F477541

General Info

Members Datasets Scaffolds Average Seq Length
724 506 1448 297

Family's Representative Sequence

Representative Sequence 3300003215|JGI25153J46596_10009092|JGI25153J46596_100090922
Length 312
Sequence MSLVATLICNPDNPALDTTIVDGARTVLPQALPAHWLFDGVAVDIPFGADSNLEGDRHAIEQRLRELRGDLPIDIVVQPVGFRRKKLFLADMDSTMIGQECIDELADFAGLKAHVAAITERAMRGEIEFEPALRERVALLKDLPASATMRAHGAYTCLVSGGFTLFTTAVAARIGFQENRANXLVVRDGKFTGEVKXPILGRAAKXATLVDLMESFDLDDIDSVVVGDGANDLAMIQAAGLGVAXHAKPAVAAAAAARIDHGDLTALLYAQGYRRDEFVEXXLIRRSGVVRSTRPGTSRFRVRCFASPRNDG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
65 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
66 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
69 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
115 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
116 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
117 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
118 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
129 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
187 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
214 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
215 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
262 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
267 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
268 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
269 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
274 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
281 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
282 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
283 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
284 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
285 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
286 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
287 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
288 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
289 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
290 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
298 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
299 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
300 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
301 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
306 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
308 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
309 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
310 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
311 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
312 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
313 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
314 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
315 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
316 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
317 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
318 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
319 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
320 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
321 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
322 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
323 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
324 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
325 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
326 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
327 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
328 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
329 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
330 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
331 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
332 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
333 2643221651 Afipia sp. Root123D2 Isolate Unclassified
334 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
335 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
336 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
337 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
338 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
339 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
340 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
341 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
342 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
343 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
344 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
345 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
346 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
347 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
348 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
349 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
350 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
351 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
352 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
353 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
354 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
355 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
356 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
357 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
358 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
359 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
360 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
361 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
362 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
363 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
364 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
365 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
366 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
367 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
368 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
369 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
370 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
371 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
372 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
373 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
374 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
375 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
376 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
377 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
378 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
379 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
380 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
381 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
382 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
383 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
384 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
385 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
386 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
387 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
388 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
389 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
390 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
391 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
392 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
393 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
394 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
395 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
396 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
397 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
398 2906610324
399 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
400 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
401 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
402 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
403 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
404 2922368715
405 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
