300031595 Bacteria 1240
312 Ga0307410_10165272 3300031852 Bacteria 1662
313 Ga0307410_10575153 3300031852 Bacteria 937
314 Ga0307410_11948196 3300031852 Bacteria 524
315 Ga0307412_10222624 3300031911 Bacteria 1447
316 Ga0307409_101371724 3300031995 Bacteria 733
317 Ga0307415_100281302 3300032126 Bacteria 1368
318 Ga0373938_0005377 3300034957 Bacteria 2176
319 Ga0373941_0306021 3300035115 Bacteria 636
320 Ga0373957_0136891 3300035120 Bacteria 1000
321 Ga0373943_0168160 3300035170 Bacteria 1198
322 Ga0373955_0256220 3300035172 Bacteria 1050
323 Ga0373924_0294272 3300035410 Bacteria 721
324 Ga0373931_0199791 3300035691 Bacteria 1194
325 Ga0373937_0000447 3300036401 Bacteria 38075
326 Ga0373937_0359013 3300036401 Bacteria 1381
327 Ga0373937_0766363 3300036401 Bacteria 912
328 Ga0373925_0807104 3300037068 Bacteria 774
329 Ga0395899_0036333 3300037312 Bacteria 3696
330 Ga0395899_0355945 3300037312 Bacteria 978
331 Ga0395900_0087940 3300037418 Bacteria 3194
332 Ga0395900_0161246 3300037418 Bacteria 2287
333 Ga0395900_0173599 3300037418 Bacteria 2193
334 Ga0395900_1604034 3300037418 Bacteria 562
335 Ga0395898_0138416 3300037466 Bacteria 2331
336 Ga0395898_0213814 3300037466 Unclassified 1839
337 Ga0395898_0254767 3300037466 Bacteria 1674
338 Ga0395898_0755068 3300037466 Bacteria 914
339 Ga0395898_1637765 3300037466 Bacteria 567
340 Ga0395898_1641664 3300037466 Bacteria 566
341 Ga0395905_0059446 3300037471 Bacteria 3573
342 Ga0395905_0260892 3300037471 Bacteria 1618
343 Ga0395905_1777294 3300037471 Bacteria 522
344 Ga0436364_1204968 3300037853 Bacteria 1039
345 Ga0395901_0019380 3300038443 Bacteria 6956
346 Ga0395901_0190108 3300038443 Bacteria 2153
347 Ga0395901_0660297 3300038443 Bacteria 1048
348 Ga0395901_0793231 3300038443 Bacteria 937
349 Ga0436365_0960298 3300039437 Bacteria 2175
350 Ga0436360_0782260 3300039438 Bacteria 2005
351 Ga0436363_0412008 3300039450 Bacteria 1072
352 Ga0436363_0850823 3300039450 Bacteria 1076
353 Ga0439458_0076481 3300042157 Bacteria 850
354 Ga0451577_0338639 3300042876 Bacteria 1364
355 Ga0466965_0104936 3300044683 Bacteria 1448
356 Ga0466965_0417980 3300044683 Bacteria 743
357 Ga0466966_0016294 3300044684 Bacteria 4915
358 Ga0466961_0027058 3300044693 Bacteria 3687
359 Ga0466961_0037049 3300044693 Bacteria 3130
360 Ga0466961_0188676 3300044693 Bacteria 1278
361 Ga0466961_0189804 3300044693 Bacteria 1274
362 Ga0466963_0000619 3300044694 Bacteria 17041
363 Ga0466963_0000941 3300044694 Bacteria 14889
364 Ga0466963_0002309 3300044694 Bacteria 10613
365 Ga0466963_0009360 3300044694 Bacteria 5898
366 Ga0466963_0010180 3300044694 Bacteria 5685
367 Ga0466963_0017156 3300044694 Bacteria 4509
368 Ga0466963_0018386 3300044694 Bacteria 4369
369 Ga0466963_0041717 3300044694 Bacteria 3010
370 Ga0466963_0045895 3300044694 Bacteria 2879
371 Ga0466963_0047009 3300044694 Bacteria 2848
372 Ga0466963_0114958 3300044694 Bacteria 1849
373 Ga0466963_0133894 3300044694 Bacteria 1714
374 Ga0466963_0146303 3300044694 Bacteria 1639
375 Ga0466963_0430317 3300044694 Bacteria 931
376 Ga0466963_0546250 3300044694 Bacteria 818
377 Ga0466963_0692644 3300044694 Bacteria 719
378 Ga0466964_0010167 3300044706 Bacteria 3547
379 Ga0466964_0061509 3300044706 Bacteria 1564
380 Ga0466964_0125804 3300044706 Bacteria 1161
381 Ga0466964_0128977 3300044706 Bacteria 1149
382 Ga0466964_0214264 3300044706 Bacteria 932
383 Ga0466964_0231695 3300044706 Bacteria 902
384 Ga0466964_0391712 3300044706 Bacteria 724
385 Ga0466964_0602837 3300044706 Bacteria 602
386 Ga0466971_0023171 3300044719 Bacteria 2767
387 Ga0466971_0049863 3300044719 Bacteria 1884
388 Ga0466971_0110788 3300044719 Bacteria 1266
389 Ga0466971_0292237 3300044719 Bacteria 781
390 Ga0466968_0008788 3300044735 Bacteria 3875
391 Ga0466968_0035404 3300044735 Bacteria 2089
392 Ga0466968_0062218 3300044735 Bacteria 1611
393 Ga0466968_0075890 3300044735 Bacteria 1470
394 Ga0466968_0337128 3300044735 Bacteria 731
395 Ga0466970_0352271 3300044765 Unclassified 835
396 Ga0466970_0364527 3300044765 Bacteria 821
397 Ga0466957_0003145 3300044842 Bacteria 8992
398 Ga0466957_0005881 3300044842 Bacteria 6914
399 Ga0466957_0006804 3300044842 Bacteria 6458
400 Ga0466957_0668594 3300044842 Bacteria 731
401 Ga0466957_0721657 3300044842 Bacteria 704
402 Ga0466957_1413363 3300044842 Bacteria 507
403 Ga0466960_0126969 3300044901 Bacteria 1342
404 Ga0466960_0168758 3300044901 Bacteria 1180
405 Ga0466960_0290699 3300044901 Bacteria 918
406 Ga0466960_0402595 3300044901 Bacteria 789
407 Ga0466959_0010855 3300045049 Bacteria 6530
408 Ga0466959_0028656 3300045049 Bacteria 4129
409 Ga0466959_0113440 3300045049 Bacteria 1932
410 Ga0466959_0400227 3300045049 Bacteria 933
411 Ga0466958_0000905 3300045836 Bacteria 13318
412 Ga0466958_0025112 3300045836 Bacteria 3509
413 Ga0466958_0027856 3300045836 Bacteria 3345
414 Ga0466958_0032128 3300045836 Bacteria 3122
415 Ga0466958_0047069 3300045836 Bacteria 2603
416 Ga0466958_0175988 3300045836 Bacteria 1356
417 Ga0466958_0814503 3300045836 Bacteria 609
418 Ga0466967_0000047 3300045976 Bacteria 43648
419 Ga0466967_0003348 3300045976 Bacteria 10425
420 Ga0466967_0009506 3300045976 Bacteria 7218
421 Ga0466967_0015841 3300045976 Bacteria 5925
