F477566

General Info

Members Datasets Scaffolds Average Seq Length
724 402 1448 165

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100014453|Ga0307409_1000144532
Length 191
Sequence MGWAVAARPEFANPDPVPPLIRGNSLEPDMSEVLVIATKPDTLRVQRSVGIKASPDDIFPLISDFRQWRNWSPYEQKDPAMKRTYSGAERGQGAVYAWDGDKNVGSGRMEILDASVPQRIAIKLDFFKPFEGHNTAEFTMLPQGDGTHVTWLMHGPARFLTRLIQVFMNLDNMIGKDFEVGLANLKTITEK

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
89 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
90 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
174 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
175 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
202 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
294 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
322 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
331 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
350 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
351 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
352 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
355 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
358 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
363 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
364 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
365 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
366 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
369 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
372 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
373 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
374 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
375 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
376 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
377 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
378 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
379 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
380 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
383 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
384 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
385 2643221607 Rhizobium sp. Root73 Isolate Unclassified
386 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
387 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
388 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
389 2791355199
390 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
391 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
392 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
393 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
394 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
395 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
396 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
397 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
398 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
399 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
400 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
401 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
402 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.54
Nodule 2.62
Rhizoplane 8.7
Rhizosphere 68.92
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100014453 3300031995 Bacteria 5136
2 LJQas_1002452 3300000549 Bacteria 2574
3 JGI24744J21845_10007506 3300002077 Bacteria 2253
4 JGI25165J46597_1005047 3300003214 Bacteria 2639
5 JGI25153J46596_10009592 3300003215 Bacteria 4473
6 JGI25405J52794_10011407 3300003911 Bacteria 1701
7 Ga0065715_10258935 3300005293 Bacteria 1144
8 Ga0070676_10055728 3300005328 Bacteria 2334
9 Ga0070676_10110711 3300005328 Bacteria 1709
10 Ga0070683_100002138 3300005329 Bacteria 15616
11 Ga0070683_100917073 3300005329 Bacteria 841
12 Ga0070690_100053814 3300005330 Bacteria 2575
13 Ga0070670_100346476 3300005331 Bacteria 1305
14 Ga0068869_100067827 3300005334 Bacteria 2633
15 Ga0068869_100310348 3300005334 Bacteria 1276
16 Ga0068869_100532733 3300005334 Bacteria 984
17 Ga0068869_100742431 3300005334 Bacteria 840
18 Ga0070666_10239538 3300005335 Bacteria 1283
19 Ga0070666_10389644 3300005335 Bacteria 1001
20 Ga0070682_100186034 3300005337 Bacteria 1455
21 Ga0068868_100006404 3300005338 Bacteria 8329
22 Ga0070660_100120229 3300005339 Bacteria 2096
23 Ga0070660_101002485 3300005339 Bacteria 706
24 Ga0070689_100283582 3300005340 Bacteria 1374
25 Ga0070691_10130422 3300005341 Bacteria 1273
26 Ga0070687_100417911 3300005343 Bacteria 884
27 Ga0070668_100013490 3300005347 Bacteria 6099
28 Ga0070668_100094754 3300005347 Bacteria 2357
29 Ga0070668_100292673 3300005347 Bacteria 1363
30 Ga0070668_100439493 3300005347 Bacteria 1120
31 Ga0070668_100452092 3300005347 Bacteria 1104
32 Ga0070669_100247074 3300005353 Bacteria 1419
33 Ga0070675_100271799 3300005354 Bacteria 1488
34 Ga0070675_100861299 3300005354 Bacteria 829
35 Ga0070675_101006962 3300005354 Bacteria 765
36 Ga0070671_100227859 3300005355 Bacteria 1581
37 Ga0070674_100128685 3300005356 Bacteria 1884
38 Ga0070674_100278454 3300005356 Bacteria 1325
39 Ga0070673_100830213 3300005364 Bacteria 854
40 Ga0070673_101116533 3300005364 Bacteria 737
41 Ga0070667_100284482 3300005367 Bacteria 1486
42 Ga0070667_100420403 3300005367 Bacteria 1218
43 Ga0070667_100867347 3300005367 Bacteria 840
44 Ga0070714_101307545 3300005435 Bacteria 708
45 Ga0070713_100046315 3300005436 Bacteria 3568
46 Ga0070713_100052950 3300005436 Bacteria 3362
47 Ga0070713_100724894 3300005436 Bacteria 950
48 Ga0070710_10275305 3300005437 Bacteria 1090
49 Ga0070701_10039691 3300005438 Bacteria 2390
50 Ga0070701_10209488 3300005438 Bacteria 1157
51 Ga0070711_100327315 3300005439 Bacteria 1226
52 Ga0070705_100339779 3300005440 Bacteria 1091
53 Ga0070694_100298033 3300005444 Bacteria 1234
54 Ga0070663_100077431 3300005455 Bacteria 2434
55 Ga0070663_100152677 3300005455 Bacteria 1772
56 Ga0070663_100783217 3300005455 Bacteria 816
57 Ga0070663_101018055 3300005455 Bacteria 721
58 Ga0070678_100014685 3300005456 Bacteria 4951
59 Ga0070678_100102369 3300005456 Bacteria 2222
60 Ga0070678_100199222 3300005456 Bacteria 1651
61 Ga0068867_100021006 3300005459 Bacteria 4657
62 Ga0068867_100650888 3300005459 Bacteria 925
63 Ga0068867_100970719 3300005459 Bacteria 769
64 Ga0070685_10202337 3300005466 Bacteria 1292
65 Ga0070706_100686555 3300005467 Bacteria 950
66 Ga0070706_100727817 3300005467 Bacteria 920
67 Ga0070707_101203377 3300005468 Bacteria 724
68 Ga0070699_100159280 3300005518 Bacteria 1998
69 Ga0070679_100071048 3300005530 Bacteria 3471
70 Ga0070684_100013257 3300005535 Bacteria 6641
71 Ga0070697_100020889 3300005536 Bacteria 5184
72 Ga0070697_101311514 3300005536 Bacteria 646
73 Ga0068853_100105141 3300005539 Bacteria 2500
74 Ga0068853_100292871 3300005539 Bacteria 1503
75 Ga0070672_100099136 3300005543 Bacteria 2361
76 Ga0070672_100101389 3300005543 Bacteria 2335
77 Ga0070695_100388752 3300005545 Bacteria 1055
78 Ga0070696_100452200 3300005546 Bacteria 1014
79 Ga0070693_100080019 3300005547 Bacteria 1946