406 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
407 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
408 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
409 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
410 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
411 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
412 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
413 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
414 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
415 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
416 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
417 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
418 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
419 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
420 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
421 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
422 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
423 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
424 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
425 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
426 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
427 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
428 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
429 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
430 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
431 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
432 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
433 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
434 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
435 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
436 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
437 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
438 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
439 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
440 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
441 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
442 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
443 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
444 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
445 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
446 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
447 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
448 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
449 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
450 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
451 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
452 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
453 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
454 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
455 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
456 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
457 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
458 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
459 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
460 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
461 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
462 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
463 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
464 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
465 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
466 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
467 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
468 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
469 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
470 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
471 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
472 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
473 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
474 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
475 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
476 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
477 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
478 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
479 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
480 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
481 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
482 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
483 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
484 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
485 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
486 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
487 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
488 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
489 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
490 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
491 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
492 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
493 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
494 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
495 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
496 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
497 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
498 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
499 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
500 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
501 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
502 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
503 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
504 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
505 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
506 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.13
Metatranscriptomes 0.14
Isolates 26.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.54
Nodule 21.69
Rhizoplane 4.42
Rhizosphere 40.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10009092 3300003215 Bacteria 4665
2 JGI25165J46597_1004656 3300003214 Bacteria 2869
3 JGI25153J46596_10004824 3300003215 Bacteria 7183
4 JGI25153J46596_10027971 3300003215 Bacteria 1964
5 JGI25153J46596_10028501 3300003215 Bacteria 1934
6 JGI25160J50197_1009693 3300003354 Bacteria 3547
7 JGI25404J52841_10001584 3300003659 Bacteria 4055
8 Ga0055539_1003188 3300003752 Bacteria 2334
9 Ga0055526_1028525 3300003771 Bacteria 1686
10 Ga0055526_1029585 3300003771 Bacteria 1622
11 Ga0055531_10003265 3300003794 Bacteria 10406
12 Ga0055543_1003054 3300004625 Bacteria 5152
13 Ga0055543_1016904 3300004625 Bacteria 1380
14 Ga0065165_1002837 3300005262 Bacteria 13516
15 Ga0065165_1005269 3300005262 Bacteria 7376
16 Ga0065165_1007564 3300005262 Bacteria 5300
17 Ga0070658_10019082 3300005327 Bacteria 5493
18 Ga0070658_10045152 3300005327 Bacteria 3562
19 Ga0070683_100125277 3300005329 Bacteria 2429
20 Ga0068868_100017680 3300005338 Bacteria 5316
21 Ga0070661_100065700 3300005344 Bacteria 2665
22 Ga0070668_100077330 3300005347 Bacteria 2601
23 Ga0070668_100123936 3300005347 Bacteria 2068
24 Ga0070669_100270897 3300005353 Bacteria 1357
25 Ga0070671_100052057 3300005355 Bacteria 3405
26 Ga0070667_100053721 3300005367 Bacteria 3400
27 Ga0070667_100135306 3300005367 Bacteria 2155
28 Ga0070709_10001764 3300005434 Bacteria 11754
29 Ga0070709_10028569 3300005434 Bacteria 3328
30 Ga0070714_100010698 3300005435 Bacteria 7261
31 Ga0070714_100185760 3300005435 Bacteria 1894
32 Ga0070710_10001695 3300005437 Bacteria 10382
33 Ga0070710_10021064 3300005437 Bacteria 3393
34 Ga0070711_100002420 3300005439 Bacteria 10634
35 Ga0070711_100137513 3300005439 Bacteria 1828
36 Ga0070663_100050838 3300005455 Bacteria 2950
37 Ga0070663_100056464 3300005455 Bacteria 2813
38 Ga0070663_100106968 3300005455 Bacteria 2096
39 Ga0070679_100069331 3300005530 Bacteria 3517
40 Ga0070684_100038257 3300005535 Bacteria 4119