422 Ga0466967_0027857 3300045976 Bacteria 4707
423 Ga0466967_0081915 3300045976 Bacteria 2915
424 Ga0466967_0083772 3300045976 Bacteria 2884
425 Ga0466967_0088224 3300045976 Bacteria 2814
426 Ga0466967_0094609 3300045976 Bacteria 2721
427 Ga0466967_0099927 3300045976 Bacteria 2650
428 Ga0466967_0133760 3300045976 Bacteria 2304
429 Ga0466967_0161527 3300045976 Bacteria 2103
430 Ga0466967_0174191 3300045976 Bacteria 2026
431 Ga0466967_0206357 3300045976 Bacteria 1863
432 Ga0466967_0225011 3300045976 Bacteria 1784
433 Ga0466967_0233958 3300045976 Bacteria 1750
434 Ga0466967_0247582 3300045976 Bacteria 1701
435 Ga0466967_0254254 3300045976 Bacteria 1679
436 Ga0466967_0315804 3300045976 Bacteria 1506
437 Ga0466967_0365638 3300045976 Bacteria 1398
438 Ga0466967_0420787 3300045976 Bacteria 1302
439 Ga0466967_0423043 3300045976 Bacteria 1298
440 Ga0466967_0471780 3300045976 Bacteria 1228
441 Ga0466967_0567025 3300045976 Bacteria 1118
442 Ga0466967_0607760 3300045976 Bacteria 1079
443 Ga0466967_0677697 3300045976 Bacteria 1020
444 Ga0466967_0760020 3300045976 Bacteria 961
445 Ga0466967_0985161 3300045976 Bacteria 839
446 Ga0466967_0994936 3300045976 Bacteria 835
447 Ga0466967_1574578 3300045976 Bacteria 654
448 Ga0495592_0000124 3300046454 Bacteria 68396
449 Ga0495592_0005934 3300046454 Bacteria 9068
450 Ga0495629_0018477 3300046459 Bacteria 4990
451 Ga0495629_0054231 3300046459 Bacteria 2804
452 Ga0495629_0091290 3300046459 Bacteria 2125
453 Ga0495629_0119877 3300046459 Bacteria 1833
454 Ga0495641_0061747 3300046461 Bacteria 1691
455 Ga0495641_0167076 3300046461 Bacteria 984
456 Ga0495641_0490213 3300046461 Bacteria 560
457 Ga0495651_0000011 3300046462 Bacteria 147193
458 Ga0495651_0051489 3300046462 Bacteria 3174
459 Ga0495653_0001296 3300046463 Bacteria 19369
460 Ga0495653_0029348 3300046463 Bacteria 4392
461 Ga0495653_0088373 3300046463 Bacteria 2274
462 Ga0495653_0429942 3300046463 Bacteria 834
463 Ga0495653_0836853 3300046463 Bacteria 551
464 Ga0495582_0044089 3300046473 Bacteria 2457
465 Ga0495582_0044325 3300046473 Bacteria 2450
466 Ga0495582_0703280 3300046473 Bacteria 585
467 Ga0495605_0057857 3300046474 Bacteria 1865
468 Ga0495662_0277897 3300046476 Bacteria 824
469 Ga0495664_0026457 3300046477 Bacteria 3378
470 Ga0495664_0086913 3300046477 Bacteria 1878
471 Ga0495664_0193177 3300046477 Bacteria 1234
472 Ga0495584_0033026 3300046491 Bacteria 2618
473 Ga0495584_0054947 3300046491 Bacteria 2004
474 Ga0495596_0081735 3300046500 Bacteria 1254
475 Ga0495607_0073552 3300046501 Bacteria 1899
476 Ga0495608_0002975 3300046511 Bacteria 12113
477 Ga0495608_0674450 3300046511 Bacteria 616
478 Ga0495618_0001100 3300046514 Bacteria 18323
479 Ga0495618_0405186 3300046514 Bacteria 833
480 Ga0495628_0000024 3300046516 Bacteria 130196
481 Ga0495628_0007684 3300046516 Bacteria 9321
482 Ga0495628_0657831 3300046516 Bacteria 743
483 Ga0495630_0007053 3300046517 Bacteria 8007
484 Ga0495630_0305053 3300046517 Bacteria 1217
485 Ga0495630_0361031 3300046517 Bacteria 1112
486 Ga0495630_0765446 3300046517 Bacteria 738
487 Ga0495644_0162856 3300046523 Bacteria 855
488 Ga0495652_0000050 3300046529 Bacteria 120480
489 Ga0495652_0551437 3300046529 Bacteria 792
490 Ga0495652_0629466 3300046529 Bacteria 729
491 Ga0495640_0035591 3300046533 Bacteria 3523
492 Ga0495640_0132257 3300046533 Bacteria 1614
493 Ga0495586_0217644 3300046535 Bacteria 1085
494 Ga0495587_0000084 3300046536 Bacteria 72926
495 Ga0495587_0284945 3300046536 Bacteria 925
496 Ga0495587_0384105 3300046536 Bacteria 781
497 Ga0495645_0000067 3300046543 Bacteria 73037
498 Ga0495645_0018585 3300046543 Bacteria 4994
499 Ga0495645_0168116 3300046543 Bacteria 1511
500 Ga0495645_0826044 3300046543 Bacteria 554
501 Ga0495667_0040389 3300046559 Bacteria 3098
502 Ga0495667_0211639 3300046559 Bacteria 1239
503 Ga0495667_0270481 3300046559 Bacteria 1080
504 Ga0495667_0320907 3300046559 Bacteria 980
505 Ga0495656_0070587 3300046615 Bacteria 1550
506 Ga0495668_0478916 3300046616 Bacteria 686
507 Ga0495634_0010896 3300046642 Bacteria 6638
508 Ga0495634_0117873 3300046642 Bacteria 1702
509 Ga0495635_0085700 3300046663 Bacteria 2155
510 Ga0495635_0188271 3300046663 Bacteria 1401
511 Ga0495635_0394940 3300046663 Bacteria 919
512 Ga0495635_0562334 3300046663 Bacteria 747
513 Ga0495588_0363789 3300046674 Bacteria 760
514 Ga0495657_0049553 3300046675 Bacteria 2828
515 Ga0495657_0207180 3300046675 Bacteria 1193
516 Ga0495657_0217952 3300046675 Bacteria 1158
517 Ga0495657_0526864 3300046675 Bacteria 687
518 Ga0495599_0000009 3300046678 Bacteria 217299
519 Ga0495599_0561272 3300046678 Bacteria 668
520 Ga0495599_0661612 3300046678 Bacteria 604
521 Ga0495623_0000219 3300046679 Bacteria 36687
522 Ga0495623_0134609 3300046679 Bacteria 1476
523 Ga0495646_0015895 3300046680 Bacteria 4777
524 Ga0495647_0032452 3300046681 Bacteria 1946
525 Ga0495647_0094057 3300046681 Bacteria 1233
526 Ga0495658_0085513 3300046683 Bacteria 1859
527 Ga0495658_0126474 3300046683 Bacteria 1551
528 Ga0495658_0734553 3300046683 Bacteria 632
529 Ga0495613_0000613 3300046689 Bacteria 28456
530 Ga0495613_0446093 3300046689 Bacteria 877
531 Ga0495613_0742844 3300046689 Bacteria 643