80 Ga0070665_100162979 3300005548 Bacteria 2232
81 Ga0070665_100410507 3300005548 Bacteria 1362
82 Ga0070665_100605647 3300005548 Bacteria 1108
83 Ga0070665_100608637 3300005548 Bacteria 1106
84 Ga0070665_100864126 3300005548 Bacteria 917
85 Ga0070704_100330878 3300005549 Bacteria 1280
86 Ga0070704_101019031 3300005549 Unclassified 749
87 Ga0068855_100569247 3300005563 Bacteria 1225
88 Ga0070664_100062716 3300005564 Bacteria 3169
89 Ga0070664_100072449 3300005564 Bacteria 2955
90 Ga0068857_100188408 3300005577 Bacteria 1879
91 Ga0068854_100267518 3300005578 Bacteria 1371
92 Ga0068854_100771757 3300005578 Bacteria 836
93 Ga0070702_100161556 3300005615 Bacteria 1449
94 Ga0068852_100168020 3300005616 Bacteria 2054
95 Ga0068852_100223430 3300005616 Bacteria 1792
96 Ga0068852_100374504 3300005616 Bacteria 1395
97 Ga0068852_101185060 3300005616 Bacteria 785
98 Ga0068859_100135274 3300005617 Bacteria 2537
99 Ga0068859_100588222 3300005617 Bacteria 1206
100 Ga0068864_100112223 3300005618 Bacteria 2429
101 Ga0068864_100272177 3300005618 Bacteria 1578
102 Ga0068864_100371685 3300005618 Bacteria 1353
103 Ga0068866_10040074 3300005718 Bacteria 2317
104 Ga0068866_10166374 3300005718 Bacteria 1290
105 Ga0068861_100021444 3300005719 Bacteria 4642
106 Ga0068861_100071608 3300005719 Bacteria 2687
107 Ga0068861_100336569 3300005719 Bacteria 1320
108 Ga0068861_100492481 3300005719 Bacteria 1106
109 Ga0068851_10030046 3300005834 Bacteria 2693
110 Ga0068870_10058566 3300005840 Bacteria 2062
111 Ga0068863_100000231 3300005841 Bacteria 59096
112 Ga0068863_100082905 3300005841 Bacteria 3038
113 Ga0068863_100294794 3300005841 Bacteria 1572
114 Ga0068863_100809363 3300005841 Bacteria 935
115 Ga0068858_100077169 3300005842 Bacteria 3094
116 Ga0068858_100126335 3300005842 Bacteria 2395
117 Ga0068858_101098675 3300005842 Bacteria 781
118 Ga0068858_101114455 3300005842 Bacteria 775
119 Ga0068860_100414647 3300005843 Bacteria 1334
120 Ga0068860_100625342 3300005843 Bacteria 1083
121 Ga0068862_100320487 3300005844 Bacteria 1430
122 Ga0068862_100612697 3300005844 Bacteria 1046
123 Ga0081455_10002785 3300005937 Bacteria 20594
124 Ga0081455_10060822 3300005937 Bacteria 3182
125 Ga0081540_1010291 3300005983 Bacteria 6346
126 Ga0081540_1119220 3300005983 Bacteria 1098
127 Ga0081539_10089525 3300005985 Bacteria 1594
128 Ga0070717_10000460 3300006028 Bacteria 25862
129 Ga0070717_10700931 3300006028 Bacteria 920
130 Ga0075365_10041120 3300006038 Bacteria 3018
131 Ga0075365_10245163 3300006038 Bacteria 1258
132 Ga0075368_10053271 3300006042 Bacteria 1610
133 Ga0075368_10110130 3300006042 Bacteria 1135
134 Ga0075368_10306727 3300006042 Bacteria 686
135 Ga0075363_100055314 3300006048 Bacteria 2125
136 Ga0075363_100183054 3300006048 Bacteria 1193
137 Ga0075363_100184298 3300006048 Bacteria 1189
138 Ga0075364_10150124 3300006051 Bacteria 1570
139 Ga0070715_10073801 3300006163 Bacteria 1531
140 Ga0070715_10302837 3300006163 Bacteria 856
141 Ga0070716_100526628 3300006173 Bacteria 877
142 Ga0070712_100173829 3300006175 Bacteria 1673
143 Ga0070712_101100235 3300006175 Bacteria 690
144 Ga0075362_10237307 3300006177 Bacteria 894
145 Ga0075367_10056926 3300006178 Bacteria 2323
146 Ga0075367_10087751 3300006178 Bacteria 1889
147 Ga0075367_10305366 3300006178 Bacteria 1002
148 Ga0075369_10078875 3300006186 Bacteria 1458
149 Ga0075369_10122341 3300006186 Bacteria 1179
150 Ga0075369_10221965 3300006186 Bacteria 875
151 Ga0075369_10352551 3300006186 Bacteria 690
152 Ga0097621_100037847 3300006237 Bacteria 3869
153 Ga0075370_10013830 3300006353 Bacteria 4294
154 Ga0075370_10032745 3300006353 Bacteria 2907
155 Ga0075370_10043187 3300006353 Bacteria 2548
156 Ga0075370_10226527 3300006353 Bacteria 1105
157 Ga0068871_100060972 3300006358 Bacteria 3079
158 Ga0068871_100224504 3300006358 Bacteria 1629
159 Ga0068871_100295485 3300006358 Bacteria 1420
160 Ga0075428_100674399 3300006844 Bacteria 1102
161 Ga0075430_100518073 3300006846 Bacteria 984
162 Ga0068865_100032124 3300006881 Bacteria 3504
163 Ga0068865_100042465 3300006881 Bacteria 3101
164 Ga0097620_100135278 3300006931 Bacteria 2537
165 Ga0097620_100588248 3300006931 Bacteria 1206
166 Ga0099825_1032168 3300006941 Bacteria 2153
167 Ga0099824_1016972 3300006942 Bacteria 6452
168 Ga0099822_1004807 3300006943 Bacteria 17628
169 Ga0099794_10268996 3300007265 Bacteria 880
170 Ga0099794_10368014 3300007265 Bacteria 749
171 Ga0099795_10005225 3300007788 Bacteria 3432
172 Ga0099795_10023844 3300007788 Bacteria 2034
173 Ga0099795_10038257 3300007788 Bacteria 1692
174 Ga0099795_10236544 3300007788 Bacteria 783
175 Ga0105240_10225510 3300009093 Bacteria 2181
176 Ga0105240_10918433 3300009093 Bacteria 941
177 Ga0111539_10291752 3300009094 Bacteria 1898
178 Ga0111539_11050371 3300009094 Bacteria 947
179 Ga0105245_10010180 3300009098 Bacteria 8188
180 Ga0105247_10368595 3300009101 Bacteria 1015
181 Ga0105247_10421862 3300009101 Bacteria 955
182 Ga0114129_10437458 3300009147 Bacteria 1717
183 Ga0114129_11012443 3300009147 Bacteria 1045
184 Ga0105243_10063654 3300009148 Bacteria 2956
185 Ga0105243_10352191 3300009148 Bacteria 1352
186 Ga0105241_10057387 3300009174 Bacteria 2986
187 Ga0105241_10134091 3300009174 Bacteria 2008
188 Ga0105241_10259975 3300009174 Bacteria 1475
189 Ga0105242_10309316 3300009176 Bacteria 1445
190 Ga0105248_10026042 3300009177 Bacteria 6506
191 Ga0105248_10203617 3300009177 Bacteria 2230
192 Ga0105248_10315071 3300009177 Bacteria 1762
193 Ga0105237_10067810 3300009545 Bacteria 3561
194 Ga0105237_10163591 3300009545 Bacteria 2224
195 Ga0105237_10822113 3300009545 Bacteria 936
196 Ga0105238_10227690 3300009551 Bacteria 1841
197 Ga0105249_10089683 3300009553 Bacteria 2874
198 Ga0105249_10150105 3300009553 Bacteria 2243
199 Ga0105249_10374042 3300009553 Bacteria 1449
200 Ga0105239_10049562 3300010375 Bacteria 4605
201 Ga0105239_10176034 3300010375 Bacteria 2393
202 Ga0105239_10203875 3300010375 Bacteria 2216
203 Ga0105239_10474294 3300010375 Bacteria 1421
204 Ga0105246_10039944 3300011119 Bacteria 3164
205 Ga0105246_10580859 3300011119 Bacteria 965
206 Ga0105246_10743078 3300011119 Bacteria 864
207 Ga0157374_10028177 3300013296 Bacteria 5072
208 Ga0157374_10105817 3300013296 Bacteria 2702
209 Ga0157374_10411172 3300013296 Bacteria 1351
210 Ga0157378_10043705 3300013297 Bacteria 3978
211 Ga0157378_10536860 3300013297 Bacteria 1173
212 Ga0157378_10667062 3300013297 Bacteria 1057
213 Ga0157378_11882279 3300013297 Bacteria 647
214 Ga0163162_10111100 3300013306 Bacteria 2838
215 Ga0163162_10611103 3300013306 Bacteria 1216
216 Ga0163162_10824571 3300013306 Bacteria 1044
217 Ga0163162_11202541 3300013306 Bacteria 860
218 Ga0157375_10037030 3300013308 Bacteria 4671
219 Ga0157375_10115292 3300013308 Bacteria 2790
220 Ga0157375_11180137 3300013308 Bacteria 898
221 Ga0163163_10089828 3300014325 Bacteria 3085
222 Ga0163163_10253936 3300014325 Bacteria 1809
223 Ga0163163_11251919 3300014325 Bacteria 804
224 Ga0157380_10040768 3300014326 Bacteria 3619