41 Ga0070684_100559520 3300005535 Bacteria 1062
42 Ga0068853_100047394 3300005539 Bacteria 3687
43 Ga0070665_100256281 3300005548 Bacteria 1750
44 Ga0068855_100097468 3300005563 Bacteria 3387
45 Ga0068857_100019266 3300005577 Bacteria 5991
46 Ga0068854_100313128 3300005578 Bacteria 1273
47 Ga0068856_100002538 3300005614 Bacteria 18824
48 Ga0068864_100322688 3300005618 Bacteria 1451
49 Ga0068851_10161030 3300005834 Bacteria 1233
50 Ga0068862_100493908 3300005844 Bacteria 1160
51 Ga0081455_10003699 3300005937 Bacteria 17509
52 Ga0081540_1003091 3300005983 Bacteria 13334
53 Ga0081540_1010356 3300005983 Bacteria 6324
54 Ga0081539_10001829 3300005985 Bacteria 33573
55 Ga0070717_10029907 3300006028 Bacteria 4375
56 Ga0075365_10088253 3300006038 Bacteria 2110
57 Ga0075365_10119922 3300006038 Bacteria 1814
58 Ga0075368_10034252 3300006042 Bacteria 1978
59 Ga0075368_10056296 3300006042 Bacteria 1569
60 Ga0075363_100045805 3300006048 Bacteria 2320
61 Ga0075364_10062781 3300006051 Bacteria 2438
62 Ga0070712_100007513 3300006175 Bacteria 6810
63 Ga0075367_10098451 3300006178 Bacteria 1785
64 Ga0075367_10152756 3300006178 Bacteria 1433
65 Ga0075369_10010725 3300006186 Bacteria 3590
66 Ga0075369_10059516 3300006186 Bacteria 1664
67 Ga0075366_10034561 3300006195 Bacteria 2977
68 Ga0075366_10197329 3300006195 Bacteria 1223
69 Ga0075370_10069024 3300006353 Bacteria 2019
70 Ga0075370_10251434 3300006353 Bacteria 1048
71 Ga0068871_100080011 3300006358 Bacteria 2705
72 Ga0099825_1020431 3300006941 Bacteria 4708
73 Ga0099824_1025695 3300006942 Bacteria 3173
74 Ga0099823_1063709 3300006944 Bacteria 1833
75 Ga0099794_10046066 3300007265 Bacteria 2088
76 Ga0105240_10014565 3300009093 Bacteria 10730
77 Ga0105240_10076395 3300009093 Bacteria 4129
78 Ga0105245_10074811 3300009098 Bacteria 3083
79 Ga0105247_10099619 3300009101 Bacteria 1856
80 Ga0105247_10105343 3300009101 Bacteria 1808
81 Ga0105248_10366124 3300009177 Bacteria 1623
82 Ga0105237_10004158 3300009545 Bacteria 16863
83 Ga0105237_10005728 3300009545 Bacteria 13958
84 Ga0105237_10030097 3300009545 Bacteria 5516
85 Ga0105237_10127376 3300009545 Bacteria 2540
86 Ga0105239_10018834 3300010375 Bacteria 7627
87 Ga0105239_10097833 3300010375 Bacteria 3243
88 Ga0105239_10213909 3300010375 Bacteria 2161
89 Ga0105239_10635401 3300010375 Bacteria 1219
90 Ga0157370_10099074 3300013104 Bacteria 2732
91 Ga0157369_10005591 3300013105 Bacteria 14600
92 Ga0157372_10055869 3300013307 Bacteria 4410
93 Ga0157379_10275067 3300014968 Bacteria 1532
94 Ga0157379_10289882 3300014968 Bacteria 1490
95 Ga0157376_10175757 3300014969 Bacteria 1953
96 Ga0157376_10495090 3300014969 Bacteria 1200
97 Ga0206353_10981988 3300020082 Bacteria 2126
98 Ga0214544_1000026 3300021320 Bacteria 161530
99 Ga0214542_1000025 3300021321 Bacteria 183588
100 Ga0214542_1030681 3300021321 Bacteria 2069
101 Ga0214545_1000014 3300021324 Bacteria 183588
102 Ga0214545_1025563 3300021324 Bacteria 3384
103 Ga0214543_1000034 3300021327 Bacteria 183712
104 Ga0213873_10010925 3300021358 Bacteria 1928
105 Ga0213874_10006183 3300021377 Bacteria 2825
106 Ga0213876_10003720 3300021384 Bacteria 8646
107 Ga0213876_10069659 3300021384 Bacteria 1858
108 Ga0213871_10016702 3300021441 Bacteria 1773
109 Ga0207425_1008458 3300025245 Bacteria 2630
110 Ga0209677_101109 3300025253 Bacteria 12646
111 Ga0209148_1000250 3300025254 Bacteria 85755
112 Ga0209233_1001802 3300025261 Bacteria 8254
113 Ga0209455_1002768 3300025272 Bacteria 6563
114 Ga0209455_1018947 3300025272 Bacteria 1401
115 Ga0209130_1027315 3300025284 Bacteria 1214
116 Ga0209564_1004750 3300025295 Bacteria 8125
117 Ga0209564_1009379 3300025295 Bacteria 4669
118 Ga0209564_1019544 3300025295 Bacteria 2525
119 Ga0209758_1000141 3300025297 Bacteria 172481
120 Ga0209758_1000324 3300025297 Bacteria 91475
121 Ga0209758_1000476 3300025297 Bacteria 66180
122 Ga0209758_1001389 3300025297 Bacteria 28787
123 Ga0209758_1003697 3300025297 Bacteria 13574
124 Ga0209758_1005554 3300025297 Bacteria 9612
125 Ga0209256_1017836 3300025299 Bacteria 2337
126 Ga0207426_1000523 3300025302 Bacteria 55736
127 Ga0207426_1003307 3300025302 Bacteria 8962
128 Ga0207426_1030127 3300025302 Bacteria 1782
129 Ga0209051_1027196 3300025303 Bacteria 2284
130 Ga0209257_1004661 3300025304 Bacteria 10331
131 Ga0209257_1066684 3300025304 Bacteria 962
132 Ga0207692_10022479 3300025898 Bacteria 2902
133 Ga0207692_10025688 3300025898 Bacteria 2755
134 Ga0207710_10030302 3300025900 Bacteria 2359
135 Ga0207710_10040333 3300025900 Bacteria 2069
136 Ga0207647_10016859 3300025904 Bacteria 4976
137 Ga0207685_10026572 3300025905 Bacteria 2015
138 Ga0207699_10000553 3300025906 Bacteria 18426
139 Ga0207699_10036291 3300025906 Bacteria 2809
140 Ga0207643_10181157 3300025908 Bacteria 1275
141 Ga0207707_10000455 3300025912 Bacteria 42610
142 Ga0207695_10000062 3300025913 Bacteria 351979
143 Ga0207695_10082713 3300025913 Bacteria 3245
144 Ga0207671_10007674 3300025914 Bacteria 9317
145 Ga0207671_10033635 3300025914 Bacteria 3812
146 Ga0207671_10040071 3300025914 Bacteria 3468
147 Ga0207693_10001851 3300025915 Bacteria 18534
148 Ga0207663_10004445 3300025916 Bacteria 6973
149 Ga0207660_10005365 3300025917 Bacteria 8325
150 Ga0207652_10001894 3300025921 Bacteria 18100
151 Ga0207681_10154110 3300025923 Bacteria 1725
152 Ga0207694_10010392 3300025924 Bacteria 7017
153 Ga0207694_10203725 3300025924 Bacteria 1610
154 Ga0207687_10173417 3300025927 Bacteria 1665
155 Ga0207700_10043051 3300025928 Bacteria 3314
156 Ga0207690_10403284 3300025932 Bacteria 1091
157 Ga0207706_10069001 3300025933 Bacteria 3109
158 Ga0207665_10008007 3300025939 Bacteria 6972
159 Ga0207665_10272997 3300025939 Bacteria 1256
160 Ga0207711_10424692 3300025941 Bacteria 1236
161 Ga0207661_10081797 3300025944 Bacteria 2668
162 Ga0207677_10069033 3300026023 Bacteria 2484
163 Ga0207703_10061959 3300026035 Bacteria 3064
164 Ga0207678_10052416 3300026067 Bacteria 3520
165 Ga0207678_10061509 3300026067 Bacteria 3230
166 Ga0207678_10074772 3300026067 Bacteria 2903
167 Ga0207702_10000041 3300026078 Bacteria 150754
168 Ga0207676_10157951 3300026095 Bacteria 1961
169 Ga0207674_10020652 3300026116 Bacteria 7112
170 Ga0207683_10359372 3300026121 Bacteria 1337
171 Ga0207698_10032705 3300026142 Bacteria 3771
172 Ga0209389_1000004 3300027296 Bacteria 263759
173 Ga0209389_1000023 3300027296 Bacteria 150730
174 Ga0209589_1000006 3300027357 Bacteria 436292
175 Ga0209589_1000010 3300027357 Bacteria 237657
176 Ga0209489_100007 3300027361 Bacteria 436292
177 Ga0209489_100011 3300027361 Bacteria 244710
178 Ga0209489_110994 3300027361 Bacteria 9645
179 Ga0209700_100008 3300027363 Bacteria 436292
180 Ga0209700_100013 3300027363 Bacteria 341906
181 Ga0209813_10000927 3300027866 Bacteria 6587
182 Ga0209813_10025239 3300027866 Bacteria 1707
183 Ga0268266_10050511 3300028379 Bacteria 3568
184 Ga0268264_10000093 3300028381 Bacteria 232057
185 Ga0307515_10104177 3300028794 Bacteria 3393
186 Ga0265338_10264055 3300028800 Bacteria 1264
187 Ga0307511_10075177 3300030521 Bacteria 2427
188 Ga0265325_10006666 3300031241 Bacteria 6986
189 Ga0265340_10000952 3300031247 Bacteria 16474
190 Ga0265339_10008913 3300031249 Bacteria 6348
191 Ga0265316_10008327 3300031344 Bacteria 9627
192 Ga0265313_10001147 3300031595 Bacteria 25315
193 Ga0307508_10000034 3300031616 Bacteria 160115
194 Ga0265314_10004394 3300031711 Bacteria 13098
195 Ga0265314_10093213 3300031711 Bacteria 1956
196 Ga0265342_10005336 3300031712 Bacteria 9833
197 Ga0265342_10168281 3300031712 Bacteria 1208
198 Ga0307510_10071474 3300033180 Bacteria 3455
199 Ga0307510_10074167 3300033180 Bacteria 3364
200 Ga0307510_10121889 3300033180 Bacteria 2309
201 Ga0307510_10169646 3300033180 Bacteria 1763
202 Ga0373950_0010582 3300034818 Bacteria 1493
203 Ga0373926_0046657 3300035083 Bacteria 1555
204 Ga0373923_0047140 3300035111 Bacteria 1795
205 Ga0373953_0014080 3300035117 Bacteria 2869
206 Ga0373954_0033846 3300035118 Bacteria 2364