532 Ga0495624_0091606 3300046690 Bacteria 1875
533 Ga0495624_0235883 3300046690 Bacteria 1107
534 Ga0495670_0042596 3300046691 Bacteria 2265
535 Ga0495671_0314823 3300046692 Bacteria 752
536 Ga0495589_0056674 3300046794 Bacteria 1929
537 Ga0495600_0012552 3300046809 Bacteria 5301
538 Ga0495600_0121076 3300046809 Bacteria 1702
539 Ga0495600_0149478 3300046809 Bacteria 1513
540 Ga0495600_0265626 3300046809 Bacteria 1089
541 Ga0495604_0000334 3300047317 Bacteria 42026
542 Ga0495604_0350213 3300047317 Bacteria 981
543 Ga0495636_0087069 3300047318 Bacteria 1352
544 Ga0495674_0156774 3300047319 Bacteria 1907
545 Ga0495674_0203737 3300047319 Bacteria 1641
546 Ga0495674_0244002 3300047319 Bacteria 1479
547 Ga0495674_0514853 3300047319 Bacteria 956
548 Ga0495676_0042115 3300047321 Bacteria 3752
549 Ga0495680_0008157 3300047322 Bacteria 9546
550 Ga0495680_0035105 3300047322 Bacteria 4042
551 Ga0495680_0062832 3300047322 Bacteria 2853
552 Ga0495680_0156897 3300047322 Bacteria 1655
553 Ga0495680_0754260 3300047322 Bacteria 639
554 Ga0495683_0229159 3300047323 Bacteria 825
555 Ga0495675_0000757 3300047444 Bacteria 20228
556 Ga0495684_0053089 3300047471 Bacteria 3092
557 Ga0495593_0202275 3300047673 Bacteria 998
558 Ga0495602_0001847 3300048088 Bacteria 21195
559 Ga0495602_0149854 3300048088 Bacteria 1835
560 Ga0495602_0176094 3300048088 Bacteria 1655
561 Ga0496100_0002976 3300048903 Bacteria 8721
562 Ga0496100_0206325 3300048903 Bacteria 1435
563 Ga0496100_0248537 3300048903 Bacteria 1315
564 Ga0496100_0285056 3300048903 Bacteria 1232
565 Ga0496100_0372859 3300048903 Bacteria 1083
566 Ga0496100_0720752 3300048903 Bacteria 779
567 Ga0496101_0007083 3300048904 Bacteria 7249
568 Ga0496101_0052526 3300048904 Bacteria 2939
569 Ga0496101_0089536 3300048904 Bacteria 2287
570 Ga0496101_0218574 3300048904 Bacteria 1478
571 Ga0496101_0388948 3300048904 Bacteria 1098
572 Ga0496102_0007907 3300048905 Bacteria 9089
573 Ga0496102_0288785 3300048905 Bacteria 1546
574 Ga0496102_0696246 3300048905 Bacteria 939
575 Ga0496103_0008543 3300048906 Bacteria 6086
576 Ga0496103_0084990 3300048906 Bacteria 1994
577 Ga0496103_0156749 3300048906 Bacteria 1460
578 Ga0496103_0238836 3300048906 Bacteria 1169
579 Ga0496104_0000444 3300048907 Bacteria 35985
580 Ga0496104_0001528 3300048907 Bacteria 19957
581 Ga0496104_0022323 3300048907 Bacteria 5813
582 Ga0496104_0046686 3300048907 Bacteria 4080
583 Ga0496104_0104066 3300048907 Bacteria 2720
584 Ga0496104_0478634 3300048907 Bacteria 1156
585 Ga0496104_0777201 3300048907 Bacteria 864
586 Ga0496105_0000200 3300048908 Bacteria 39964
587 Ga0496105_0052506 3300048908 Bacteria 3367
588 Ga0496105_0095255 3300048908 Bacteria 2459
589 Ga0496105_0142684 3300048908 Bacteria 1971
590 Ga0496105_0151863 3300048908 Bacteria 1903
591 Ga0496105_0229459 3300048908 Bacteria 1509
592 Ga0496105_0638261 3300048908 Bacteria 823
593 Ga0496106_0018932 3300048909 Bacteria 5101
594 Ga0496106_0025838 3300048909 Bacteria 4369
595 Ga0496106_0052460 3300048909 Bacteria 3077
596 Ga0496106_0100951 3300048909 Bacteria 2238
597 Ga0496106_0131114 3300048909 Bacteria 1966
598 Ga0496107_0090984 3300048910 Bacteria 2229
599 Ga0496107_0169638 3300048910 Bacteria 1619
600 Ga0496108_0002894 3300048911 Bacteria 13785
601 Ga0496108_0012840 3300048911 Bacteria 6821
602 Ga0496108_0020580 3300048911 Bacteria 5422
603 Ga0496108_0034422 3300048911 Bacteria 4209
604 Ga0496108_0091425 3300048911 Bacteria 2587
605 Ga0496108_0101142 3300048911 Bacteria 2459
606 Ga0496108_1033869 3300048911 Bacteria 700
607 Ga0496108_1292132 3300048911 Bacteria 614
608 Ga0496109_0000461 3300048912 Bacteria 34811
609 Ga0496109_0002306 3300048912 Bacteria 15879
610 Ga0496109_0063284 3300048912 Bacteria 3384
611 Ga0496109_0080750 3300048912 Bacteria 2996
612 Ga0496109_0085944 3300048912 Bacteria 2904
613 Ga0496109_0153756 3300048912 Bacteria 2155
614 Ga0496109_0189563 3300048912 Bacteria 1932
615 Ga0496109_0214079 3300048912 Bacteria 1812
616 Ga0496109_0266632 3300048912 Bacteria 1613
617 Ga0496109_0328224 3300048912 Bacteria 1444
618 Ga0496109_1019582 3300048912 Bacteria 765
619 Ga0496110_0001896 3300048913 Bacteria 15452
620 Ga0496110_0002454 3300048913 Bacteria 13884
621 Ga0496110_0025742 3300048913 Bacteria 5029
622 Ga0496110_0055376 3300048913 Bacteria 3490
623 Ga0496110_0066298 3300048913 Bacteria 3193
624 Ga0496110_0099727 3300048913 Bacteria 2604
625 Ga0496110_0130824 3300048913 Bacteria 2266
626 Ga0496110_0833227 3300048913 Bacteria 827
627 Ga0496111_0000113 3300048914 Bacteria 35668
628 Ga0496111_0001148 3300048914 Bacteria 14704
629 Ga0496111_0046713 3300048914 Bacteria 3118
630 Ga0496111_0095951 3300048914 Bacteria 2176
631 Ga0496111_0103571 3300048914 Bacteria 2093
632 Ga0496111_0712775 3300048914 Bacteria 729
633 Ga0496112_0007214 3300048915 Bacteria 9852
634 Ga0496112_0021708 3300048915 Bacteria 6108
635 Ga0496112_0043655 3300048915 Bacteria 4390
636 Ga0496112_0059375 3300048915 Bacteria 3768
637 Ga0496112_0087049 3300048915 Bacteria 3091
638 Ga0496112_0218378 3300048915 Bacteria 1863
639 Ga0496112_0552302 3300048915 Bacteria 1085
640 Ga0496112_0759456 3300048915 Unclassified 895
641 Ga0496112_0769607 3300048915 Bacteria 888