225 Ga0157379_10127631 3300014968 Bacteria 2289
226 Ga0157379_10205992 3300014968 Bacteria 1779
227 Ga0157379_10226320 3300014968 Bacteria 1695
228 Ga0157379_10329562 3300014968 Bacteria 1395
229 Ga0157376_10188163 3300014969 Bacteria 1891
230 Ga0157376_11011021 3300014969 Bacteria 854
231 Ga0182006_1171005 3300015261 Bacteria 728
232 Ga0163161_10092455 3300017792 Bacteria 2240
233 Ga0163161_10118281 3300017792 Bacteria 1989
234 Ga0163161_10179568 3300017792 Bacteria 1622
235 Ga0163161_10531738 3300017792 Bacteria 961
236 Ga0209233_1014256 3300025261 Bacteria 2244
237 Ga0209758_1007538 3300025297 Bacteria 7364
238 Ga0209758_1010903 3300025297 Bacteria 5354
239 Ga0209758_1082752 3300025297 Bacteria 965
240 Ga0207697_10059688 3300025315 Bacteria 1585
241 Ga0207696_1111840 3300025711 Bacteria 740
242 Ga0207642_10134961 3300025899 Bacteria 1293
243 Ga0207710_10110153 3300025900 Bacteria 1307
244 Ga0207688_10700599 3300025901 Bacteria 640
245 Ga0207680_10324850 3300025903 Bacteria 1077
246 Ga0207647_10138774 3300025904 Bacteria 1425
247 Ga0207685_10201962 3300025905 Bacteria 934
248 Ga0207645_10117629 3300025907 Bacteria 1724
249 Ga0207643_10059936 3300025908 Bacteria 2172
250 Ga0207705_10959493 3300025909 Bacteria 661
251 Ga0207684_10149544 3300025910 Bacteria 2009
252 Ga0207654_10027726 3300025911 Bacteria 3081
253 Ga0207654_10484170 3300025911 Bacteria 872
254 Ga0207707_10219551 3300025912 Bacteria 1655
255 Ga0207695_10264236 3300025913 Bacteria 1618
256 Ga0207671_10201946 3300025914 Bacteria 1553
257 Ga0207671_10462307 3300025914 Bacteria 1011
258 Ga0207693_10593820 3300025915 Bacteria 862
259 Ga0207663_10122838 3300025916 Bacteria 1781
260 Ga0207649_10566446 3300025920 Bacteria 871
261 Ga0207652_10122765 3300025921 Bacteria 2312
262 Ga0207646_10159697 3300025922 Bacteria 2034
263 Ga0207694_10544783 3300025924 Bacteria 973
264 Ga0207694_10735331 3300025924 Bacteria 833
265 Ga0207650_10327132 3300025925 Bacteria 1256
266 Ga0207700_10008658 3300025928 Bacteria 6318
267 Ga0207700_10103231 3300025928 Bacteria 2279
268 Ga0207700_10592622 3300025928 Bacteria 986
269 Ga0207664_10154737 3300025929 Bacteria 1951
270 Ga0207664_11393024 3300025929 Bacteria 622
271 Ga0207644_10104878 3300025931 Bacteria 2129
272 Ga0207706_10302874 3300025933 Bacteria 1392
273 Ga0207686_10120804 3300025934 Bacteria 1783
274 Ga0207686_10365272 3300025934 Bacteria 1091
275 Ga0207709_10168798 3300025935 Bacteria 1534
276 Ga0207709_10221557 3300025935 Bacteria 1365
277 Ga0207709_10428352 3300025935 Bacteria 1018
278 Ga0207669_10059712 3300025937 Bacteria 2334
279 Ga0207669_10094129 3300025937 Bacteria 1959
280 Ga0207669_10137542 3300025937 Bacteria 1690
281 Ga0207669_10714572 3300025937 Bacteria 825
282 Ga0207704_10060365 3300025938 Bacteria 2346
283 Ga0207665_10750850 3300025939 Bacteria 769
284 Ga0207665_10893381 3300025939 Bacteria 704
285 Ga0207691_10121249 3300025940 Bacteria 2317
286 Ga0207711_10123813 3300025941 Bacteria 2311
287 Ga0207711_10198204 3300025941 Unclassified 1832
288 Ga0207689_10033711 3300025942 Bacteria 4254
289 Ga0207689_10110058 3300025942 Bacteria 2264
290 Ga0207689_10228921 3300025942 Bacteria 1536
291 Ga0207661_10000421 3300025944 Bacteria 27342
292 Ga0207679_10093822 3300025945 Bacteria 2329
293 Ga0207667_10122488 3300025949 Bacteria 2679
294 Ga0207712_10342202 3300025961 Bacteria 1241
295 Ga0207668_10014219 3300025972 Bacteria 4922
296 Ga0207668_10029839 3300025972 Bacteria 3578
297 Ga0207640_10168752 3300025981 Bacteria 1628
298 Ga0207658_11083421 3300025986 Bacteria 732
299 Ga0207677_10005364 3300026023 Bacteria 6955
300 Ga0207677_10029024 3300026023 Bacteria 3509
301 Ga0207677_10424327 3300026023 Bacteria 1133
302 Ga0207703_10102385 3300026035 Bacteria 2430
303 Ga0207703_10514738 3300026035 Bacteria 1125
304 Ga0207703_10954138 3300026035 Bacteria 822
305 Ga0207639_10043701 3300026041 Bacteria 3365
306 Ga0207639_11279496 3300026041 Bacteria 688
307 Ga0207678_10004216 3300026067 Bacteria 12904
308 Ga0207678_10391252 3300026067 Bacteria 1203
309 Ga0207702_10430122 3300026078 Bacteria 1278
310 Ga0207641_10217919 3300026088 Bacteria 1768
311 Ga0207641_10312449 3300026088 Bacteria 1488
312 Ga0207648_10079602 3300026089 Bacteria 2859
313 Ga0207648_10623618 3300026089 Bacteria 995
314 Ga0207676_10063927 3300026095 Bacteria 2924
315 Ga0207674_10272155 3300026116 Bacteria 1641
316 Ga0207675_100016441 3300026118 Bacteria 6910
317 Ga0207675_100084238 3300026118 Bacteria 2983
318 Ga0207675_100093425 3300026118 Bacteria 2829
319 Ga0207675_100723707 3300026118 Bacteria 1005
320 Ga0207683_10094349 3300026121 Bacteria 2667
321 Ga0207683_10147863 3300026121 Bacteria 2120
322 Ga0207683_10441141 3300026121 Bacteria 1200
323 Ga0207698_10084396 3300026142 Bacteria 2575
324 Ga0209589_1000005 3300027357 Bacteria 530958
325 Ga0209489_100005 3300027361 Bacteria 530958
326 Ga0209700_100006 3300027363 Bacteria 530958
327 Ga0209179_1015735 3300027512 Bacteria 1409
328 Ga0207428_10069869 3300027907 Bacteria 2761
329 Ga0268266_10003686 3300028379 Bacteria 15118
330 Ga0268266_10041651 3300028379 Bacteria 3919
331 Ga0268266_10134632 3300028379 Bacteria 2212
332 Ga0268266_10251984 3300028379 Bacteria 1633
333 Ga0268266_10306408 3300028379 Bacteria 1483
334 Ga0268266_11241861 3300028379 Bacteria 720
335 Ga0268264_10270524 3300028381 Bacteria 1587
336 Ga0268264_10362714 3300028381 Bacteria 1383
337 Ga0265334_10034163 3300028573 Bacteria 2019
338 Ga0307517_10000098 3300028786 Bacteria 126044
339 Ga0307517_10092064 3300028786 Bacteria 2470
340 Ga0307515_10297043 3300028794 Bacteria 1304
341 Ga0265338_10615299 3300028800 Bacteria 756
342 Ga0265330_10013905 3300031235 Bacteria 3742
343 Ga0265330_10034391 3300031235 Bacteria 2264
344 Ga0265330_10077314 3300031235 Bacteria 1436
345 Ga0265332_10029923 3300031238 Bacteria 2379
346 Ga0265332_10051243 3300031238 Bacteria 1773
347 Ga0265325_10010704 3300031241 Bacteria 5297
348 Ga0265340_10016525 3300031247 Bacteria 3820
349 Ga0265340_10198359 3300031247 Bacteria 903
350 Ga0265339_10089306 3300031249 Bacteria 1617
351 Ga0307509_10072313 3300031507 Bacteria 3593
352 Ga0265313_10036233 3300031595 Bacteria 2478
353 Ga0307508_10014893 3300031616 Bacteria 7094
354 Ga0307508_10055386 3300031616 Bacteria 3513
355 Ga0307508_10371005 3300031616 Bacteria 1022
356 Ga0307508_10388890 3300031616 Bacteria 986
357 Ga0265314_10189592 3300031711 Bacteria 1225
358 Ga0307516_10192626 3300031730 Bacteria 1764
359 Ga0307516_10368398 3300031730 Bacteria 1100
360 Ga0307413_10041282 3300031824 Bacteria 2700
361 Ga0307406_10599850 3300031901 Bacteria 908
362 Ga0307416_100568582 3300032002 Bacteria 1209
363 Ga0307416_100757116 3300032002 Bacteria 1064
364 Ga0307411_10318262 3300032005 Bacteria 1255
365 Ga0307411_10356936 3300032005 Bacteria 1194
366 Ga0307415_100301540 3300032126 Bacteria 1327
367 Ga0307415_100635045 3300032126 Bacteria 955
368 Ga0307415_101339363 3300032126 Bacteria 679
369 Ga0307507_10297508 3300033179 Bacteria 993
370 Ga0307510_10035509 3300033180 Bacteria 5566