207 Ga0373954_0036855 3300035118 Bacteria 2271
208 Ga0373956_0007755 3300035119 Bacteria 4329
209 Ga0373957_0000736 3300035120 Bacteria 8502
210 Ga0373955_0095837 3300035172 Bacteria 1697
211 Ga0373924_0013953 3300035410 Bacteria 3027
212 Ga0373935_0024123 3300035692 Bacteria 3741
213 Ga0373927_0030875 3300035695 Bacteria 3495
214 Ga0373947_0061286 3300035725 Bacteria 2286
215 Ga0373925_0174005 3300037068 Bacteria 1701
216 Ga0373925_0375315 3300037068 Bacteria 1157
217 Ga0395900_0063174 3300037418 Bacteria 3806
218 Ga0395900_0126981 3300037418 Bacteria 2616
219 Ga0395905_0010894 3300037471 Bacteria 8805
220 Ga0395905_0025659 3300037471 Bacteria 5557
221 Ga0436364_1394155 3300037853 Bacteria 3739
222 Ga0436365_0062390 3300039437 Bacteria 1829
223 Ga0436365_0207937 3300039437 Bacteria 18457
224 Ga0436365_1143724 3300039437 Bacteria 2586
225 Ga0436365_1558193 3300039437 Bacteria 1308
226 Ga0436361_0282868 3300039447 Bacteria 3368
227 Ga0436361_0864922 3300039447 Bacteria 3169
228 Ga0436361_0985631 3300039447 Bacteria 4268
229 Ga0436363_0144469 3300039450 Bacteria 8876
230 Ga0436362_0722869 3300039453 Bacteria 1590
231 Ga0436362_0880762 3300039453 Bacteria 6633
232 Ga0451841_0644879 3300041498 Bacteria 1543
233 Ga0439455_0032503 3300042012 Bacteria 1305
234 Ga0466969_0014623 3300044656 Bacteria 4127
235 Ga0466969_0116841 3300044656 Bacteria 1244
236 Ga0466969_0133445 3300044656 Bacteria 1150
237 Ga0466972_0000884 3300044658 Bacteria 14415
238 Ga0466965_0028587 3300044683 Bacteria 2709
239 Ga0466966_0000419 3300044684 Bacteria 27305
240 Ga0466966_0155124 3300044684 Bacteria 1395
241 Ga0466961_0000020 3300044693 Bacteria 107610
242 Ga0466963_0021740 3300044694 Bacteria 4051
243 Ga0466968_0008072 3300044735 Bacteria 4025
244 Ga0466968_0036874 3300044735 Bacteria 2049
245 Ga0466957_0065416 3300044842 Bacteria 2239
246 Ga0466960_0009778 3300044901 Bacteria 3966
247 Ga0466959_0015465 3300045049 Bacteria 5560
248 Ga0466958_0111198 3300045836 Bacteria 1710
249 Ga0466967_0035765 3300045976 Bacteria 4232
250 Ga0495592_0032248 3300046454 Bacteria 3954
251 Ga0495592_0033017 3300046454 Bacteria 3905
252 Ga0495592_0062498 3300046454 Bacteria 2734
253 Ga0495592_0074237 3300046454 Bacteria 2471
254 Ga0495603_0011576 3300046455 Bacteria 5336
255 Ga0495629_0001285 3300046459 Bacteria 19732
256 Ga0495629_0005714 3300046459 Bacteria 9286
257 Ga0495638_0004256 3300046460 Bacteria 10894
258 Ga0495638_0051379 3300046460 Bacteria 2570
259 Ga0495651_0002943 3300046462 Bacteria 13173
260 Ga0495651_0045396 3300046462 Bacteria 3404
261 Ga0495653_0003792 3300046463 Bacteria 12222
262 Ga0495653_0160928 3300046463 Bacteria 1558
263 Ga0495639_0020450 3300046475 Bacteria 2893
264 Ga0495664_0029166 3300046477 Bacteria 3225
265 Ga0495594_0054357 3300046499 Bacteria 2207
266 Ga0495583_0086990 3300046506 Bacteria 1351
267 Ga0495606_0018195 3300046507 Bacteria 5279
268 Ga0495608_0025820 3300046511 Bacteria 4009
269 Ga0495608_0034226 3300046511 Bacteria 3430
270 Ga0495608_0070527 3300046511 Bacteria 2280
271 Ga0495610_0063678 3300046512 Bacteria 1745
272 Ga0495610_0084059 3300046512 Bacteria 1455
273 Ga0495628_0225902 3300046516 Bacteria 1404
274 Ga0495632_0070855 3300046519 Bacteria 1676
275 Ga0495643_0017154 3300046522 Bacteria 4239
276 Ga0495648_0003170 3300046524 Bacteria 14641
277 Ga0495652_0003125 3300046529 Bacteria 16545
278 Ga0495640_0006193 3300046533 Bacteria 9475
279 Ga0495640_0013630 3300046533 Bacteria 6179
280 Ga0495640_0077352 3300046533 Bacteria 2218
281 Ga0495587_0040557 3300046536 Bacteria 2782
282 Ga0495587_0138874 3300046536 Bacteria 1387
283 Ga0495609_0042687 3300046538 Bacteria 2037
284 Ga0495645_0030962 3300046543 Bacteria 3897
285 Ga0495645_0291132 3300046543 Bacteria 1070
286 Ga0495622_0003529 3300046557 Bacteria 7358
287 Ga0495622_0022704 3300046557 Bacteria 2923
288 Ga0495667_0006907 3300046559 Bacteria 7698
289 Ga0495667_0129442 3300046559 Bacteria 1628
290 Ga0495667_0136629 3300046559 Bacteria 1580
291 Ga0495668_0131622 3300046616 Bacteria 1369
292 Ga0495668_0199454 3300046616 Bacteria 1096
293 Ga0495634_0027819 3300046642 Bacteria 3931
294 Ga0495634_0030692 3300046642 Bacteria 3709
295 Ga0495611_0032459 3300046648 Bacteria 2301
296 Ga0495611_0064116 3300046648 Bacteria 1673
297 Ga0495625_0026834 3300046660 Bacteria 4344
298 Ga0495635_0002149 3300046663 Bacteria 13377
299 Ga0495635_0002910 3300046663 Bacteria 11762
300 Ga0495635_0077127 3300046663 Bacteria 2283
301 Ga0495588_0008982 3300046674 Bacteria 4603
302 Ga0495657_0002869 3300046675 Bacteria 14315
303 Ga0495657_0025540 3300046675 Bacteria 4193
304 Ga0495599_0049823 3300046678 Bacteria 2625
305 Ga0495623_0065880 3300046679 Bacteria 2264
306 Ga0495623_0186665 3300046679 Bacteria 1200
307 Ga0495646_0091179 3300046680 Bacteria 1759
308 Ga0495646_0133506 3300046680 Bacteria 1395
309 Ga0495646_0149256 3300046680 Bacteria 1301
310 Ga0495613_0117094 3300046689 Bacteria 1916
311 Ga0495613_0354177 3300046689 Bacteria 1008
312 Ga0495670_0022409 3300046691 Bacteria 3118
313 Ga0495649_0040585 3300046694 Bacteria 2547
314 Ga0495600_0004830 3300046809 Bacteria 8093
315 Ga0495600_0059270 3300046809 Bacteria 2500
316 Ga0495604_0007695 3300047317 Bacteria 8534
317 Ga0495604_0007712 3300047317 Bacteria 8528
318 Ga0495604_0089021 3300047317 Bacteria 2295
319 Ga0495674_0044542 3300047319 Bacteria 3945
320 Ga0495674_0048975 3300047319 Bacteria 3736
321 Ga0495672_0009510 3300047320 Bacteria 7037
322 Ga0495672_0010901 3300047320 Bacteria 6448
323 Ga0495672_0085538 3300047320 Bacteria 1747
324 Ga0495676_0089041 3300047321 Bacteria 2313
325 Ga0495676_0139333 3300047321 Bacteria 1740
326 Ga0495680_0009327 3300047322 Bacteria 8839
327 Ga0495680_0010422 3300047322 Bacteria 8293
328 Ga0495680_0039739 3300047322 Bacteria 3751
329 Ga0495683_0029211 3300047323 Bacteria 2818
330 Ga0495687_006414 3300047443 Bacteria 7216
331 Ga0495675_0006349 3300047444 Bacteria 7234
332 Ga0495673_0104085 3300047469 Bacteria 1143
333 Ga0495681_0161408 3300047470 Bacteria 933
334 Ga0495684_0136904 3300047471 Bacteria 1837
335 Ga0495686_0053553 3300047472 Bacteria 2529
336 Ga0495686_0064675 3300047472 Bacteria 2263
337 Ga0495593_0022030 3300047673 Bacteria 3555
338 Ga0495602_0089280 3300048088 Bacteria 2563
339 Ga0496100_0020659 3300048903 Bacteria 3952
340 Ga0496100_0049703 3300048903 Bacteria 2713
341 Ga0496102_0110959 3300048905 Bacteria 2557
342 Ga0496102_0149129 3300048905 Bacteria 2196
343 Ga0496102_0166000 3300048905 Bacteria 2077
344 Ga0496102_0206350 3300048905 Bacteria 1853
345 Ga0496103_0006040 3300048906 Bacteria 7237
346 Ga0496103_0013113 3300048906 Bacteria 4915
347 Ga0496105_0007938 3300048908 Bacteria 8247
348 Ga0496105_0072433 3300048908 Bacteria 2847
349 Ga0496105_0114424 3300048908 Bacteria 2225
350 Ga0496105_0267429 3300048908 Bacteria 1381
351 Ga0496106_0002438 3300048909 Bacteria 13856
352 Ga0496106_0005543 3300048909 Bacteria 9342
353 Ga0496106_0030606 3300048909 Bacteria 4012
354 Ga0496106_0069423 3300048909 Bacteria 2689
355 Ga0496107_0040003 3300048910 Bacteria 3365
356 Ga0496107_0115896 3300048910 Bacteria 1972
357 Ga0496107_0124522 3300048910 Bacteria 1900
358 Ga0496108_0005372 3300048911 Bacteria 10354
359 Ga0496108_0021547 3300048911 Bacteria 5294
360 Ga0496109_0001905 3300048912 Bacteria 17328
361 Ga0496109_0081491 3300048912 Bacteria 2982
362 Ga0496110_0012096 3300048913 Bacteria 7091
363 Ga0496110_0015008 3300048913 Bacteria 6442
364 Ga0496110_0167420 3300048913 Bacteria 1993
365 Ga0496110_0343158 3300048913 Bacteria 1360
366 Ga0496112_0002552 3300048915 Bacteria 14709
367 Ga0496112_0009780 3300048915 Bacteria 8660
368 Ga0496114_0130114 3300048917 Bacteria 2173
369 Ga0496115_0014720 3300048918 Bacteria 5926
370 Ga0496116_0046071 3300048919 Bacteria 2946
371 Ga0496117_0019495 3300048920 Bacteria 5567
372 Ga0496117_0122959 3300048920 Bacteria 1590
373 Ga0496117_0164011 3300048920 Bacteria 1298
374 Ga0496117_0184533 3300048920 Bacteria 1195
375 Ga0496117_0203566 3300048920 Bacteria 1116