642 Ga0496113_0011013 3300048916 Bacteria 6010
643 Ga0496113_0114155 3300048916 Bacteria 2106
644 Ga0496113_0270762 3300048916 Bacteria 1357
645 Ga0496113_0544535 3300048916 Bacteria 931
646 Ga0496114_0006544 3300048917 Bacteria 9183
647 Ga0496114_0017599 3300048917 Bacteria 5771
648 Ga0496114_0063433 3300048917 Bacteria 3094
649 Ga0496114_0282377 3300048917 Bacteria 1464
650 Ga0496114_0284551 3300048917 Bacteria 1458
651 Ga0496114_0367705 3300048917 Bacteria 1273
652 Ga0496115_0026438 3300048918 Bacteria 4530
653 Ga0496115_0135763 3300048918 Bacteria 2028
654 Ga0496115_0372805 3300048918 Bacteria 1162
655 Ga0496115_0836236 3300048918 Bacteria 714
656 Ga0501032_0008374 3300049569 Bacteria 7540
657 Ga0501034_0000066 3300049571 Bacteria 184727
658 Ga0501034_0006648 3300049571 Bacteria 12406
659 Ga0501037_0031239 3300049573 Bacteria 3932
660 Ga0501039_0545472 3300049575 Bacteria 910
661 Ga0501039_0972832 3300049575 Bacteria 660
662 Ga0501043_0036713 3300049579 Bacteria 3855
663 Ga0501067_0031664 3300049583 Bacteria 2934
664 Ga0501067_0058209 3300049583 Bacteria 2140
665 Ga0501067_0550439 3300049583 Bacteria 646
666 Ga0501068_0183019 3300049584 Bacteria 1325
667 Ga0501068_0391891 3300049584 Bacteria 895
668 Ga0501069_0031128 3300049585 Bacteria 2933
669 Ga0501072_0070348 3300049588 Bacteria 2763
670 Ga0501074_0033384 3300049590 Bacteria 3729
671 Ga0501074_0067418 3300049590 Bacteria 2574
672 Ga0501075_0291100 3300049591 Bacteria 1244
673 Ga0501077_0034255 3300049593 Bacteria 3232
674 Ga0501079_0006416 3300049741 Bacteria 8831
675 Ga0501080_0014355 3300049742 Bacteria 7293
676 Ga0501080_0099693 3300049742 Bacteria 2695
677 Ga0501081_0038156 3300049743 Bacteria 3280
678 Ga0501083_0004631 3300049744 Bacteria 9713
679 nmdc:mga0yw44_449785_c1 3300050492 Bacteria 873
680 nmdc:mga04h51_245862_c1 3300050495 Bacteria 715
681 nmdc:mga07m45_181143_c1 3300050496 Bacteria 1225
682 nmdc:mga0n895_1570166_c1 3300050512 Bacteria 623
683 nmdc:mga0n895_1616808_c1 3300050512 Bacteria 612
684 nmdc:mga0n895_467221_c1 3300050512 Bacteria 1273
685 nmdc:mga0n895_76263_c1 3300050512 Bacteria 3334
686 nmdc:mga0rr50_248895_c1 3300050513 Bacteria 1475
687 nmdc:mga0rr50_64322_c1 3300050513 Bacteria 2774
688 nmdc:mga0rr50_990573_c1 3300050513 Bacteria 716
689 nmdc:mga08x19_426101_c1 3300050514 Bacteria 932
690 nmdc:mga08x19_503318_c1 3300050514 Bacteria 855
691 nmdc:mga0a205_612791_c1 3300050515 Bacteria 941
692 Ga0495601_0000487 3300053077 Bacteria 20805
693 Ga0495601_0104519 3300053077 Bacteria 1831
694 Ga0495601_0110078 3300053077 Bacteria 1783
695 Ga0495601_0142711 3300053077 Bacteria 1562
696 Ga0495601_0372463 3300053077 Bacteria 927
697 Ga0495601_0571321 3300053077 Bacteria 727
698 Ga0495595_0007262 3300053084 Bacteria 4530
699 Ga0495595_0011324 3300053084 Bacteria 3725
700 Ga0495595_0072429 3300053084 Bacteria 1630
701 Ga0495595_0209284 3300053084 Bacteria 972
702 Ga0495619_0005343 3300053085 Bacteria 8130
703 Ga0495619_0005609 3300053085 Bacteria 7962
704 Ga0495619_0011965 3300053085 Bacteria 5466
705 Ga0495619_0078682 3300053085 Bacteria 2217
706 Ga0495619_0917387 3300053085 Bacteria 589
707 Ga0501084_0036203 3300054114 Bacteria 4123
708 Ga0501082_0230874 3300060353 Bacteria 1610
709 Ga0501082_1068632 3300060353 Bacteria 706
710 Ga0466962_0010130 3300061719 Bacteria 4526
711 Ga0466962_0022021 3300061719 Bacteria 3061
712 Ga0466962_0107571 3300061719 Bacteria 1342
713 2739364832 2738543034 Bacteria 6084756
714 2852649742 2852646457 Bacteria 3408613
715 2904779147 2904776348 Bacteria 4658726
716 2910811905 2910809715 Bacteria 4982797
717 2919061423 2919059106 Bacteria 4991624
718 2932429924 2932426870 Bacteria 4547726
719 2933419361 2933418574 Bacteria 4476724
720 2939650757 2939647034 Bacteria 4681660
721 2939675791 2939674588 Bacteria 4844420
722 2945969873 2945968032 Bacteria 4111363
723 2946027119 2946024296 Bacteria 3508095
724 8033689448 8033684223 Bacteria 6906479
725 Ga0451851_1184046
726 Ga0070658_10024130
727 Ga0070658_10044295
728 Ga0070683_100013654
729 Ga0070683_100048113
730 Ga0070683_100197248
731 Ga0070683_100515396
732 Ga0070683_100520440
733 Ga0070680_100012266
734 Ga0070680_100037889
735 Ga0070680_100046397
736 Ga0070682_100023546
737 Ga0070682_100042155
738 Ga0068868_100173315
739 Ga0068868_100201358
740 Ga0068868_100950570
741 Ga0070660_100010569
742 Ga0070660_100033834
743 Ga0070687_100454337
744 Ga0070661_100084331
745 Ga0070661_100185037
746 Ga0070661_100428688
747 Ga0070692_10338708
748 Ga0070668_100338890
749 Ga0070669_100453975
750 Ga0070671_101331747
751 Ga0070674_101133532
752 Ga0070673_100630166
753 Ga0070659_100078346
754 Ga0070659_100317361
755 Ga0070667_100549080
756 Ga0070703_10171642
757 Ga0070709_10453267
758 Ga0070709_11085532
759 Ga0070714_100046885
760 Ga0070714_100254827
761 Ga0070714_100417590
762 Ga0070714_100573797
763 Ga0070714_101024548
764 Ga0070714_101530655
765 Ga0070713_100173940
766 Ga0070701_10342747
767 Ga0070711_100040739
768 Ga0070711_100172278
769 Ga0070711_100416372
770 Ga0070711_100642206
771 Ga0070711_100778783
772 Ga0070711_101137539
773 Ga0070705_100624006
774 Ga0070700_100887576
775 Ga0070708_100642482
776 Ga0070708_101293802
777 Ga0070678_100008917