371 Ga0307510_10039876 3300033180 Bacteria 5165
372 Ga0307510_10049365 3300033180 Bacteria 4476
373 Ga0315911_1000005 3300033442 Bacteria 426255
374 Ga0373926_0143687 3300035083 Bacteria 907
375 Ga0373934_0025910 3300035086 Bacteria 2273
376 Ga0373949_0105232 3300035090 Bacteria 777
377 Ga0373923_0034589 3300035111 Bacteria 2052
378 Ga0373936_0099684 3300035113 Bacteria 1225
379 Ga0373953_0039992 3300035117 Bacteria 1861
380 Ga0373954_0001160 3300035118 Bacteria 10599
381 Ga0373954_0046631 3300035118 Bacteria 2026
382 Ga0373957_0001004 3300035120 Bacteria 7420
383 Ga0373957_0120887 3300035120 Bacteria 1060
384 Ga0373946_0014259 3300035171 Bacteria 2996
385 Ga0373955_0036332 3300035172 Bacteria 2613
386 Ga0373961_0213666 3300035241 Bacteria 685
387 Ga0373931_0003428 3300035691 Bacteria 7118
388 Ga0373931_0446868 3300035691 Bacteria 826
389 Ga0373935_0000520 3300035692 Bacteria 20054
390 Ga0373935_0028130 3300035692 Bacteria 3474
391 Ga0373935_0083123 3300035692 Bacteria 2084
392 Ga0373927_0000046 3300035695 Bacteria 88401
393 Ga0373927_0016201 3300035695 Bacteria 4919
394 Ga0373927_0019031 3300035695 Bacteria 4504
395 Ga0373927_0042207 3300035695 Bacteria 2956
396 Ga0373933_0744456 3300035724 Bacteria 645
397 Ga0373947_0001392 3300035725 Bacteria 14902
398 Ga0373947_0016227 3300035725 Bacteria 4280
399 Ga0373947_0160194 3300035725 Bacteria 1455
400 Ga0373947_0229749 3300035725 Bacteria 1222
401 Ga0373947_0519751 3300035725 Bacteria 809
402 Ga0373937_0015298 3300036401 Bacteria 6784
403 Ga0373937_1296075 3300036401 Bacteria 676
404 Ga0373937_1501786 3300036401 Bacteria 621
405 Ga0373925_0003408 3300037068 Bacteria 12318
406 Ga0373925_0068872 3300037068 Bacteria 2672
407 Ga0373925_0956260 3300037068 Bacteria 706
408 Ga0395898_0339701 3300037466 Bacteria 1432
409 Ga0395905_0330562 3300037471 Bacteria 1414
410 Ga0436361_1092384 3300039447 Bacteria 1735
411 Ga0439465_0039674 3300041413 Bacteria 1521
412 Ga0451789_0699059 3300041443 Bacteria 704
413 Ga0451797_1590854 3300041453 Bacteria 1011
414 Ga0451798_0009136 3300041458 Bacteria 930
415 Ga0451800_1668225 3300041459 Bacteria 537
416 Ga0451841_1183591 3300041498 Bacteria 610
417 Ga0451853_0221928 3300041512 Bacteria 1652
418 Ga0495617_006574 3300046452 Bacteria 4070
419 Ga0495617_042834 3300046452 Bacteria 1512
420 Ga0495592_0073270 3300046454 Bacteria 2490
421 Ga0495592_0159719 3300046454 Bacteria 1552
422 Ga0495603_0000051 3300046455 Bacteria 50402
423 Ga0495603_0014396 3300046455 Bacteria 4785
424 Ga0495603_0088150 3300046455 Bacteria 1816
425 Ga0495603_0338403 3300046455 Bacteria 863
426 Ga0495629_0000182 3300046459 Bacteria 56655
427 Ga0495629_0000750 3300046459 Bacteria 26239
428 Ga0495638_0058840 3300046460 Bacteria 2380
429 Ga0495641_0006785 3300046461 Bacteria 7338
430 Ga0495651_0026747 3300046462 Bacteria 4492
431 Ga0495651_0245480 3300046462 Bacteria 1225
432 Ga0495653_0064475 3300046463 Bacteria 2760
433 Ga0495650_0065271 3300046471 Bacteria 1445
434 Ga0495650_0116516 3300046471 Bacteria 987
435 Ga0495580_0004021 3300046472 Bacteria 12411
436 Ga0495582_0000137 3300046473 Bacteria 39425
437 Ga0495582_0180459 3300046473 Bacteria 1203
438 Ga0495582_0195889 3300046473 Bacteria 1153
439 Ga0495605_0152020 3300046474 Bacteria 1032
440 Ga0495639_0000047 3300046475 Bacteria 53940
441 Ga0495639_0013823 3300046475 Bacteria 3490
442 Ga0495662_0001496 3300046476 Bacteria 11578
443 Ga0495664_0111795 3300046477 Bacteria 1649
444 Ga0495664_0156474 3300046477 Bacteria 1383
445 Ga0495584_0315799 3300046491 Bacteria 793
446 Ga0495584_0340659 3300046491 Bacteria 761
447 Ga0495585_0135990 3300046492 Bacteria 1290
448 Ga0495594_0001833 3300046499 Bacteria 11057
449 Ga0495596_0105170 3300046500 Bacteria 1096
450 Ga0495606_0453200 3300046507 Bacteria 657
451 Ga0495608_0008203 3300046511 Bacteria 7333
452 Ga0495610_0047560 3300046512 Bacteria 2110
453 Ga0495616_0135136 3300046513 Bacteria 1127
454 Ga0495618_0233565 3300046514 Bacteria 1157
455 Ga0495620_0077421 3300046515 Bacteria 1350
456 Ga0495628_0102698 3300046516 Bacteria 2205
457 Ga0495628_0232458 3300046516 Bacteria 1382
458 Ga0495630_0002625 3300046517 Bacteria 12446
459 Ga0495631_0024147 3300046518 Bacteria 2809
460 Ga0495631_0048226 3300046518 Bacteria 1868
461 Ga0495631_0054858 3300046518 Bacteria 1737
462 Ga0495632_0082828 3300046519 Bacteria 1528
463 Ga0495643_0060131 3300046522 Bacteria 2018
464 Ga0495644_0033809 3300046523 Bacteria 1931
465 Ga0495648_0018184 3300046524 Bacteria 4992
466 Ga0495652_0189551 3300046529 Bacteria 1570
467 Ga0495654_0067292 3300046530 Bacteria 1706
468 Ga0495665_0001239 3300046531 Bacteria 13612
469 Ga0495640_0004375 3300046533 Bacteria 11274
470 Ga0495640_0026585 3300046533 Bacteria 4179
471 Ga0495587_0087341 3300046536 Bacteria 1804
472 Ga0495622_0055750 3300046557 Bacteria 1833
473 Ga0495622_0100575 3300046557 Bacteria 1325
474 Ga0495667_0035317 3300046559 Bacteria 3341
475 Ga0495667_0147947 3300046559 Bacteria 1512
476 Ga0495656_0042566 3300046615 Bacteria 1902
477 Ga0495656_0059396 3300046615 Bacteria 1663
478 Ga0495656_0107171 3300046615 Bacteria 1301
479 Ga0495656_0176130 3300046615 Bacteria 1048
480 Ga0495668_0035388 3300046616 Bacteria 2800
481 Ga0495668_0209619 3300046616 Bacteria 1067
482 Ga0495634_0002221 3300046642 Bacteria 16276
483 Ga0495625_0218033 3300046660 Bacteria 1251
484 Ga0495635_0001455 3300046663 Bacteria 15846
485 Ga0495635_0002383 3300046663 Bacteria 12797
486 Ga0495659_0007624 3300046664 Bacteria 3430
487 Ga0495659_0022896 3300046664 Bacteria 2118
488 Ga0495659_0074696 3300046664 Bacteria 1276
489 Ga0495588_0037254 3300046674 Bacteria 2470
490 Ga0495588_0071970 3300046674 Bacteria 1798
491 Ga0495657_0004131 3300046675 Bacteria 11623
492 Ga0495623_0191104 3300046679 Bacteria 1183
493 Ga0495646_0073462 3300046680 Bacteria 2009
494 Ga0495647_0000577 3300046681 Bacteria 10837
495 Ga0495647_0019054 3300046681 Bacteria 2451
496 Ga0495658_0001786 3300046683 Bacteria 11096
497 Ga0495658_0709272 3300046683 Bacteria 644
498 Ga0495669_0007096 3300046684 Bacteria 4693
499 Ga0495669_0248839 3300046684 Bacteria 853
500 Ga0495613_0007297 3300046689 Bacteria 8233
501 Ga0495613_0123620 3300046689 Bacteria 1857
502 Ga0495624_0000898 3300046690 Bacteria 23624
503 Ga0495670_0076629 3300046691 Bacteria 1699
504 Ga0495670_0137520 3300046691 Bacteria 1276
505 Ga0495671_0012647 3300046692 Bacteria 4603
506 Ga0495649_0096349 3300046694 Bacteria 1574
507 Ga0495589_0231051 3300046794 Bacteria 867
508 Ga0495600_0069131 3300046809 Bacteria 2308
509 Ga0495600_0100686 3300046809 Bacteria 1883
510 Ga0495660_0192574 3300046810 Bacteria 979
511 Ga0495581_0001056 3300047315 Bacteria 14926
512 Ga0495581_0304119 3300047315 Bacteria 932
513 Ga0495604_0013331 3300047317 Bacteria 6545
514 Ga0495604_0165048 3300047317 Bacteria 1562
515 Ga0495674_0014874 3300047319 Bacteria 7279
516 Ga0495674_0018308 3300047319 Bacteria 6522
517 Ga0495674_0163861 3300047319 Bacteria 1859
518 Ga0495674_0405073 3300047319 Bacteria 1101
519 Ga0495672_0107741 3300047320 Bacteria 1500