376 Ga0496117_0291492 3300048920 Bacteria 868
377 Ga0496118_0006042 3300048921 Bacteria 13485
378 Ga0496118_0040927 3300048921 Bacteria 3676
379 Ga0496118_0042272 3300048921 Bacteria 3597
380 Ga0496118_0063520 3300048921 Bacteria 2716
381 Ga0496118_0233700 3300048921 Bacteria 1058
382 Ga0496119_0052645 3300048922 Bacteria 2492
383 Ga0496120_0030158 3300048923 Bacteria 3301
384 Ga0496121_0000381 3300048924 Bacteria 90593
385 Ga0496121_0000894 3300048924 Bacteria 53831
386 Ga0496121_0022968 3300048924 Bacteria 6026
387 Ga0496121_0025842 3300048924 Bacteria 5555
388 Ga0496121_0045740 3300048924 Bacteria 3757
389 Ga0496121_0096082 3300048924 Bacteria 2301
390 Ga0496121_0154500 3300048924 Bacteria 1685
391 Ga0496121_0257325 3300048924 Bacteria 1207
392 Ga0496122_0075903 3300048925 Bacteria 2368
393 Ga0496122_0105596 3300048925 Bacteria 1867
394 Ga0496122_0191323 3300048925 Bacteria 1207
395 Ga0496122_0234652 3300048925 Bacteria 1040
396 Ga0496124_0125704 3300048927 Bacteria 2043
397 Ga0496125_0000203 3300048928 Bacteria 125569
398 Ga0496125_0008442 3300048928 Bacteria 10779
399 Ga0496125_0061769 3300048928 Bacteria 3002
400 Ga0496125_0062864 3300048928 Bacteria 2965
401 Ga0496125_0065940 3300048928 Bacteria 2864
402 Ga0496125_0066809 3300048928 Bacteria 2838
403 Ga0496125_0115229 3300048928 Bacteria 1933
404 Ga0496125_0156733 3300048928 Bacteria 1554
405 Ga0496126_0003737 3300048929 Bacteria 18962
406 Ga0496126_0031265 3300048929 Bacteria 5033
407 Ga0496126_0033507 3300048929 Bacteria 4832
408 Ga0496126_0058233 3300048929 Bacteria 3483
409 Ga0496126_0072248 3300048929 Bacteria 3069
410 Ga0496126_0158489 3300048929 Bacteria 1935
411 Ga0496126_0181789 3300048929 Bacteria 1786
412 Ga0496126_0232926 3300048929 Bacteria 1542
413 Ga0496126_0240084 3300048929 Bacteria 1514
414 Ga0496126_0296968 3300048929 Bacteria 1334
415 Ga0495678_061814 3300049459 Bacteria 1404
416 Ga0501033_0014949 3300049570 Bacteria 5892
417 Ga0501034_0094551 3300049571 Bacteria 2985
418 Ga0501034_0098319 3300049571 Bacteria 2922
419 Ga0501034_0488180 3300049571 Bacteria 1146
420 Ga0501037_0078046 3300049573 Bacteria 2403
421 Ga0501038_0008323 3300049574 Bacteria 9544
422 Ga0501038_0094169 3300049574 Bacteria 2504
423 Ga0501038_0102461 3300049574 Bacteria 2382
424 Ga0501043_0020301 3300049579 Bacteria 5212
425 Ga0501043_0087651 3300049579 Bacteria 2446
426 Ga0501043_0106403 3300049579 Bacteria 2203
427 Ga0501043_0189138 3300049579 Bacteria 1602
428 Ga0501047_0018314 3300049581 Bacteria 6711
429 Ga0501047_0026863 3300049581 Bacteria 5542
430 Ga0501047_0193360 3300049581 Bacteria 1897
431 Ga0501067_0036259 3300049583 Bacteria 2738
432 Ga0501070_0036466 3300049586 Bacteria 4106
433 Ga0501070_0081744 3300049586 Bacteria 2673
434 Ga0501070_0112302 3300049586 Bacteria 2252
435 Ga0501070_0354661 3300049586 Bacteria 1190
436 Ga0501073_0018379 3300049589 Bacteria 5053
437 Ga0501074_0016566 3300049590 Bacteria 5350
438 Ga0501079_0117553 3300049741 Bacteria 2067
439 Ga0501080_0031335 3300049742 Bacteria 4954
440 Ga0501080_0105685 3300049742 Bacteria 2610
441 Ga0501035_0076300 3300049822 Bacteria 2964
442 Ga0501035_0162387 3300049822 Bacteria 1933
443 Ga0501044_0060011 3300049823 Bacteria 3896
444 Ga0501044_0098629 3300049823 Bacteria 2941
445 Ga0501044_0221329 3300049823 Bacteria 1843
446 Ga0501044_0281870 3300049823 Bacteria 1595
447 Ga0501044_0329678 3300049823 Bacteria 1449
448 nmdc:mga03n38_40045_c1 3300050490 Bacteria 2035
449 nmdc:mga00v17_168068_c1 3300050491 Bacteria 1413
450 nmdc:mga0yw44_161474_c1 3300050492 Bacteria 1467
451 nmdc:mga0yw44_169146_c1 3300050492 Bacteria 1434
452 nmdc:mga0yw44_288523_c1 3300050492 Bacteria 1098
453 nmdc:mga0k408_194564_c1 3300050493 Bacteria 1210
454 nmdc:mga0k408_23356_c1 3300050493 Bacteria 3487
455 nmdc:mga0k408_28176_c1 3300050493 Bacteria 3193
456 nmdc:mga06z11_78529_c1 3300050494 Bacteria 1765
457 nmdc:mga04h51_24029_c1 3300050495 Bacteria 1862
458 nmdc:mga04h51_977_c1 3300050495 Bacteria 6603
459 nmdc:mga07m45_121104_c1 3300050496 Bacteria 1511
460 nmdc:mga07m45_170878_c1 3300050496 Bacteria 1263
461 nmdc:mga0qj67_267_c1 3300050509 Bacteria 35925
462 nmdc:mga0n895_291700_c1 3300050512 Bacteria 1654
463 nmdc:mga0rr50_33962_c1 3300050513 Bacteria 3648
464 nmdc:mga0sz30_37157_c1 3300050516 Bacteria 2038
465 Ga0495601_0034782 3300053077 Bacteria 3144
466 Ga0495601_0121914 3300053077 Bacteria 1694
467 Ga0495612_0127891 3300053078 Bacteria 1096
468 Ga0500635_0036306 3300053080 Bacteria 1623
469 Ga0495655_0022058 3300053083 Bacteria 1450
470 Ga0495595_0022452 3300053084 Bacteria 2770
471 Ga0495619_0022381 3300053085 Bacteria 4044
472 Ga0500643_000018 3300053087 Bacteria 296505
473 Ga0500643_013312 3300053087 Bacteria 2910
474 Ga0500581_037972 3300053089 Bacteria 2468
475 Ga0500651_0021939 3300053093 Bacteria 3985
476 Ga0500651_0116898 3300053093 Bacteria 1622
477 Ga0500566_0018834 3300053094 Bacteria 4053
478 Ga0500566_0040832 3300053094 Bacteria 2681
479 Ga0500641_0013788 3300053096 Bacteria 2973
480 Ga0500641_0116900 3300053096 Bacteria 1148
481 Ga0500650_0016521 3300053098 Bacteria 3168
482 Ga0500555_001894 3300053103 Bacteria 6209
483 Ga0500556_0000778 3300053104 Bacteria 18849
484 Ga0500556_0107433 3300053104 Bacteria 1079
485 Ga0500557_000008 3300053105 Bacteria 127284
486 Ga0500562_047754 3300053108 Bacteria 1142
487 Ga0500569_000332 3300053109 Bacteria 7539
488 Ga0500572_000927 3300053111 Bacteria 9023
489 Ga0500572_023508 3300053111 Bacteria 1655
490 Ga0500592_001472 3300053116 Bacteria 3822
491 Ga0500592_002606 3300053116 Bacteria 2895
492 Ga0500595_001022 3300053119 Bacteria 15703
493 Ga0500595_004914 3300053119 Bacteria 5910
494 Ga0500595_021071 3300053119 Bacteria 2333
495 Ga0500607_007866 3300053121 Bacteria 6527
496 Ga0500608_058663 3300053122 Bacteria 1842
497 Ga0500608_136535 3300053122 Bacteria 1093
498 Ga0500614_023246 3300053123 Bacteria 1455
499 Ga0500618_007183 3300053125 Bacteria 3201
500 Ga0500642_0000279 3300053130 Bacteria 18931
501 Ga0500642_0000425 3300053130 Bacteria 13760
502 Ga0500652_008162 3300053131 Bacteria 3475
503 Ga0500658_0064369 3300053134 Bacteria 1533
504 Ga0500559_0001443 3300053136 Bacteria 13494
505 Ga0500559_0002465 3300053136 Bacteria 9560
506 Ga0500559_0017531 3300053136 Bacteria 3024
507 Ga0500568_0000833 3300053139 Bacteria 21699
508 Ga0500568_0017296 3300053139 Bacteria 3185
509 Ga0500573_0015044 3300053140 Bacteria 4382
510 Ga0500577_0024782 3300053142 Bacteria 2021
511 Ga0500586_028255 3300053145 Bacteria 1830
512 Ga0500588_0100285 3300053146 Bacteria 997
513 Ga0500603_002201 3300053150 Bacteria 4304
514 Ga0500604_0016112 3300053151 Bacteria 2055
515 Ga0500616_0000180 3300053153 Bacteria 106053
516 Ga0500616_0007514 3300053153 Bacteria 6903
517 Ga0500622_0004447 3300053156 Bacteria 8802
518 Ga0500622_0006536 3300053156 Bacteria 6736
519 Ga0500627_0007880 3300053158 Bacteria 3745
520 Ga0500627_0059483 3300053158 Bacteria 1679
521 Ga0500639_013282 3300053163 Bacteria 4332
522 Ga0500636_0001226 3300053177 Bacteria 13863
523 Ga0500636_0085715 3300053177 Bacteria 1809
524 Ga0500637_0005742 3300053178 Bacteria 6040
525 Ga0500637_0020186 3300053178 Bacteria 3604
526 Ga0500576_009965 3300053725 Bacteria 4190
527 Ga0500552_000615 3300053733 Bacteria 3353
528 Ga0500596_003569 3300053735 Bacteria 2936
529 Ga0500601_000920 3300053737 Bacteria 3496
530 2507510914 2507262055 Bacteria 8048963
531 2508544726 2508501009 Bacteria 7784016
532 2508697044 2508501042 Bacteria 8719808
533 2509147146 2508501128 Bacteria 8613869
534 2511394394 2511231028 Bacteria 8046582
535 2513623397 2513237092 Bacteria 8341956
536 2513637575 2513237094 Bacteria 8789602
537 2513649582 2513237095 Bacteria 8976980
538 2513700035 2513237102 Bacteria 7703324
539 2513719234 2513237104 Bacteria 10034502
540 2513874563 2513237139 Bacteria 8737671
541 2514015531 2513237161 Bacteria 8871253
542 2515625542 2515154112 Bacteria 8294334
543 2517100494 2517093001 Bacteria 9002274
544 2517894671 2517572143 Bacteria 9484767