778 Ga0070678_101131806
779 Ga0070678_102192367
780 Ga0070662_100453930
781 Ga0070681_10006989
782 Ga0070681_10078229
783 Ga0070681_10084144
784 Ga0070681_10276750
785 Ga0070681_10518818
786 Ga0068867_101645742
787 Ga0070685_10762853
788 Ga0070685_11332219
789 Ga0070706_100260564
790 Ga0070706_100506742
791 Ga0070706_101005280
792 Ga0070707_100000633
793 Ga0070707_101675994
794 Ga0070698_100142629
795 Ga0070698_100214595
796 Ga0070679_100001973
797 Ga0070679_100102120
798 Ga0070679_100141147
799 Ga0070679_100233708
800 Ga0070679_100386805
801 Ga0070679_101658155
802 Ga0070684_100000226
803 Ga0070684_100305941
804 Ga0070684_101494644
805 Ga0068853_100897320
806 Ga0070672_100628367
807 Ga0070672_100823159
808 Ga0070686_100636626
809 Ga0070695_100421850
810 Ga0070695_101693288
811 Ga0070696_100211738
812 Ga0070693_100945050
813 Ga0070665_101229078
814 Ga0070704_100059042
815 Ga0070704_100818874
816 Ga0068855_100057638
817 Ga0068857_100619284
818 Ga0068854_100103423
819 Ga0068856_100053920
820 Ga0068856_100066521
821 Ga0068856_100067956
822 Ga0068856_101397505
823 Ga0068856_101574173
824 Ga0068859_100695999
825 Ga0068859_101748025
826 Ga0068859_102880967
827 Ga0068864_101759057
828 Ga0068866_10274746
829 Ga0068861_100188587
830 Ga0068863_100452639
831 Ga0081455_10291275
832 Ga0070717_10005163
833 Ga0070717_10009227
834 Ga0070717_10011053
835 Ga0070717_10277950
836 Ga0070717_10468632
837 Ga0070717_10470056
838 Ga0070717_11418801
839 Ga0070717_11724913
840 Ga0075365_10500006
841 Ga0075364_10350466
842 Ga0070716_101346109
843 Ga0070712_100050005
844 Ga0070712_100301139
845 Ga0070712_100516575
846 Ga0070712_100547046
847 Ga0070712_100549566
848 Ga0070712_100666252
849 Ga0070712_101204804
850 Ga0075367_10571294
851 Ga0097621_100432036
852 Ga0075370_10051939
853 Ga0068871_100942453
854 Ga0068871_101722270
855 Ga0075430_100578150
856 Ga0075433_10970269
857 Ga0075434_100010482
858 Ga0075434_100474267
859 Ga0075434_101513365
860 Ga0068865_101096509
861 Ga0075436_100310780
862 Ga0075436_100530828
863 Ga0097620_100696027
864 Ga0097620_101747532
865 Ga0097620_102880359
866 Ga0075435_100073084
867 Ga0105244_10066873
868 Ga0105244_10067876
869 Ga0105244_10244746
870 Ga0105244_10254047
871 Ga0105244_10295608
872 Ga0105240_10137719
873 Ga0105240_10143402
874 Ga0105245_10050785
875 Ga0105245_10206250
876 Ga0105245_10850356
877 Ga0105245_10963770
878 Ga0105245_11710653
879 Ga0114129_10678794
880 Ga0114129_11356756
881 Ga0105243_10235565
882 Ga0105243_10347438
883 Ga0105241_11131327
884 Ga0105249_10777399
885 Ga0099796_10079320
886 Ga0105239_10087646
887 Ga0105239_10280211
888 Ga0105239_10442865
889 Ga0105239_10663907
890 Ga0105246_10106845
891 Ga0157373_10092954
892 Ga0157373_10333166
893 Ga0157370_10232952
894 Ga0157370_10635829
895 Ga0157369_10001705
896 Ga0157369_10083907
897 Ga0157369_10881608
898 Ga0157369_11473599
899 Ga0157374_10398806
900 Ga0157374_10603194
901 Ga0157374_10796494
902 Ga0157378_10696848
903 Ga0163162_10111189
904 Ga0163162_10280707
905 Ga0157372_10514212
906 Ga0157372_10518521
907 Ga0157372_10545351
908 Ga0157372_12743535
909 Ga0157375_10157691
910 Ga0157375_11747635
911 Ga0157375_12432569
912 Ga0163163_10135311
913 Ga0182008_10001466
914 Ga0182008_10097424
915 Ga0182008_10114716
916 Ga0182008_10207292
917 Ga0182008_10863289
918 Ga0157377_10144771
919 Ga0157379_10130266
920 Ga0157379_10132046
921 Ga0157376_10029224
922 Ga0157376_10592602
923 Ga0182006_1007203
924 Ga0182007_10004451
925 Ga0206356_11611016
926 Ga0206353_10273639
927 Ga0206353_11455085
928 Ga0206353_11561108
929 Ga0213874_10111245
930 Ga0213876_10062078
931 Ga0209051_1007701
932 Ga0207697_10026395
933 Ga0207655_1022908
934 Ga0207655_1149994
935 Ga0207692_10298891
936 Ga0207699_10100419
937 Ga0207699_10332785
938 Ga0207699_10447098
939 Ga0207699_11085582
940 Ga0207705_10459886
941 Ga0207684_10446897
942 Ga0207654_10266740
943 Ga0207654_10507839
944 Ga0207707_10021653
945 Ga0207707_10049626
946 Ga0207707_10093154
947 Ga0207707_10224920
948 Ga0207707_10411547
949 Ga0207707_11482503
950 Ga0207695_10051170
951 Ga0207693_10001153
952 Ga0207693_10186864
953 Ga0207693_10251905
954 Ga0207693_10436574
955 Ga0207693_10481581
956 Ga0207663_10210069
957 Ga0207660_10012489
958 Ga0207660_10224532
959 Ga0207660_10296727
960 Ga0207660_10644210
961 Ga0207657_10001428
962 Ga0207657_10001687
963 Ga0207657_10007626
964 Ga0207657_10683601
965 Ga0207649_10195631
966 Ga0207649_10612145
967 Ga0207652_10005412
968 Ga0207652_10087174
969 Ga0207652_10356170
970 Ga0207646_10001749
971 Ga0207646_10287354
972 Ga0207694_10647648
973 Ga0207687_10012917
974 Ga0207687_10038612
975 Ga0207687_10110279
976 Ga0207700_10551032
977 Ga0207700_10778778
978 Ga0207664_10247144
979 Ga0207664_10294721
980 Ga0207664_10395005
981 Ga0207664_10411009
982 Ga0207664_10430610
983 Ga0207664_10441026
984 Ga0207664_10504307
985 Ga0207664_10608614
986 Ga0207644_10417302
987 Ga0207690_10086348
988 Ga0207690_11076895
989 Ga0207706_11357169
990 Ga0207686_10066329
991 Ga0207686_10179216
992 Ga0207709_10291626
993 Ga0207669_10127478
994 Ga0207665_10229432
995 Ga0207665_10335294
996 Ga0207665_11091640
997 Ga0207691_10284355
998 Ga0207661_10010057
999 Ga0207661_10217090
1000 Ga0207661_10582051