520 Ga0495672_0418510 3300047320 Bacteria 610
521 Ga0495676_0024153 3300047321 Bacteria 5266
522 Ga0495676_0084428 3300047321 Bacteria 2396
523 Ga0495680_0029259 3300047322 Bacteria 4511
524 Ga0495683_0018396 3300047323 Bacteria 3614
525 Ga0495675_0036374 3300047444 Bacteria 3140
526 Ga0495685_028578 3300047447 Bacteria 1918
527 Ga0495685_071543 3300047447 Bacteria 1161
528 Ga0495673_0022493 3300047469 Bacteria 3088
529 Ga0495673_0103565 3300047469 Bacteria 1147
530 Ga0495673_0125117 3300047469 Bacteria 1014
531 Ga0495681_0138246 3300047470 Bacteria 1031
532 Ga0495684_0000643 3300047471 Bacteria 28074
533 Ga0495684_0031079 3300047471 Bacteria 4099
534 Ga0495686_0045773 3300047472 Bacteria 2768
535 Ga0495686_0047245 3300047472 Bacteria 2719
536 Ga0495686_0162921 3300047472 Bacteria 1302
537 Ga0495593_0006202 3300047673 Bacteria 7030
538 Ga0495593_0038227 3300047673 Bacteria 2592
539 Ga0495602_0125851 3300048088 Bacteria 2053
540 Ga0496100_0025314 3300048903 Bacteria 3629
541 Ga0496100_0124404 3300048903 Bacteria 1808
542 Ga0496100_0132230 3300048903 Bacteria 1759
543 Ga0496100_0324111 3300048903 Bacteria 1158
544 Ga0496100_0631992 3300048903 Bacteria 833
545 Ga0496100_0643955 3300048903 Bacteria 825
546 Ga0496101_0007768 3300048904 Bacteria 6971
547 Ga0496101_0051293 3300048904 Bacteria 2972
548 Ga0496101_0373333 3300048904 Bacteria 1122
549 Ga0496101_0700157 3300048904 Bacteria 800
550 Ga0496102_0079685 3300048905 Bacteria 3016
551 Ga0496102_0453172 3300048905 Bacteria 1203
552 Ga0496102_0677372 3300048905 Bacteria 954
553 Ga0496103_0061585 3300048906 Bacteria 2334
554 Ga0496103_0198103 3300048906 Bacteria 1291
555 Ga0496103_0451404 3300048906 Bacteria 825
556 Ga0496104_0043739 3300048907 Bacteria 4206
557 Ga0496104_0103613 3300048907 Bacteria 2726
558 Ga0496104_0186748 3300048907 Bacteria 1983
559 Ga0496104_0579360 3300048907 Bacteria 1033
560 Ga0496105_0142648 3300048908 Bacteria 1971
561 Ga0496105_0306466 3300048908 Bacteria 1276
562 Ga0496106_0058839 3300048909 Bacteria 2910
563 Ga0496106_0239930 3300048909 Bacteria 1448
564 Ga0496107_0006973 3300048910 Bacteria 7786
565 Ga0496107_0011332 3300048910 Bacteria 6205
566 Ga0496107_0017889 3300048910 Bacteria 4989
567 Ga0496107_0138216 3300048910 Bacteria 1800
568 Ga0496107_0539583 3300048910 Bacteria 864
569 Ga0496108_0000681 3300048911 Bacteria 26279
570 Ga0496108_0041142 3300048911 Bacteria 3856
571 Ga0496108_0463904 3300048911 Bacteria 1107
572 Ga0496108_0867100 3300048911 Bacteria 776
573 Ga0496109_0000450 3300048912 Bacteria 35265
574 Ga0496109_0048409 3300048912 Bacteria 3868
575 Ga0496109_0077635 3300048912 Bacteria 3056
576 Ga0496109_0191493 3300048912 Bacteria 1922
577 Ga0496109_0220984 3300048912 Bacteria 1781
578 Ga0496110_0009862 3300048913 Bacteria 7741
579 Ga0496110_0015912 3300048913 Bacteria 6273
580 Ga0496110_0333486 3300048913 Bacteria 1382
581 Ga0496110_0395896 3300048913 Bacteria 1259
582 Ga0496110_0745254 3300048913 Bacteria 882
583 Ga0496111_0026720 3300048914 Bacteria 4077
584 Ga0496111_0242116 3300048914 Bacteria 1339
585 Ga0496112_0005466 3300048915 Bacteria 10997
586 Ga0496112_0008308 3300048915 Bacteria 9290
587 Ga0496112_0012229 3300048915 Bacteria 7879
588 Ga0496112_0014817 3300048915 Bacteria 7250
589 Ga0496112_0172598 3300048915 Bacteria 2127
590 Ga0496112_0255044 3300048915 Bacteria 1704
591 Ga0496112_0284953 3300048915 Bacteria 1598
592 Ga0496112_0927999 3300048915 Bacteria 792
593 Ga0496113_0073832 3300048916 Bacteria 2599
594 Ga0496114_0050080 3300048917 Bacteria 3476
595 Ga0496114_0090980 3300048917 Bacteria 2591
596 Ga0496114_0178022 3300048917 Bacteria 1856
597 Ga0496114_0202739 3300048917 Bacteria 1738
598 Ga0496114_0667636 3300048917 Bacteria 913
599 Ga0496118_0220866 3300048921 Bacteria 1103
600 Ga0496120_0210997 3300048923 Bacteria 934
601 Ga0496121_0000265 3300048924 Bacteria 109251
602 Ga0496121_0013326 3300048924 Bacteria 8849
603 Ga0496121_0061837 3300048924 Bacteria 3070
604 Ga0496121_0079198 3300048924 Bacteria 2609
605 Ga0496121_0096216 3300048924 Bacteria 2299
606 Ga0496121_0118804 3300048924 Bacteria 2000
607 Ga0496121_0181752 3300048924 Bacteria 1517
608 Ga0496121_0241206 3300048924 Bacteria 1259
609 Ga0496124_0024122 3300048927 Bacteria 5536
610 Ga0496124_0069122 3300048927 Bacteria 2933
611 Ga0496124_0334913 3300048927 Bacteria 1077
612 Ga0496125_0140871 3300048928 Bacteria 1677
613 Ga0496125_0215986 3300048928 Bacteria 1240
614 Ga0496126_0022749 3300048929 Bacteria 6088
615 Ga0496126_0191437 3300048929 Bacteria 1732
616 Ga0496126_0222934 3300048929 Bacteria 1583
617 Ga0496126_0231114 3300048929 Bacteria 1549
618 Ga0496126_0487205 3300048929 Bacteria 987
619 Ga0495678_073113 3300049459 Bacteria 1251
620 Ga0501038_0515583 3300049574 Bacteria 913
621 Ga0501071_1097424 3300049587 Bacteria 615
622 Ga0501075_0721988 3300049591 Bacteria 759
623 Ga0501080_0919559 3300049742 Bacteria 762
624 nmdc:mga03683_120326_c1 3300050489 Bacteria 1167
625 nmdc:mga03683_133841_c1 3300050489 Bacteria 1111
626 nmdc:mga03n38_143989_c1 3300050490 Bacteria 1193
627 nmdc:mga03n38_256971_c1 3300050490 Bacteria 925
628 nmdc:mga03n38_300370_c1 3300050490 Bacteria 862
629 nmdc:mga03n38_64565_c1 3300050490 Bacteria 1676
630 nmdc:mga00v17_140936_c1 3300050491 Bacteria 1252
631 nmdc:mga00v17_449946_c1 3300050491 Bacteria 836
632 nmdc:mga0yw44_208504_c1 3300050492 Bacteria 1292
633 nmdc:mga0yw44_225423_c1 3300050492 Bacteria 1243
634 nmdc:mga0yw44_245166_c1 3300050492 Bacteria 1192
635 nmdc:mga0yw44_29499_c1 3300050492 Bacteria 3167
636 nmdc:mga0yw44_79166_c1 3300050492 Bacteria 2056
637 nmdc:mga0k408_418552_c1 3300050493 Bacteria 797
638 nmdc:mga0k408_551934_c1 3300050493 Bacteria 681
639 nmdc:mga0k408_565636_c1 3300050493 Bacteria 671
640 nmdc:mga0k408_74075_c1 3300050493 Bacteria 1989
641 nmdc:mga06z11_48368_c1 3300050494 Bacteria 2164
642 nmdc:mga06z11_71275_c1 3300050494 Bacteria 1839
643 nmdc:mga06z11_7602_c1 3300050494 Bacteria 4472
644 nmdc:mga04h51_1706_c1 3300050495 Bacteria 5131
645 nmdc:mga07m45_10402_c1 3300050496 Bacteria 4859
646 nmdc:mga07m45_221127_c1 3300050496 Bacteria 1102
647 nmdc:mga07m45_410778_c1 3300050496 Bacteria 785
648 nmdc:mga07m45_66757_c1 3300050496 Bacteria 2044
649 nmdc:mga05p37_23088_c1 3300050507 Bacteria 3718
650 nmdc:mga09592_407186_c1 3300050508 Bacteria 1175
651 nmdc:mga0n895_308147_c1 3300050512 Bacteria 1605
652 nmdc:mga0sz30_4840_c1 3300050516 Bacteria 1583
653 nmdc:mga0sz30_57481_c1 3300050516 Bacteria 1658
654 Ga0495601_0115445 3300053077 Bacteria 1741
655 Ga0500635_0091467 3300053080 Bacteria 1107
656 Ga0495655_0006618 3300053083 Bacteria 2116
657 Ga0495595_0020073 3300053084 Bacteria 2905
658 Ga0495595_0032987 3300053084 Bacteria 2334
659 Ga0495619_0000633 3300053085 Bacteria 23194
660 Ga0500643_047235 3300053087 Bacteria 1241
661 Ga0500647_0069944 3300053091 Bacteria 1688
662 Ga0500651_0490144 3300053093 Bacteria 679
663 Ga0500566_0000078 3300053094 Bacteria 47558
664 Ga0500640_003832 3300053095 Bacteria 5354