545 2524437354 2524023205 Bacteria 8918781
546 2524534411 2524023228 Bacteria 10118060
547 2528849927 2528768022 Bacteria 10457665
548 2603861230 2602042107 Bacteria 6226103
549 2617350672 2617270735 Bacteria 9163226
550 2617377920 2617270741 Bacteria 8201522
551 2644287393 2643221651 Bacteria 4798932
552 2728747670 2728368998 Bacteria 8720350
553 2745076830 2744054633 Bacteria 8678936
554 2793066062 2791355196 Bacteria 7323613
555 2805916558 2802429603 Bacteria 8777136
556 2818238052 2816332527 Bacteria 8933356
557 2824606146 2824600985 Bacteria 8488197
558 2824616026 2824609381 Bacteria 8672835
559 2824618949 2824617872 Bacteria 8814715
560 2824627531 2824626560 Bacteria 8813858
561 2824638856 2824635225 Bacteria 8785348
562 2824647658 2824644064 Bacteria 8743947
563 2824657325 2824653114 Bacteria 8493680
564 2824668197 2824661429 Bacteria 9877870
565 2824675565 2824671348 Bacteria 8369588
566 2824682032 2824679649 Bacteria 8248951
567 2824692231 2824687955 Bacteria 8360029
568 2824698703 2824696289 Bacteria 8335049
569 2824706525 2824704595 Bacteria 9667483
570 2824716453 2824714736 Bacteria 8717648
571 2824726399 2824723954 Bacteria 8758240
572 2824736300 2824732956 Bacteria 7810675
573 2824751942 2824746037 Bacteria 7911610
574 2824756927 2824753945 Bacteria 9787441
575 2824769723 2824763712 Bacteria 9792355
576 2824778465 2824773399 Bacteria 8360218
577 2838127804 2838122688 Bacteria 8803140
578 2841943097 2841941048 Bacteria 8688029
579 2841956118 2841949485 Bacteria 8680857
580 2841960310 2841957949 Bacteria 8652217
581 2841968261 2841966195 Bacteria 8673214
582 2841976525 2841974524 Bacteria 8931498
583 2841987901 2841983080 Bacteria 8395090
584 2842042796 2842038055 Bacteria 8002051
585 2842050838 2842045827 Bacteria 8006841
586 2844317008 2844315083 Bacteria 8138177
587 2847938475 2847930680 Bacteria 9342022
588 2847944327 2847939898 Bacteria 8606328
589 2849081435 2849076700 Bacteria 7039503
590 2857512095 2857509624 Bacteria 7472071
591 2857530013 2857524615 Bacteria 6615449
592 2874597639 2874590934 Bacteria 8299676
593 2874615721 2874612657 Bacteria 8252029
594 2874623523 2874620515 Bacteria 8290088
595 2874630546 2874628541 Bacteria 8630250
596 2874649203 2874645413 Bacteria 8214782
597 2876774888 2876771140 Bacteria 8287509
598 2876822360 2876818435 Bacteria 8274608
599 2879077976 2879074833 Bacteria 8279565
600 2879088714 2879083081 Bacteria 8587928
601 2879102001 2879099564 Bacteria 10442239
602 2879132473 2879127579 Bacteria 8294491
603 2879145973 2879142872 Bacteria 8267021
604 2881370592 2881364244 Bacteria 7710352
605 2881667355 2881665667 Bacteria 8175609
606 2885367019 2885366525 Bacteria 8326213
607 2885416557 2885409591 Bacteria 9235467
608 2888381631 2888378607 Bacteria 9652610
609 2888388998 2888388044 Bacteria 7304136
610 2888422030 2888419890 Bacteria 7857137
611 2893071063 2893066018 Bacteria 6158120
612 2903734976 2903727486 Bacteria 8281579
613 2904667673 2904666416 Bacteria 8226587
614 2904719109 2904711408 Bacteria 9771557
615 2906604091 2906602504 Bacteria 8295279
616 2906611398
617 2906632998 2906626472 Bacteria 8826946
618 2906648266 2906643746 Bacteria 8722424
619 2908782030 2908775508 Bacteria 8092255
620 2919077069 2919073203 Bacteria 6531949
621 2919452441 2919450847 Bacteria 5631160
622 2922371304
623 2922393786 2922393267 Bacteria 8285685
624 2929619681 2929615660 Bacteria 9193770
625 2929627848 2929624759 Bacteria 9339455
626 2932786013 2932784394 Bacteria 9704911
627 2932798216 2932794094 Bacteria 7915132
628 2932804009 2932801729 Bacteria 7987968
629 2932817038 2932809354 Bacteria 9135765
630 2932822471 2932818245 Bacteria 9955613
631 2932831057 2932828146 Bacteria 9745859
632 2933581600 2933577622 Bacteria 9116884
633 2935612868 2935608549 Bacteria 8203142
634 2935624155 2935616580 Bacteria 9032984
635 2935632112 2935630451 Bacteria 8169952
636 2935640199 2935638405 Bacteria 10015038
637 2935654993 2935648319 Bacteria 8801166
638 2935663873 2935656913 Bacteria 8965014
639 2935666963 2935665750 Bacteria 9571747
640 2935680397 2935675223 Bacteria 9928132
641 2935690094 2935684952 Bacteria 9590419
642 2935699824 2935694250 Bacteria 9291695
643 2935704718 2935703347 Bacteria 10242284
644 2935722194 2935713505 Bacteria 9608509
645 2935731503 2935722832 Bacteria 9608746
646 2935735409 2935732158 Bacteria 9706831
647 2935745320 2935741537 Bacteria 9707219
648 2935755105 2935750917 Bacteria 9590372
649 2935762380 2935760218 Bacteria 9817913
650 2935775415 2935769743 Bacteria 7878163
651 2935780317 2935777560 Bacteria 8077691
652 2935790664 2935785616 Bacteria 7962367
653 2935799153 2935793552 Bacteria 8012592
654 2935803879 2935801545 Bacteria 9301974
655 2935811797 2935810662 Bacteria 9401221
656 2935824356 2935819856 Bacteria 8261050
657 2935829682 2935827899 Bacteria 10038562
658 2935842986 2935837841 Bacteria 9454360
659 2935852499 2935847175 Bacteria 8228321
660 2935862345 2935855204 Bacteria 9035059
661 2935870480 2935864058 Bacteria 9784707
662 2935881062 2935873716 Bacteria 9632195
663 2935884185 2935883170 Bacteria 7964738
664 2935912347 2935908558 Bacteria 8568796
665 2935923979 2935916978 Bacteria 9113783
666 2935929376 2935926038 Bacteria 8601059
667 2935936007 2935934488 Bacteria 8602579
668 2935949907 2935942939 Bacteria 8599779
669 2935957327 2935951376 Bacteria 8602333
670 2935962154 2935959822 Bacteria 7869783
671 2935968358 2935967501 Bacteria 8603075
672 2935976545 2935975950 Bacteria 8347125
673 2935988009 2935984226 Bacteria 8302647
674 2935993559 2935992306 Bacteria 9802711
675 2936004455 2936002035 Bacteria 9362176
676 2936018058 2936011229 Bacteria 8801034
677 2936026532 2936019824 Bacteria 8804134
678 2936035275 2936028420 Bacteria 8965941
679 2936038380 2936037263 Bacteria 9446081
680 2936053453 2936046547 Bacteria 8903709
681 2936059434 2936055302 Bacteria 8785755
682 2940561615 2940556831 Bacteria 9590747
683 2941508060 2941507105 Bacteria 8166816
684 2941515435 2941515067 Bacteria 8166720
685 2941523990 2941523033 Bacteria 8169134
686 2941533793 2941531003 Bacteria 7653939
687 2941544210 2941538514 Bacteria 9402094
688 3005485407 3005483717 Bacteria 7877331
689 3005507218 3005506211 Bacteria 6943378
690 3005594578 3005587118 Bacteria 7794411
691 3005596652 3005594810 Bacteria 8716512
692 3005712727 3005710791 Bacteria 7622528
693 3005719777 3005718088 Bacteria 8283608
694 8006933166 8006926726 Bacteria 6749210
695 8016516323 8016511872 Bacteria 9921665
696 8016523719 8016522445 Bacteria 8156687
697 8016537243 8016530956 Bacteria 8155261
698 8016541504 8016539877 Bacteria 8155419
699 8016551749 8016548790 Bacteria 8155074
700 8016560138 8016557553 Bacteria 8154380
701 8016566896 8016566248 Bacteria 8158151
702 8016579626 8016575299 Bacteria 8154085
703 8016589243 8016583857 Bacteria 10421953
704 8016598057 8016595262 Bacteria 8149947
705 8016604196 8016603502 Bacteria 8731218
706 8016620777 8016613128 Bacteria 8794220
707 8016629209 8016622563 Bacteria 7999408
708 8017060210 8017057580 Bacteria 10023680
709 8019536932 8019530166 Bacteria 8155624
710 8019548141 8019547302 Bacteria 7996444
711 8019579729 8019576017 Bacteria 10049540
712 8019587441 8019586578 Bacteria 10212056
713 8019614636 8019608314 Bacteria 10042931
714 8019625254 8019619141 Bacteria 9218857
715 8019636927 8019629233 Bacteria 8687553
716 8019642681 8019638758 Bacteria 9062356
717 8019649908 8019648815 Bacteria 10014479
718 8019664750 8019659431 Bacteria 8577854
719 8019674332 8019668869 Bacteria 8791617
720 8019681782 8019678201 Bacteria 8863603
721 8019693997 8019687851 Bacteria 8712826
722 8055749063 8055742211 Bacteria 9226248
723 8056695099 8056689827 Bacteria 6712655
724 8056969916 8056967851 Bacteria 9038162
725 JGI25153J46596_10009092
726 JGI25165J46597_1004656
727 JGI25153J46596_10004824
728 JGI25153J46596_10027971
729 JGI25153J46596_10028501
730 JGI25160J50197_1009693
731 JGI25404J52841_10001584
732 Ga0055539_1003188
733 Ga0055526_1028525
734 Ga0055526_1029585
735 Ga0055531_10003265