1001 Ga0207661_10610915
1002 Ga0207667_10170076
1003 Ga0207667_11915290
1004 Ga0207651_10354739
1005 Ga0207640_10060215
1006 Ga0207640_10187737
1007 Ga0207658_10981288
1008 Ga0207677_10053006
1009 Ga0207639_10732602
1010 Ga0207639_11252790
1011 Ga0207702_10006575
1012 Ga0207702_10047637
1013 Ga0207702_10153290
1014 Ga0207702_10376836
1015 Ga0207674_10059519
1016 Ga0207674_10329595
1017 Ga0207674_11635587
1018 Ga0207683_10011493
1019 Ga0207683_11091440
1020 Ga0207683_11128835
1021 Ga0207698_10499511
1022 Ga0207428_10277835
1023 Ga0265337_1077255
1024 Ga0265318_10054781
1025 Ga0265336_10085283
1026 Ga0307515_10075561
1027 Ga0265338_10556829
1028 Ga0265339_10053110
1029 Ga0265339_10103998
1030 Ga0265331_10297922
1031 Ga0265327_10000019
1032 Ga0265327_10082755
1033 Ga0265316_10678566
1034 Ga0265313_10024742
1035 Ga0265313_10106139
1036 Ga0307410_10165272
1037 Ga0307410_10575153
1038 Ga0307410_11948196
1039 Ga0307412_10222624
1040 Ga0307409_101371724
1041 Ga0307415_100281302
1042 Ga0373938_0005377
1043 Ga0373941_0306021
1044 Ga0373957_0136891
1045 Ga0373943_0168160
1046 Ga0373955_0256220
1047 Ga0373924_0294272
1048 Ga0373931_0199791
1049 Ga0373937_0000447
1050 Ga0373937_0359013
1051 Ga0373937_0766363
1052 Ga0373925_0807104
1053 Ga0395899_0036333
1054 Ga0395899_0355945
1055 Ga0395900_0087940
1056 Ga0395900_0161246
1057 Ga0395900_0173599
1058 Ga0395900_1604034
1059 Ga0395898_0138416
1060 Ga0395898_0213814
1061 Ga0395898_0254767
1062 Ga0395898_0755068
1063 Ga0395898_1637765
1064 Ga0395898_1641664
1065 Ga0395905_0059446
1066 Ga0395905_0260892
1067 Ga0395905_1777294
1068 Ga0436364_1204968
1069 Ga0395901_0019380
1070 Ga0395901_0190108
1071 Ga0395901_0660297
1072 Ga0395901_0793231
1073 Ga0436365_0960298
1074 Ga0436360_0782260
1075 Ga0436363_0412008
1076 Ga0436363_0850823
1077 Ga0439458_0076481
1078 Ga0451577_0338639
1079 Ga0466965_0104936
1080 Ga0466965_0417980
1081 Ga0466966_0016294
1082 Ga0466961_0027058
1083 Ga0466961_0037049
1084 Ga0466961_0188676
1085 Ga0466961_0189804
1086 Ga0466963_0000619
1087 Ga0466963_0000941
1088 Ga0466963_0002309
1089 Ga0466963_0009360
1090 Ga0466963_0010180
1091 Ga0466963_0017156
1092 Ga0466963_0018386
1093 Ga0466963_0041717
1094 Ga0466963_0045895
1095 Ga0466963_0047009
1096 Ga0466963_0114958
1097 Ga0466963_0133894
1098 Ga0466963_0146303
1099 Ga0466963_0430317
1100 Ga0466963_0546250
1101 Ga0466963_0692644
1102 Ga0466964_0010167
1103 Ga0466964_0061509
1104 Ga0466964_0125804
1105 Ga0466964_0128977
1106 Ga0466964_0214264
1107 Ga0466964_0231695
1108 Ga0466964_0391712
1109 Ga0466964_0602837
1110 Ga0466971_0023171
1111 Ga0466971_0049863
1112 Ga0466971_0110788
1113 Ga0466971_0292237
1114 Ga0466968_0008788
1115 Ga0466968_0035404
1116 Ga0466968_0062218
1117 Ga0466968_0075890
1118 Ga0466968_0337128
1119 Ga0466970_0352271
1120 Ga0466970_0364527
1121 Ga0466957_0003145
1122 Ga0466957_0005881
1123 Ga0466957_0006804
1124 Ga0466957_0668594
1125 Ga0466957_0721657
1126 Ga0466957_1413363
1127 Ga0466960_0126969
1128 Ga0466960_0168758
1129 Ga0466960_0290699
1130 Ga0466960_0402595
1131 Ga0466959_0010855
1132 Ga0466959_0028656
1133 Ga0466959_0113440
1134 Ga0466959_0400227
1135 Ga0466958_0000905
1136 Ga0466958_0025112
1137 Ga0466958_0027856
1138 Ga0466958_0032128
1139 Ga0466958_0047069
1140 Ga0466958_0175988
1141 Ga0466958_0814503
1142 Ga0466967_0000047
1143 Ga0466967_0003348
1144 Ga0466967_0009506
1145 Ga0466967_0015841
1146 Ga0466967_0027857
1147 Ga0466967_0081915
1148 Ga0466967_0083772
1149 Ga0466967_0088224
1150 Ga0466967_0094609
1151 Ga0466967_0099927
1152 Ga0466967_0133760
1153 Ga0466967_0161527
1154 Ga0466967_0174191
1155 Ga0466967_0206357
1156 Ga0466967_0225011
1157 Ga0466967_0233958
1158 Ga0466967_0247582
1159 Ga0466967_0254254
1160 Ga0466967_0315804
1161 Ga0466967_0365638
1162 Ga0466967_0420787
1163 Ga0466967_0423043
1164 Ga0466967_0471780
1165 Ga0466967_0567025
1166 Ga0466967_0607760
1167 Ga0466967_0677697
1168 Ga0466967_0760020
1169 Ga0466967_0985161
1170 Ga0466967_0994936
1171 Ga0466967_1574578
1172 Ga0495592_0000124
1173 Ga0495592_0005934
1174 Ga0495629_0018477
1175 Ga0495629_0054231
1176 Ga0495629_0091290
1177 Ga0495629_0119877
1178 Ga0495641_0061747
1179 Ga0495641_0167076
1180 Ga0495641_0490213
1181 Ga0495651_0000011
1182 Ga0495651_0051489
1183 Ga0495653_0001296
1184 Ga0495653_0029348
1185 Ga0495653_0088373
1186 Ga0495653_0429942
1187 Ga0495653_0836853
1188 Ga0495582_0044089
1189 Ga0495582_0044325
1190 Ga0495582_0703280
1191 Ga0495605_0057857
1192 Ga0495662_0277897
1193 Ga0495664_0026457
1194 Ga0495664_0086913
1195 Ga0495664_0193177
1196 Ga0495584_0033026
1197 Ga0495584_0054947
1198 Ga0495596_0081735
1199 Ga0495607_0073552
1200 Ga0495608_0002975
1201 Ga0495608_0674450
1202 Ga0495618_0001100
1203 Ga0495618_0405186
1204 Ga0495628_0000024
1205 Ga0495628_0007684
1206 Ga0495628_0657831
1207 Ga0495630_0007053
1208 Ga0495630_0305053
1209 Ga0495630_0361031
1210 Ga0495630_0765446
1211 Ga0495644_0162856
1212 Ga0495652_0000050
1213 Ga0495652_0551437
1214 Ga0495652_0629466
1215 Ga0495640_0035591
1216 Ga0495640_0132257
1217 Ga0495586_0217644
1218 Ga0495587_0000084
1219 Ga0495587_0284945
1220 Ga0495587_0384105
1221 Ga0495645_0000067
1222 Ga0495645_0018585
1223 Ga0495645_0168116