665 Ga0500641_0000385 3300053096 Bacteria 16362
666 Ga0500641_0010519 3300053096 Bacteria 3345
667 Ga0500641_0094963 3300053096 Bacteria 1275
668 Ga0500562_092907 3300053108 Bacteria 819
669 Ga0500572_000170 3300053111 Bacteria 22863
670 Ga0500595_002344 3300053119 Bacteria 9470
671 Ga0500595_028314 3300053119 Bacteria 1911
672 Ga0500608_020846 3300053122 Bacteria 3021
673 Ga0500614_001418 3300053123 Bacteria 5747
674 Ga0500658_0084712 3300053134 Bacteria 1362
675 Ga0500559_0004643 3300053136 Bacteria 6478
676 Ga0500568_0026049 3300053139 Bacteria 2458
677 Ga0500577_0173783 3300053142 Bacteria 922
678 Ga0500588_0061958 3300053146 Bacteria 1202
679 Ga0500589_048061 3300053147 Bacteria 1984
680 Ga0500589_143797 3300053147 Bacteria 979
681 Ga0500590_075556 3300053148 Bacteria 1666
682 Ga0500590_078782 3300053148 Bacteria 1623
683 Ga0500603_000081 3300053150 Bacteria 22182
684 Ga0500603_002203 3300053150 Bacteria 4302
685 Ga0500604_0033104 3300053151 Bacteria 1527
686 Ga0500630_013843 3300053159 Bacteria 3971
687 Ga0500633_0123831 3300053160 Bacteria 963
688 Ga0500634_0222339 3300053161 Bacteria 809
689 Ga0500638_065985 3300053162 Bacteria 1735
690 Ga0500639_000028 3300053163 Bacteria 77951
691 Ga0500636_0036573 3300053177 Bacteria 2906
692 Ga0500636_0066447 3300053177 Bacteria 2097
693 Ga0500636_0076437 3300053177 Bacteria 1936
694 Ga0500637_0077331 3300053178 Bacteria 1919
695 Ga0500637_0146451 3300053178 Bacteria 1365
696 Ga0500637_0221815 3300053178 Bacteria 1068
697 Ga0500645_011523 3300053730 Bacteria 2884
698 Ga0500609_046550 3300053731 Bacteria 601
699 Ga0500656_009233 3300053732 Bacteria 1058
700 Ga0500596_001371 3300053735 Bacteria 4913
701 Ga0500601_001477 3300053737 Bacteria 2571
702 Ga0500587_014712 3300053739 Bacteria 993
703 Ga0501084_0643984 3300054114 Bacteria 895
704 2513696114 2513237101 Bacteria 7952346
705 2513863608 2513237137 Bacteria 9558895
706 2517889849 2517572143 Bacteria 9484767
707 2644048377 2643221607 Bacteria 6314006
708 2644201738 2643221636 Bacteria 6583769
709 2644481179 2643221686 Bacteria 6310811
710 2723848852 2721755755 Bacteria 8322773
711 2793078847
712 2874606020 2874604998 Bacteria 7834745
713 2879116820 2879110137 Bacteria 8907982
714 2885379005 2885374607 Bacteria 8927485
715 2889034473 2889033259 Bacteria 9099371
716 2903748986 2903748898 Bacteria 9972761
717 2906636765 2906635258 Bacteria 8601019
718 2906663460 2906660503 Bacteria 8595048
719 2908757648 2908756301 Bacteria 8864324
720 2922366566 2922361189 Bacteria 7436256
721 2922389525 2922386360 Bacteria 7017218
722 8006992966 8006984368 Bacteria 9651211
723 8006996809 8006994254 Bacteria 8309700
724 8056692039 8056689827 Bacteria 6712655
725 Ga0307409_100014453
726 LJQas_1002452
727 JGI24744J21845_10007506
728 JGI25165J46597_1005047
729 JGI25153J46596_10009592
730 JGI25405J52794_10011407
731 Ga0065715_10258935
732 Ga0070676_10055728
733 Ga0070676_10110711
734 Ga0070683_100002138
735 Ga0070683_100917073
736 Ga0070690_100053814
737 Ga0070670_100346476
738 Ga0068869_100067827
739 Ga0068869_100310348
740 Ga0068869_100532733
741 Ga0068869_100742431
742 Ga0070666_10239538
743 Ga0070666_10389644
744 Ga0070682_100186034
745 Ga0068868_100006404
746 Ga0070660_100120229
747 Ga0070660_101002485
748 Ga0070689_100283582
749 Ga0070691_10130422
750 Ga0070687_100417911
751 Ga0070668_100013490
752 Ga0070668_100094754
753 Ga0070668_100292673
754 Ga0070668_100439493
755 Ga0070668_100452092
756 Ga0070669_100247074
757 Ga0070675_100271799
758 Ga0070675_100861299
759 Ga0070675_101006962
760 Ga0070671_100227859
761 Ga0070674_100128685
762 Ga0070674_100278454
763 Ga0070673_100830213
764 Ga0070673_101116533
765 Ga0070667_100284482
766 Ga0070667_100420403
767 Ga0070667_100867347
768 Ga0070714_101307545
769 Ga0070713_100046315
770 Ga0070713_100052950
771 Ga0070713_100724894
772 Ga0070710_10275305
773 Ga0070701_10039691
774 Ga0070701_10209488
775 Ga0070711_100327315
776 Ga0070705_100339779
777 Ga0070694_100298033
778 Ga0070663_100077431
779 Ga0070663_100152677
780 Ga0070663_100783217
781 Ga0070663_101018055
782 Ga0070678_100014685
783 Ga0070678_100102369
784 Ga0070678_100199222
785 Ga0068867_100021006
786 Ga0068867_100650888
787 Ga0068867_100970719
788 Ga0070685_10202337
789 Ga0070706_100686555
790 Ga0070706_100727817
791 Ga0070707_101203377
792 Ga0070699_100159280
793 Ga0070679_100071048
794 Ga0070684_100013257
795 Ga0070697_100020889
796 Ga0070697_101311514
797 Ga0068853_100105141
798 Ga0068853_100292871
799 Ga0070672_100099136
800 Ga0070672_100101389
801 Ga0070695_100388752
802 Ga0070696_100452200
803 Ga0070693_100080019
804 Ga0070665_100162979
805 Ga0070665_100410507
806 Ga0070665_100605647
807 Ga0070665_100608637
808 Ga0070665_100864126
809 Ga0070704_100330878
810 Ga0070704_101019031
811 Ga0068855_100569247
812 Ga0070664_100062716
813 Ga0070664_100072449
814 Ga0068857_100188408
815 Ga0068854_100267518
816 Ga0068854_100771757
817 Ga0070702_100161556
818 Ga0068852_100168020
819 Ga0068852_100223430
820 Ga0068852_100374504
821 Ga0068852_101185060
822 Ga0068859_100135274
823 Ga0068859_100588222
824 Ga0068864_100112223
825 Ga0068864_100272177
826 Ga0068864_100371685
827 Ga0068866_10040074
828 Ga0068866_10166374
829 Ga0068861_100021444
830 Ga0068861_100071608
831 Ga0068861_100336569
832 Ga0068861_100492481
833 Ga0068851_10030046
834 Ga0068870_10058566
835 Ga0068863_100000231
836 Ga0068863_100082905
837 Ga0068863_100294794
838 Ga0068863_100809363
839 Ga0068858_100077169
840 Ga0068858_100126335
841 Ga0068858_101098675
842 Ga0068858_101114455
843 Ga0068860_100414647
844 Ga0068860_100625342
845 Ga0068862_100320487
846 Ga0068862_100612697
847 Ga0081455_10002785
848 Ga0081455_10060822
849 Ga0081540_1010291
850 Ga0081540_1119220
851 Ga0081539_10089525
852 Ga0070717_10000460
853 Ga0070717_10700931
854 Ga0075365_10041120
855 Ga0075365_10245163
856 Ga0075368_10053271
857 Ga0075368_10110130
858 Ga0075368_10306727
859 Ga0075363_100055314
860 Ga0075363_100183054
861 Ga0075363_100184298
862 Ga0075364_10150124
863 Ga0070715_10073801
864 Ga0070715_10302837
865 Ga0070716_100526628
866 Ga0070712_100173829
867 Ga0070712_101100235
868 Ga0075362_10237307
869 Ga0075367_10056926
870 Ga0075367_10087751
871 Ga0075367_10305366
872 Ga0075369_10078875
873 Ga0075369_10122341
874 Ga0075369_10221965
875 Ga0075369_10352551
876 Ga0097621_100037847
877 Ga0075370_10013830
878 Ga0075370_10032745
879 Ga0075370_10043187
880 Ga0075370_10226527
881 Ga0068871_100060972
882 Ga0068871_100224504
883 Ga0068871_100295485
884 Ga0075428_100674399
885 Ga0075430_100518073
886 Ga0068865_100032124
887 Ga0068865_100042465
888 Ga0097620_100135278
889 Ga0097620_100588248
890 Ga0099825_1032168
891 Ga0099824_1016972
892 Ga0099822_1004807
893 Ga0099794_10268996
894 Ga0099794_10368014
895 Ga0099795_10005225
896 Ga0099795_10023844
897 Ga0099795_10038257
898 Ga0099795_10236544
899 Ga0105240_10225510
900 Ga0105240_10918433
901 Ga0111539_10291752
902 Ga0111539_11050371
903 Ga0105245_10010180
904 Ga0105247_10368595
905 Ga0105247_10421862
906 Ga0114129_10437458