736 Ga0055543_1003054
737 Ga0055543_1016904
738 Ga0065165_1002837
739 Ga0065165_1005269
740 Ga0065165_1007564
741 Ga0070658_10019082
742 Ga0070658_10045152
743 Ga0070683_100125277
744 Ga0068868_100017680
745 Ga0070661_100065700
746 Ga0070668_100077330
747 Ga0070668_100123936
748 Ga0070669_100270897
749 Ga0070671_100052057
750 Ga0070667_100053721
751 Ga0070667_100135306
752 Ga0070709_10001764
753 Ga0070709_10028569
754 Ga0070714_100010698
755 Ga0070714_100185760
756 Ga0070710_10001695
757 Ga0070710_10021064
758 Ga0070711_100002420
759 Ga0070711_100137513
760 Ga0070663_100050838
761 Ga0070663_100056464
762 Ga0070663_100106968
763 Ga0070679_100069331
764 Ga0070684_100038257
765 Ga0070684_100559520
766 Ga0068853_100047394
767 Ga0070665_100256281
768 Ga0068855_100097468
769 Ga0068857_100019266
770 Ga0068854_100313128
771 Ga0068856_100002538
772 Ga0068864_100322688
773 Ga0068851_10161030
774 Ga0068862_100493908
775 Ga0081455_10003699
776 Ga0081540_1003091
777 Ga0081540_1010356
778 Ga0081539_10001829
779 Ga0070717_10029907
780 Ga0075365_10088253
781 Ga0075365_10119922
782 Ga0075368_10034252
783 Ga0075368_10056296
784 Ga0075363_100045805
785 Ga0075364_10062781
786 Ga0070712_100007513
787 Ga0075367_10098451
788 Ga0075367_10152756
789 Ga0075369_10010725
790 Ga0075369_10059516
791 Ga0075366_10034561
792 Ga0075366_10197329
793 Ga0075370_10069024
794 Ga0075370_10251434
795 Ga0068871_100080011
796 Ga0099825_1020431
797 Ga0099824_1025695
798 Ga0099823_1063709
799 Ga0099794_10046066
800 Ga0105240_10014565
801 Ga0105240_10076395
802 Ga0105245_10074811
803 Ga0105247_10099619
804 Ga0105247_10105343
805 Ga0105248_10366124
806 Ga0105237_10004158
807 Ga0105237_10005728
808 Ga0105237_10030097
809 Ga0105237_10127376
810 Ga0105239_10018834
811 Ga0105239_10097833
812 Ga0105239_10213909
813 Ga0105239_10635401
814 Ga0157370_10099074
815 Ga0157369_10005591
816 Ga0157372_10055869
817 Ga0157379_10275067
818 Ga0157379_10289882
819 Ga0157376_10175757
820 Ga0157376_10495090
821 Ga0206353_10981988
822 Ga0214544_1000026
823 Ga0214542_1000025
824 Ga0214542_1030681
825 Ga0214545_1000014
826 Ga0214545_1025563
827 Ga0214543_1000034
828 Ga0213873_10010925
829 Ga0213874_10006183
830 Ga0213876_10003720
831 Ga0213876_10069659
832 Ga0213871_10016702
833 Ga0207425_1008458
834 Ga0209677_101109
835 Ga0209148_1000250
836 Ga0209233_1001802
837 Ga0209455_1002768
838 Ga0209455_1018947
839 Ga0209130_1027315
840 Ga0209564_1004750
841 Ga0209564_1009379
842 Ga0209564_1019544
843 Ga0209758_1000141
844 Ga0209758_1000324
845 Ga0209758_1000476
846 Ga0209758_1001389
847 Ga0209758_1003697
848 Ga0209758_1005554
849 Ga0209256_1017836
850 Ga0207426_1000523
851 Ga0207426_1003307
852 Ga0207426_1030127
853 Ga0209051_1027196
854 Ga0209257_1004661
855 Ga0209257_1066684
856 Ga0207692_10022479
857 Ga0207692_10025688
858 Ga0207710_10030302
859 Ga0207710_10040333
860 Ga0207647_10016859
861 Ga0207685_10026572
862 Ga0207699_10000553
863 Ga0207699_10036291
864 Ga0207643_10181157
865 Ga0207707_10000455
866 Ga0207695_10000062
867 Ga0207695_10082713
868 Ga0207671_10007674
869 Ga0207671_10033635
870 Ga0207671_10040071
871 Ga0207693_10001851
872 Ga0207663_10004445
873 Ga0207660_10005365
874 Ga0207652_10001894
875 Ga0207681_10154110
876 Ga0207694_10010392
877 Ga0207694_10203725
878 Ga0207687_10173417
879 Ga0207700_10043051
880 Ga0207690_10403284
881 Ga0207706_10069001
882 Ga0207665_10008007
883 Ga0207665_10272997
884 Ga0207711_10424692
885 Ga0207661_10081797
886 Ga0207677_10069033
887 Ga0207703_10061959
888 Ga0207678_10052416
889 Ga0207678_10061509
890 Ga0207678_10074772
891 Ga0207702_10000041
892 Ga0207676_10157951
893 Ga0207674_10020652
894 Ga0207683_10359372
895 Ga0207698_10032705
896 Ga0209389_1000004
897 Ga0209389_1000023
898 Ga0209589_1000006
899 Ga0209589_1000010
900 Ga0209489_100007
901 Ga0209489_100011
902 Ga0209489_110994
903 Ga0209700_100008
904 Ga0209700_100013
905 Ga0209813_10000927
906 Ga0209813_10025239
907 Ga0268266_10050511
908 Ga0268264_10000093
909 Ga0307515_10104177
910 Ga0265338_10264055
911 Ga0307511_10075177
912 Ga0265325_10006666
913 Ga0265340_10000952
914 Ga0265339_10008913
915 Ga0265316_10008327
916 Ga0265313_10001147
917 Ga0307508_10000034
918 Ga0265314_10004394
919 Ga0265314_10093213
920 Ga0265342_10005336
921 Ga0265342_10168281
922 Ga0307510_10071474
923 Ga0307510_10074167
924 Ga0307510_10121889
925 Ga0307510_10169646
926 Ga0373950_0010582
927 Ga0373926_0046657
928 Ga0373923_0047140
929 Ga0373953_0014080
930 Ga0373954_0033846
931 Ga0373954_0036855
932 Ga0373956_0007755
933 Ga0373957_0000736
934 Ga0373955_0095837
935 Ga0373924_0013953
936 Ga0373935_0024123
937 Ga0373927_0030875
938 Ga0373947_0061286
939 Ga0373925_0174005
940 Ga0373925_0375315
941 Ga0395900_0063174
942 Ga0395900_0126981
943 Ga0395905_0010894
944 Ga0395905_0025659
945 Ga0436364_1394155
946 Ga0436365_0062390
947 Ga0436365_0207937
948 Ga0436365_1143724
949 Ga0436365_1558193
950 Ga0436361_0282868
951 Ga0436361_0864922
952 Ga0436361_0985631
953 Ga0436363_0144469
954 Ga0436362_0722869
955 Ga0436362_0880762
956 Ga0451841_0644879
957 Ga0439455_0032503
958 Ga0466969_0014623
959 Ga0466969_0116841
960 Ga0466969_0133445
961 Ga0466972_0000884
962 Ga0466965_0028587
963 Ga0466966_0000419
964 Ga0466966_0155124
965 Ga0466961_0000020
966 Ga0466963_0021740
967 Ga0466968_0008072
968 Ga0466968_0036874
969 Ga0466957_0065416
970 Ga0466960_0009778
971 Ga0466959_0015465
972 Ga0466958_0111198
973 Ga0466967_0035765
974 Ga0495592_0032248
975 Ga0495592_0033017
976 Ga0495592_0062498
977 Ga0495592_0074237
978 Ga0495603_0011576
979 Ga0495629_0001285
980 Ga0495629_0005714
981 Ga0495638_0004256
982 Ga0495638_0051379
983 Ga0495651_0002943
984 Ga0495651_0045396
985 Ga0495653_0003792
986 Ga0495653_0160928
987 Ga0495639_0020450
988 Ga0495664_0029166
989 Ga0495594_0054357
990 Ga0495583_0086990
991 Ga0495606_0018195
992 Ga0495608_0025820
993 Ga0495608_0034226
994 Ga0495608_0070527
995 Ga0495610_0063678
996 Ga0495610_0084059
997 Ga0495628_0225902
998 Ga0495632_0070855
999 Ga0495643_0017154
1000 Ga0495648_0003170
1001 Ga0495652_0003125
1002 Ga0495640_0006193
1003 Ga0495640_0013630
1004 Ga0495640_0077352
1005 Ga0495587_0040557
1006 Ga0495587_0138874
1007 Ga0495609_0042687
1008 Ga0495645_0030962
1009 Ga0495645_0291132
1010 Ga0495622_0003529
1011 Ga0495622_0022704
1012 Ga0495667_0006907
1013 Ga0495667_0129442
1014 Ga0495667_0136629
1015 Ga0495668_0131622
1016 Ga0495668_0199454
1017 Ga0495634_0027819
1018 Ga0495634_0030692
1019 Ga0495611_0032459
1020 Ga0495611_0064116
1021 Ga0495625_0026834
1022 Ga0495635_0002149
1023 Ga0495635_0002910
1024 Ga0495635_0077127
1025 Ga0495588_0008982
1026 Ga0495657_0002869
1027 Ga0495657_0025540
1028 Ga0495599_0049823
1029 Ga0495623_0065880
1030 Ga0495623_0186665
1031 Ga0495646_0091179
1032 Ga0495646_0133506
1033 Ga0495646_0149256
1034 Ga0495613_0117094
1035 Ga0495613_0354177
1036 Ga0495670_0022409
1037 Ga0495649_0040585
1038 Ga0495600_0004830
1039 Ga0495600_0059270
1040 Ga0495604_0007695
1041 Ga0495604_0007712
1042 Ga0495604_0089021
1043 Ga0495674_0044542
1044 Ga0495674_0048975
1045 Ga0495672_0009510
1046 Ga0495672_0010901
1047 Ga0495672_0085538
1048 Ga0495676_0089041
1049 Ga0495676_0139333
1050 Ga0495680_0009327
1051 Ga0495680_0010422
1052 Ga0495680_0039739
1053 Ga0495683_0029211
1054 Ga0495687_006414
1055 Ga0495675_0006349
1056 Ga0495673_0104085
1057 Ga0495681_0161408
1058 Ga0495684_0136904
1059 Ga0495686_0053553
1060 Ga0495686_0064675
1061 Ga0495593_0022030
1062 Ga0495602_0089280
1063 Ga0496100_0020659
1064 Ga0496100_0049703
1065 Ga0496102_0110959
1066 Ga0496102_0149129
1067 Ga0496102_0166000
1068 Ga0496102_0206350
1069 Ga0496103_0006040
1070 Ga0496103_0013113
1071 Ga0496105_0007938
1072 Ga0496105_0072433
1073 Ga0496105_0114424
1074 Ga0496105_0267429
1075 Ga0496106_0002438
1076 Ga0496106_0005543
1077 Ga0496106_0030606
1078 Ga0496106_0069423
1079 Ga0496107_0040003
1080 Ga0496107_0115896
1081 Ga0496107_0124522
1082 Ga0496108_0005372
1083 Ga0496108_0021547
1084 Ga0496109_0001905
1085 Ga0496109_0081491