1224 Ga0495645_0826044
1225 Ga0495667_0040389
1226 Ga0495667_0211639
1227 Ga0495667_0270481
1228 Ga0495667_0320907
1229 Ga0495656_0070587
1230 Ga0495668_0478916
1231 Ga0495634_0010896
1232 Ga0495634_0117873
1233 Ga0495635_0085700
1234 Ga0495635_0188271
1235 Ga0495635_0394940
1236 Ga0495635_0562334
1237 Ga0495588_0363789
1238 Ga0495657_0049553
1239 Ga0495657_0207180
1240 Ga0495657_0217952
1241 Ga0495657_0526864
1242 Ga0495599_0000009
1243 Ga0495599_0561272
1244 Ga0495599_0661612
1245 Ga0495623_0000219
1246 Ga0495623_0134609
1247 Ga0495646_0015895
1248 Ga0495647_0032452
1249 Ga0495647_0094057
1250 Ga0495658_0085513
1251 Ga0495658_0126474
1252 Ga0495658_0734553
1253 Ga0495613_0000613
1254 Ga0495613_0446093
1255 Ga0495613_0742844
1256 Ga0495624_0091606
1257 Ga0495624_0235883
1258 Ga0495670_0042596
1259 Ga0495671_0314823
1260 Ga0495589_0056674
1261 Ga0495600_0012552
1262 Ga0495600_0121076
1263 Ga0495600_0149478
1264 Ga0495600_0265626
1265 Ga0495604_0000334
1266 Ga0495604_0350213
1267 Ga0495636_0087069
1268 Ga0495674_0156774
1269 Ga0495674_0203737
1270 Ga0495674_0244002
1271 Ga0495674_0514853
1272 Ga0495676_0042115
1273 Ga0495680_0008157
1274 Ga0495680_0035105
1275 Ga0495680_0062832
1276 Ga0495680_0156897
1277 Ga0495680_0754260
1278 Ga0495683_0229159
1279 Ga0495675_0000757
1280 Ga0495684_0053089
1281 Ga0495593_0202275
1282 Ga0495602_0001847
1283 Ga0495602_0149854
1284 Ga0495602_0176094
1285 Ga0496100_0002976
1286 Ga0496100_0206325
1287 Ga0496100_0248537
1288 Ga0496100_0285056
1289 Ga0496100_0372859
1290 Ga0496100_0720752
1291 Ga0496101_0007083
1292 Ga0496101_0052526
1293 Ga0496101_0089536
1294 Ga0496101_0218574
1295 Ga0496101_0388948
1296 Ga0496102_0007907
1297 Ga0496102_0288785
1298 Ga0496102_0696246
1299 Ga0496103_0008543
1300 Ga0496103_0084990
1301 Ga0496103_0156749
1302 Ga0496103_0238836
1303 Ga0496104_0000444
1304 Ga0496104_0001528
1305 Ga0496104_0022323
1306 Ga0496104_0046686
1307 Ga0496104_0104066
1308 Ga0496104_0478634
1309 Ga0496104_0777201
1310 Ga0496105_0000200
1311 Ga0496105_0052506
1312 Ga0496105_0095255
1313 Ga0496105_0142684
1314 Ga0496105_0151863
1315 Ga0496105_0229459
1316 Ga0496105_0638261
1317 Ga0496106_0018932
1318 Ga0496106_0025838
1319 Ga0496106_0052460
1320 Ga0496106_0100951
1321 Ga0496106_0131114
1322 Ga0496107_0090984
1323 Ga0496107_0169638
1324 Ga0496108_0002894
1325 Ga0496108_0012840
1326 Ga0496108_0020580
1327 Ga0496108_0034422
1328 Ga0496108_0091425
1329 Ga0496108_0101142
1330 Ga0496108_1033869
1331 Ga0496108_1292132
1332 Ga0496109_0000461
1333 Ga0496109_0002306
1334 Ga0496109_0063284
1335 Ga0496109_0080750
1336 Ga0496109_0085944
1337 Ga0496109_0153756
1338 Ga0496109_0189563
1339 Ga0496109_0214079
1340 Ga0496109_0266632
1341 Ga0496109_0328224
1342 Ga0496109_1019582
1343 Ga0496110_0001896
1344 Ga0496110_0002454
1345 Ga0496110_0025742
1346 Ga0496110_0055376
1347 Ga0496110_0066298
1348 Ga0496110_0099727
1349 Ga0496110_0130824
1350 Ga0496110_0833227
1351 Ga0496111_0000113
1352 Ga0496111_0001148
1353 Ga0496111_0046713
1354 Ga0496111_0095951
1355 Ga0496111_0103571
1356 Ga0496111_0712775
1357 Ga0496112_0007214
1358 Ga0496112_0021708
1359 Ga0496112_0043655
1360 Ga0496112_0059375
1361 Ga0496112_0087049
1362 Ga0496112_0218378
1363 Ga0496112_0552302
1364 Ga0496112_0759456
1365 Ga0496112_0769607
1366 Ga0496113_0011013
1367 Ga0496113_0114155
1368 Ga0496113_0270762
1369 Ga0496113_0544535
1370 Ga0496114_0006544
1371 Ga0496114_0017599
1372 Ga0496114_0063433
1373 Ga0496114_0282377
1374 Ga0496114_0284551
1375 Ga0496114_0367705
1376 Ga0496115_0026438
1377 Ga0496115_0135763
1378 Ga0496115_0372805
1379 Ga0496115_0836236
1380 Ga0501032_0008374
1381 Ga0501034_0000066
1382 Ga0501034_0006648
1383 Ga0501037_0031239
1384 Ga0501039_0545472
1385 Ga0501039_0972832
1386 Ga0501043_0036713
1387 Ga0501067_0031664
1388 Ga0501067_0058209
1389 Ga0501067_0550439
1390 Ga0501068_0183019
1391 Ga0501068_0391891
1392 Ga0501069_0031128
1393 Ga0501072_0070348
1394 Ga0501074_0033384
1395 Ga0501074_0067418
1396 Ga0501075_0291100
1397 Ga0501077_0034255
1398 Ga0501079_0006416
1399 Ga0501080_0014355
1400 Ga0501080_0099693
1401 Ga0501081_0038156
1402 Ga0501083_0004631
1403 nmdc:mga0yw44_449785_c1
1404 nmdc:mga04h51_245862_c1
1405 nmdc:mga07m45_181143_c1
1406 nmdc:mga0n895_1570166_c1
1407 nmdc:mga0n895_1616808_c1
1408 nmdc:mga0n895_467221_c1
1409 nmdc:mga0n895_76263_c1
1410 nmdc:mga0rr50_248895_c1
1411 nmdc:mga0rr50_64322_c1
1412 nmdc:mga0rr50_990573_c1
1413 nmdc:mga08x19_426101_c1
1414 nmdc:mga08x19_503318_c1
1415 nmdc:mga0a205_612791_c1
1416 Ga0495601_0000487
1417 Ga0495601_0104519
1418 Ga0495601_0110078
1419 Ga0495601_0142711
1420 Ga0495601_0372463
1421 Ga0495601_0571321
1422 Ga0495595_0007262
1423 Ga0495595_0011324
1424 Ga0495595_0072429
1425 Ga0495595_0209284
1426 Ga0495619_0005343
1427 Ga0495619_0005609
1428 Ga0495619_0011965
1429 Ga0495619_0078682
1430 Ga0495619_0917387
1431 Ga0501084_0036203
1432 Ga0501082_0230874
1433 Ga0501082_1068632
1434 Ga0466962_0010130
1435 Ga0466962_0022021
1436 Ga0466962_0107571
1437 2739364832
1438 2852649742
1439 2904779147
1440 2910811905
1441 2919061423
1442 2932429924
1443 2933419361
1444 2939650757
1445 2939675791
1446 2945969873
1447 2946027119
1448 8033689448