907 Ga0114129_11012443
908 Ga0105243_10063654
909 Ga0105243_10352191
910 Ga0105241_10057387
911 Ga0105241_10134091
912 Ga0105241_10259975
913 Ga0105242_10309316
914 Ga0105248_10026042
915 Ga0105248_10203617
916 Ga0105248_10315071
917 Ga0105237_10067810
918 Ga0105237_10163591
919 Ga0105237_10822113
920 Ga0105238_10227690
921 Ga0105249_10089683
922 Ga0105249_10150105
923 Ga0105249_10374042
924 Ga0105239_10049562
925 Ga0105239_10176034
926 Ga0105239_10203875
927 Ga0105239_10474294
928 Ga0105246_10039944
929 Ga0105246_10580859
930 Ga0105246_10743078
931 Ga0157374_10028177
932 Ga0157374_10105817
933 Ga0157374_10411172
934 Ga0157378_10043705
935 Ga0157378_10536860
936 Ga0157378_10667062
937 Ga0157378_11882279
938 Ga0163162_10111100
939 Ga0163162_10611103
940 Ga0163162_10824571
941 Ga0163162_11202541
942 Ga0157375_10037030
943 Ga0157375_10115292
944 Ga0157375_11180137
945 Ga0163163_10089828
946 Ga0163163_10253936
947 Ga0163163_11251919
948 Ga0157380_10040768
949 Ga0157379_10127631
950 Ga0157379_10205992
951 Ga0157379_10226320
952 Ga0157379_10329562
953 Ga0157376_10188163
954 Ga0157376_11011021
955 Ga0182006_1171005
956 Ga0163161_10092455
957 Ga0163161_10118281
958 Ga0163161_10179568
959 Ga0163161_10531738
960 Ga0209233_1014256
961 Ga0209758_1007538
962 Ga0209758_1010903
963 Ga0209758_1082752
964 Ga0207697_10059688
965 Ga0207696_1111840
966 Ga0207642_10134961
967 Ga0207710_10110153
968 Ga0207688_10700599
969 Ga0207680_10324850
970 Ga0207647_10138774
971 Ga0207685_10201962
972 Ga0207645_10117629
973 Ga0207643_10059936
974 Ga0207705_10959493
975 Ga0207684_10149544
976 Ga0207654_10027726
977 Ga0207654_10484170
978 Ga0207707_10219551
979 Ga0207695_10264236
980 Ga0207671_10201946
981 Ga0207671_10462307
982 Ga0207693_10593820
983 Ga0207663_10122838
984 Ga0207649_10566446
985 Ga0207652_10122765
986 Ga0207646_10159697
987 Ga0207694_10544783
988 Ga0207694_10735331
989 Ga0207650_10327132
990 Ga0207700_10008658
991 Ga0207700_10103231
992 Ga0207700_10592622
993 Ga0207664_10154737
994 Ga0207664_11393024
995 Ga0207644_10104878
996 Ga0207706_10302874
997 Ga0207686_10120804
998 Ga0207686_10365272
999 Ga0207709_10168798
1000 Ga0207709_10221557
1001 Ga0207709_10428352
1002 Ga0207669_10059712
1003 Ga0207669_10094129
1004 Ga0207669_10137542
1005 Ga0207669_10714572
1006 Ga0207704_10060365
1007 Ga0207665_10750850
1008 Ga0207665_10893381
1009 Ga0207691_10121249
1010 Ga0207711_10123813
1011 Ga0207711_10198204
1012 Ga0207689_10033711
1013 Ga0207689_10110058
1014 Ga0207689_10228921
1015 Ga0207661_10000421
1016 Ga0207679_10093822
1017 Ga0207667_10122488
1018 Ga0207712_10342202
1019 Ga0207668_10014219
1020 Ga0207668_10029839
1021 Ga0207640_10168752
1022 Ga0207658_11083421
1023 Ga0207677_10005364
1024 Ga0207677_10029024
1025 Ga0207677_10424327
1026 Ga0207703_10102385
1027 Ga0207703_10514738
1028 Ga0207703_10954138
1029 Ga0207639_10043701
1030 Ga0207639_11279496
1031 Ga0207678_10004216
1032 Ga0207678_10391252
1033 Ga0207702_10430122
1034 Ga0207641_10217919
1035 Ga0207641_10312449
1036 Ga0207648_10079602
1037 Ga0207648_10623618
1038 Ga0207676_10063927
1039 Ga0207674_10272155
1040 Ga0207675_100016441
1041 Ga0207675_100084238
1042 Ga0207675_100093425
1043 Ga0207675_100723707
1044 Ga0207683_10094349
1045 Ga0207683_10147863
1046 Ga0207683_10441141
1047 Ga0207698_10084396
1048 Ga0209589_1000005
1049 Ga0209489_100005
1050 Ga0209700_100006
1051 Ga0209179_1015735
1052 Ga0207428_10069869
1053 Ga0268266_10003686
1054 Ga0268266_10041651
1055 Ga0268266_10134632
1056 Ga0268266_10251984
1057 Ga0268266_10306408
1058 Ga0268266_11241861
1059 Ga0268264_10270524
1060 Ga0268264_10362714
1061 Ga0265334_10034163
1062 Ga0307517_10000098
1063 Ga0307517_10092064
1064 Ga0307515_10297043
1065 Ga0265338_10615299
1066 Ga0265330_10013905
1067 Ga0265330_10034391
1068 Ga0265330_10077314
1069 Ga0265332_10029923
1070 Ga0265332_10051243
1071 Ga0265325_10010704
1072 Ga0265340_10016525
1073 Ga0265340_10198359
1074 Ga0265339_10089306
1075 Ga0307509_10072313
1076 Ga0265313_10036233
1077 Ga0307508_10014893
1078 Ga0307508_10055386
1079 Ga0307508_10371005
1080 Ga0307508_10388890
1081 Ga0265314_10189592
1082 Ga0307516_10192626
1083 Ga0307516_10368398
1084 Ga0307413_10041282
1085 Ga0307406_10599850
1086 Ga0307416_100568582
1087 Ga0307416_100757116
1088 Ga0307411_10318262
1089 Ga0307411_10356936
1090 Ga0307415_100301540
1091 Ga0307415_100635045
1092 Ga0307415_101339363
1093 Ga0307507_10297508
1094 Ga0307510_10035509
1095 Ga0307510_10039876
1096 Ga0307510_10049365
1097 Ga0315911_1000005
1098 Ga0373926_0143687
1099 Ga0373934_0025910
1100 Ga0373949_0105232
1101 Ga0373923_0034589
1102 Ga0373936_0099684
1103 Ga0373953_0039992
1104 Ga0373954_0001160
1105 Ga0373954_0046631
1106 Ga0373957_0001004
1107 Ga0373957_0120887
1108 Ga0373946_0014259
1109 Ga0373955_0036332
1110 Ga0373961_0213666
1111 Ga0373931_0003428
1112 Ga0373931_0446868
1113 Ga0373935_0000520
1114 Ga0373935_0028130
1115 Ga0373935_0083123
1116 Ga0373927_0000046
1117 Ga0373927_0016201
1118 Ga0373927_0019031
1119 Ga0373927_0042207
1120 Ga0373933_0744456
1121 Ga0373947_0001392
1122 Ga0373947_0016227
1123 Ga0373947_0160194
1124 Ga0373947_0229749
1125 Ga0373947_0519751
1126 Ga0373937_0015298
1127 Ga0373937_1296075
1128 Ga0373937_1501786
1129 Ga0373925_0003408
1130 Ga0373925_0068872
1131 Ga0373925_0956260
1132 Ga0395898_0339701
1133 Ga0395905_0330562
1134 Ga0436361_1092384
1135 Ga0439465_0039674
1136 Ga0451789_0699059
1137 Ga0451797_1590854
1138 Ga0451798_0009136
1139 Ga0451800_1668225
1140 Ga0451841_1183591
1141 Ga0451853_0221928
1142 Ga0495617_006574
1143 Ga0495617_042834
1144 Ga0495592_0073270
1145 Ga0495592_0159719
1146 Ga0495603_0000051
1147 Ga0495603_0014396
1148 Ga0495603_0088150
1149 Ga0495603_0338403
1150 Ga0495629_0000182
1151 Ga0495629_0000750
1152 Ga0495638_0058840
1153 Ga0495641_0006785
1154 Ga0495651_0026747
1155 Ga0495651_0245480
1156 Ga0495653_0064475
1157 Ga0495650_0065271
1158 Ga0495650_0116516
1159 Ga0495580_0004021
1160 Ga0495582_0000137
1161 Ga0495582_0180459
1162 Ga0495582_0195889
1163 Ga0495605_0152020
1164 Ga0495639_0000047
1165 Ga0495639_0013823
1166 Ga0495662_0001496
1167 Ga0495664_0111795
1168 Ga0495664_0156474
1169 Ga0495584_0315799
1170 Ga0495584_0340659
1171 Ga0495585_0135990
1172 Ga0495594_0001833
1173 Ga0495596_0105170
1174 Ga0495606_0453200
1175 Ga0495608_0008203
1176 Ga0495610_0047560
1177 Ga0495616_0135136
1178 Ga0495618_0233565
1179 Ga0495620_0077421
1180 Ga0495628_0102698
1181 Ga0495628_0232458
1182 Ga0495630_0002625
1183 Ga0495631_0024147
1184 Ga0495631_0048226
1185 Ga0495631_0054858
1186 Ga0495632_0082828
1187 Ga0495643_0060131
1188 Ga0495644_0033809
1189 Ga0495648_0018184
1190 Ga0495652_0189551
1191 Ga0495654_0067292
1192 Ga0495665_0001239
1193 Ga0495640_0004375
1194 Ga0495640_0026585
1195 Ga0495587_0087341
1196 Ga0495622_0055750
1197 Ga0495622_0100575
1198 Ga0495667_0035317
1199 Ga0495667_0147947
1200 Ga0495656_0042566
1201 Ga0495656_0059396
1202 Ga0495656_0107171
1203 Ga0495656_0176130
1204 Ga0495668_0035388
1205 Ga0495668_0209619