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00376

MerR

MerR family regulatory protein

6

42

0.99

PF09278

MerR-DNA-bind

MerR, DNA binding

47

112

0.98

PF13411

MerR_1

MerR HTH family regulatory protein

5

73

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r24-assembly1.cif.gz_B complete dissection of b. subtilis nitrogen homeostatic circuitry 0.9296 2 72
5i44-assembly4.cif.gz_E structure of raca-dna complex; p21 form 0.8963 4 64
7tea-assembly2.cif.gz_C crystal structure of s. aureus glnr-dna complex 0.8927 1 72
2dg6-assembly1.cif.gz_A-2 crystal structure of the putative transcriptional regulator sco5550 from streptomyces coelicolor a3(2) 0.8865 5 70
5i41-assembly1.cif.gz_B structure of the apo raca dna binding domain 0.8776 3 64
ID Description Score Start End Superfamily
af_O06302_4_79_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.926 2 68 1.10.1660.10
3hh0D01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9228 3 68 1.10.1660.10
4r22B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9129 1 72 1.10.1660.10
af_P33358_1_73_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.91 3 71 1.10.1660.10
3hh0C01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.9033 3 70 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A127SKU8-F1-model_v4 SoxR 0.9928 4 74 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A530M347-F1-model_v4 MerR family transcriptional regulator 0.9899 1 70 GO:0003677
GO:0003700
AF-A0A2V8D952-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9754 1 91 GO:0003677
GO:0003700
AF-A0A353CDX2-F1-model_v4 Redox-sensitive transcriptional activator SoxR 0.9708 3 112 GO:0003677
GO:0003700
GO:0006979
GO:0051537
AF-A0A141RI41-F1-model_v4 SoxR 0.9681 4 80 GO:0003677
GO:0003700
GO:0006979
GO:0051537

Map