1206 Ga0495634_0002221
1207 Ga0495625_0218033
1208 Ga0495635_0001455
1209 Ga0495635_0002383
1210 Ga0495659_0007624
1211 Ga0495659_0022896
1212 Ga0495659_0074696
1213 Ga0495588_0037254
1214 Ga0495588_0071970
1215 Ga0495657_0004131
1216 Ga0495623_0191104
1217 Ga0495646_0073462
1218 Ga0495647_0000577
1219 Ga0495647_0019054
1220 Ga0495658_0001786
1221 Ga0495658_0709272
1222 Ga0495669_0007096
1223 Ga0495669_0248839
1224 Ga0495613_0007297
1225 Ga0495613_0123620
1226 Ga0495624_0000898
1227 Ga0495670_0076629
1228 Ga0495670_0137520
1229 Ga0495671_0012647
1230 Ga0495649_0096349
1231 Ga0495589_0231051
1232 Ga0495600_0069131
1233 Ga0495600_0100686
1234 Ga0495660_0192574
1235 Ga0495581_0001056
1236 Ga0495581_0304119
1237 Ga0495604_0013331
1238 Ga0495604_0165048
1239 Ga0495674_0014874
1240 Ga0495674_0018308
1241 Ga0495674_0163861
1242 Ga0495674_0405073
1243 Ga0495672_0107741
1244 Ga0495672_0418510
1245 Ga0495676_0024153
1246 Ga0495676_0084428
1247 Ga0495680_0029259
1248 Ga0495683_0018396
1249 Ga0495675_0036374
1250 Ga0495685_028578
1251 Ga0495685_071543
1252 Ga0495673_0022493
1253 Ga0495673_0103565
1254 Ga0495673_0125117
1255 Ga0495681_0138246
1256 Ga0495684_0000643
1257 Ga0495684_0031079
1258 Ga0495686_0045773
1259 Ga0495686_0047245
1260 Ga0495686_0162921
1261 Ga0495593_0006202
1262 Ga0495593_0038227
1263 Ga0495602_0125851
1264 Ga0496100_0025314
1265 Ga0496100_0124404
1266 Ga0496100_0132230
1267 Ga0496100_0324111
1268 Ga0496100_0631992
1269 Ga0496100_0643955
1270 Ga0496101_0007768
1271 Ga0496101_0051293
1272 Ga0496101_0373333
1273 Ga0496101_0700157
1274 Ga0496102_0079685
1275 Ga0496102_0453172
1276 Ga0496102_0677372
1277 Ga0496103_0061585
1278 Ga0496103_0198103
1279 Ga0496103_0451404
1280 Ga0496104_0043739
1281 Ga0496104_0103613
1282 Ga0496104_0186748
1283 Ga0496104_0579360
1284 Ga0496105_0142648
1285 Ga0496105_0306466
1286 Ga0496106_0058839
1287 Ga0496106_0239930
1288 Ga0496107_0006973
1289 Ga0496107_0011332
1290 Ga0496107_0017889
1291 Ga0496107_0138216
1292 Ga0496107_0539583
1293 Ga0496108_0000681
1294 Ga0496108_0041142
1295 Ga0496108_0463904
1296 Ga0496108_0867100
1297 Ga0496109_0000450
1298 Ga0496109_0048409
1299 Ga0496109_0077635
1300 Ga0496109_0191493
1301 Ga0496109_0220984
1302 Ga0496110_0009862
1303 Ga0496110_0015912
1304 Ga0496110_0333486
1305 Ga0496110_0395896
1306 Ga0496110_0745254
1307 Ga0496111_0026720
1308 Ga0496111_0242116
1309 Ga0496112_0005466
1310 Ga0496112_0008308
1311 Ga0496112_0012229
1312 Ga0496112_0014817
1313 Ga0496112_0172598
1314 Ga0496112_0255044
1315 Ga0496112_0284953
1316 Ga0496112_0927999
1317 Ga0496113_0073832
1318 Ga0496114_0050080
1319 Ga0496114_0090980
1320 Ga0496114_0178022
1321 Ga0496114_0202739
1322 Ga0496114_0667636
1323 Ga0496118_0220866
1324 Ga0496120_0210997
1325 Ga0496121_0000265
1326 Ga0496121_0013326
1327 Ga0496121_0061837
1328 Ga0496121_0079198
1329 Ga0496121_0096216
1330 Ga0496121_0118804
1331 Ga0496121_0181752
1332 Ga0496121_0241206
1333 Ga0496124_0024122
1334 Ga0496124_0069122
1335 Ga0496124_0334913
1336 Ga0496125_0140871
1337 Ga0496125_0215986
1338 Ga0496126_0022749
1339 Ga0496126_0191437
1340 Ga0496126_0222934
1341 Ga0496126_0231114
1342 Ga0496126_0487205
1343 Ga0495678_073113
1344 Ga0501038_0515583
1345 Ga0501071_1097424
1346 Ga0501075_0721988
1347 Ga0501080_0919559
1348 nmdc:mga03683_120326_c1
1349 nmdc:mga03683_133841_c1
1350 nmdc:mga03n38_143989_c1
1351 nmdc:mga03n38_256971_c1
1352 nmdc:mga03n38_300370_c1
1353 nmdc:mga03n38_64565_c1
1354 nmdc:mga00v17_140936_c1
1355 nmdc:mga00v17_449946_c1
1356 nmdc:mga0yw44_208504_c1
1357 nmdc:mga0yw44_225423_c1
1358 nmdc:mga0yw44_245166_c1
1359 nmdc:mga0yw44_29499_c1
1360 nmdc:mga0yw44_79166_c1
1361 nmdc:mga0k408_418552_c1
1362 nmdc:mga0k408_551934_c1
1363 nmdc:mga0k408_565636_c1
1364 nmdc:mga0k408_74075_c1
1365 nmdc:mga06z11_48368_c1
1366 nmdc:mga06z11_71275_c1
1367 nmdc:mga06z11_7602_c1
1368 nmdc:mga04h51_1706_c1
1369 nmdc:mga07m45_10402_c1
1370 nmdc:mga07m45_221127_c1
1371 nmdc:mga07m45_410778_c1
1372 nmdc:mga07m45_66757_c1
1373 nmdc:mga05p37_23088_c1
1374 nmdc:mga09592_407186_c1
1375 nmdc:mga0n895_308147_c1
1376 nmdc:mga0sz30_4840_c1
1377 nmdc:mga0sz30_57481_c1
1378 Ga0495601_0115445
1379 Ga0500635_0091467
1380 Ga0495655_0006618
1381 Ga0495595_0020073
1382 Ga0495595_0032987
1383 Ga0495619_0000633
1384 Ga0500643_047235
1385 Ga0500647_0069944
1386 Ga0500651_0490144
1387 Ga0500566_0000078
1388 Ga0500640_003832
1389 Ga0500641_0000385
1390 Ga0500641_0010519
1391 Ga0500641_0094963
1392 Ga0500562_092907
1393 Ga0500572_000170
1394 Ga0500595_002344
1395 Ga0500595_028314
1396 Ga0500608_020846
1397 Ga0500614_001418
1398 Ga0500658_0084712
1399 Ga0500559_0004643
1400 Ga0500568_0026049
1401 Ga0500577_0173783
1402 Ga0500588_0061958
1403 Ga0500589_048061
1404 Ga0500589_143797
1405 Ga0500590_075556
1406 Ga0500590_078782
1407 Ga0500603_000081
1408 Ga0500603_002203
1409 Ga0500604_0033104
1410 Ga0500630_013843
1411 Ga0500633_0123831
1412 Ga0500634_0222339
1413 Ga0500638_065985
1414 Ga0500639_000028
1415 Ga0500636_0036573
1416 Ga0500636_0066447
1417 Ga0500636_0076437
1418 Ga0500637_0077331
1419 Ga0500637_0146451
1420 Ga0500637_0221815
1421 Ga0500645_011523
1422 Ga0500609_046550
1423 Ga0500656_009233
1424 Ga0500596_001371
1425 Ga0500601_001477
1426 Ga0500587_014712
1427 Ga0501084_0643984
1428 2513696114
1429 2513863608
1430 2517889849
1431 2644048377
1432 2644201738
1433 2644481179
1434 2723848852
1435 2793078847
1436 2874606020
1437 2879116820
1438 2885379005
1439 2889034473
1440 2903748986
1441 2906636765
1442 2906663460
1443 2908757648
1444 2922366566
1445 2922389525
1446 8006992966
1447 8006996809
1448 8056692039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

42

190

0.77

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

52

163

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8211 14 159
4jda-assembly1.cif.gz_B complex structure of abscisic acid receptor pyl3 with (-)-aba 0.8176 10 161
4jda-assembly2.cif.gz_C complex structure of abscisic acid receptor pyl3 with (-)-aba 0.8089 10 159
3neg-assembly1.cif.gz_A pyrabactin-bound pyl1 structure in the open and close forms 0.7913 10 160
3rt0-assembly2.cif.gz_D crystal structure of pyl10-hab1 complex in the absence of abscisic acid (aba) 0.7867 12 160
ID Description Score Start End Superfamily
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8065 11 161 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7989 16 161 3.30.530.20
af_Q10MS2_34_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7961 11 160 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7923 13 158 3.30.530.20
af_I1LX70_3_186_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7914 11 160 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y1US70-F1-model_v4 SRPBCC family protein 0.9811 13 107
AF-A0A7Y3B323-F1-model_v4 SRPBCC family protein 0.979 13 121
AF-A0A2S5LPU4-F1-model_v4 Polyketide cyclase 0.9739 10 105
AF-A0A518DS28-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9678 8 160
AF-A0A3L7S6I9-F1-model_v4 Polyketide cyclase 0.9627 9 161 GO:0016020

Map