1086 Ga0496110_0012096
1087 Ga0496110_0015008
1088 Ga0496110_0167420
1089 Ga0496110_0343158
1090 Ga0496112_0002552
1091 Ga0496112_0009780
1092 Ga0496114_0130114
1093 Ga0496115_0014720
1094 Ga0496116_0046071
1095 Ga0496117_0019495
1096 Ga0496117_0122959
1097 Ga0496117_0164011
1098 Ga0496117_0184533
1099 Ga0496117_0203566
1100 Ga0496117_0291492
1101 Ga0496118_0006042
1102 Ga0496118_0040927
1103 Ga0496118_0042272
1104 Ga0496118_0063520
1105 Ga0496118_0233700
1106 Ga0496119_0052645
1107 Ga0496120_0030158
1108 Ga0496121_0000381
1109 Ga0496121_0000894
1110 Ga0496121_0022968
1111 Ga0496121_0025842
1112 Ga0496121_0045740
1113 Ga0496121_0096082
1114 Ga0496121_0154500
1115 Ga0496121_0257325
1116 Ga0496122_0075903
1117 Ga0496122_0105596
1118 Ga0496122_0191323
1119 Ga0496122_0234652
1120 Ga0496124_0125704
1121 Ga0496125_0000203
1122 Ga0496125_0008442
1123 Ga0496125_0061769
1124 Ga0496125_0062864
1125 Ga0496125_0065940
1126 Ga0496125_0066809
1127 Ga0496125_0115229
1128 Ga0496125_0156733
1129 Ga0496126_0003737
1130 Ga0496126_0031265
1131 Ga0496126_0033507
1132 Ga0496126_0058233
1133 Ga0496126_0072248
1134 Ga0496126_0158489
1135 Ga0496126_0181789
1136 Ga0496126_0232926
1137 Ga0496126_0240084
1138 Ga0496126_0296968
1139 Ga0495678_061814
1140 Ga0501033_0014949
1141 Ga0501034_0094551
1142 Ga0501034_0098319
1143 Ga0501034_0488180
1144 Ga0501037_0078046
1145 Ga0501038_0008323
1146 Ga0501038_0094169
1147 Ga0501038_0102461
1148 Ga0501043_0020301
1149 Ga0501043_0087651
1150 Ga0501043_0106403
1151 Ga0501043_0189138
1152 Ga0501047_0018314
1153 Ga0501047_0026863
1154 Ga0501047_0193360
1155 Ga0501067_0036259
1156 Ga0501070_0036466
1157 Ga0501070_0081744
1158 Ga0501070_0112302
1159 Ga0501070_0354661
1160 Ga0501073_0018379
1161 Ga0501074_0016566
1162 Ga0501079_0117553
1163 Ga0501080_0031335
1164 Ga0501080_0105685
1165 Ga0501035_0076300
1166 Ga0501035_0162387
1167 Ga0501044_0060011
1168 Ga0501044_0098629
1169 Ga0501044_0221329
1170 Ga0501044_0281870
1171 Ga0501044_0329678
1172 nmdc:mga03n38_40045_c1
1173 nmdc:mga00v17_168068_c1
1174 nmdc:mga0yw44_161474_c1
1175 nmdc:mga0yw44_169146_c1
1176 nmdc:mga0yw44_288523_c1
1177 nmdc:mga0k408_194564_c1
1178 nmdc:mga0k408_23356_c1
1179 nmdc:mga0k408_28176_c1
1180 nmdc:mga06z11_78529_c1
1181 nmdc:mga04h51_24029_c1
1182 nmdc:mga04h51_977_c1
1183 nmdc:mga07m45_121104_c1
1184 nmdc:mga07m45_170878_c1
1185 nmdc:mga0qj67_267_c1
1186 nmdc:mga0n895_291700_c1
1187 nmdc:mga0rr50_33962_c1
1188 nmdc:mga0sz30_37157_c1
1189 Ga0495601_0034782
1190 Ga0495601_0121914
1191 Ga0495612_0127891
1192 Ga0500635_0036306
1193 Ga0495655_0022058
1194 Ga0495595_0022452
1195 Ga0495619_0022381
1196 Ga0500643_000018
1197 Ga0500643_013312
1198 Ga0500581_037972
1199 Ga0500651_0021939
1200 Ga0500651_0116898
1201 Ga0500566_0018834
1202 Ga0500566_0040832
1203 Ga0500641_0013788
1204 Ga0500641_0116900
1205 Ga0500650_0016521
1206 Ga0500555_001894
1207 Ga0500556_0000778
1208 Ga0500556_0107433
1209 Ga0500557_000008
1210 Ga0500562_047754
1211 Ga0500569_000332
1212 Ga0500572_000927
1213 Ga0500572_023508
1214 Ga0500592_001472
1215 Ga0500592_002606
1216 Ga0500595_001022
1217 Ga0500595_004914
1218 Ga0500595_021071
1219 Ga0500607_007866
1220 Ga0500608_058663
1221 Ga0500608_136535
1222 Ga0500614_023246
1223 Ga0500618_007183
1224 Ga0500642_0000279
1225 Ga0500642_0000425
1226 Ga0500652_008162
1227 Ga0500658_0064369
1228 Ga0500559_0001443
1229 Ga0500559_0002465
1230 Ga0500559_0017531
1231 Ga0500568_0000833
1232 Ga0500568_0017296
1233 Ga0500573_0015044
1234 Ga0500577_0024782
1235 Ga0500586_028255
1236 Ga0500588_0100285
1237 Ga0500603_002201
1238 Ga0500604_0016112
1239 Ga0500616_0000180
1240 Ga0500616_0007514
1241 Ga0500622_0004447
1242 Ga0500622_0006536
1243 Ga0500627_0007880
1244 Ga0500627_0059483
1245 Ga0500639_013282
1246 Ga0500636_0001226
1247 Ga0500636_0085715
1248 Ga0500637_0005742
1249 Ga0500637_0020186
1250 Ga0500576_009965
1251 Ga0500552_000615
1252 Ga0500596_003569
1253 Ga0500601_000920
1254 2507510914
1255 2508544726
1256 2508697044
1257 2509147146
1258 2511394394
1259 2513623397
1260 2513637575
1261 2513649582
1262 2513700035
1263 2513719234
1264 2513874563
1265 2514015531
1266 2515625542
1267 2517100494
1268 2517894671
1269 2524437354
1270 2524534411
1271 2528849927
1272 2603861230
1273 2617350672
1274 2617377920
1275 2644287393
1276 2728747670
1277 2745076830
1278 2793066062
1279 2805916558
1280 2818238052
1281 2824606146
1282 2824616026
1283 2824618949
1284 2824627531
1285 2824638856
1286 2824647658
1287 2824657325
1288 2824668197
1289 2824675565
1290 2824682032
1291 2824692231
1292 2824698703
1293 2824706525
1294 2824716453
1295 2824726399
1296 2824736300
1297 2824751942
1298 2824756927
1299 2824769723
1300 2824778465
1301 2838127804
1302 2841943097
1303 2841956118
1304 2841960310
1305 2841968261
1306 2841976525
1307 2841987901
1308 2842042796
1309 2842050838
1310 2844317008
1311 2847938475
1312 2847944327
1313 2849081435
1314 2857512095
1315 2857530013
1316 2874597639
1317 2874615721
1318 2874623523
1319 2874630546
1320 2874649203
1321 2876774888
1322 2876822360
1323 2879077976
1324 2879088714
1325 2879102001
1326 2879132473
1327 2879145973
1328 2881370592
1329 2881667355
1330 2885367019
1331 2885416557
1332 2888381631
1333 2888388998
1334 2888422030
1335 2893071063
1336 2903734976
1337 2904667673
1338 2904719109
1339 2906604091
1340 2906611398
1341 2906632998
1342 2906648266
1343 2908782030
1344 2919077069
1345 2919452441
1346 2922371304
1347 2922393786
1348 2929619681
1349 2929627848
1350 2932786013
1351 2932798216
1352 2932804009
1353 2932817038
1354 2932822471
1355 2932831057
1356 2933581600
1357 2935612868
1358 2935624155
1359 2935632112
1360 2935640199
1361 2935654993
1362 2935663873
1363 2935666963
1364 2935680397
1365 2935690094
1366 2935699824
1367 2935704718
1368 2935722194
1369 2935731503
1370 2935735409
1371 2935745320
1372 2935755105
1373 2935762380
1374 2935775415
1375 2935780317
1376 2935790664
1377 2935799153
1378 2935803879
1379 2935811797
1380 2935824356
1381 2935829682
1382 2935842986
1383 2935852499
1384 2935862345
1385 2935870480
1386 2935881062
1387 2935884185
1388 2935912347
1389 2935923979
1390 2935929376
1391 2935936007
1392 2935949907
1393 2935957327
1394 2935962154
1395 2935968358
1396 2935976545
1397 2935988009
1398 2935993559
1399 2936004455
1400 2936018058
1401 2936026532
1402 2936035275
1403 2936038380
1404 2936053453
1405 2936059434
1406 2940561615
1407 2941508060
1408 2941515435
1409 2941523990
1410 2941533793
1411 2941544210
1412 3005485407
1413 3005507218
1414 3005594578
1415 3005596652
1416 3005712727
1417 3005719777
1418 8006933166
1419 8016516323
1420 8016523719
1421 8016537243
1422 8016541504
1423 8016551749
1424 8016560138
1425 8016566896
1426 8016579626
1427 8016589243
1428 8016598057
1429 8016604196
1430 8016620777
1431 8016629209
1432 8017060210
1433 8019536932
1434 8019548141
1435 8019579729
1436 8019587441
1437 8019614636
1438 8019625254
1439 8019636927
1440 8019642681
1441 8019649908
1442 8019664750
1443 8019674332
1444 8019681782
1445 8019693997
1446 8055749063
1447 8056695099
1448 8056969916

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08282

Hydrolase_3

haloacid dehalogenase-like hydrolase

198

270

0.87

PF12710

HAD

haloacid dehalogenase-like hydrolase

108

237

0.8

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

16

240

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nrw-assembly1.cif.gz_A the structure of a haloacid dehalogenase-like hydrolase from b. subtilis 0.9431 202 256
4bbj-assembly1.cif.gz_A copper-transporting pib-atpase in complex with beryllium fluoride representing the e2p state 0.8699 151 270
2yj4-assembly1.cif.gz_A conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding 0.8547 148 269
7si6-assembly1.cif.gz_A structure of atp7b in state 1 0.8515 151 270
7si3-assembly1.cif.gz_A consensus structure of atp7b 0.8508 151 270
ID Description Score Start End Superfamily
af_Q9UTA6_18_291_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9056 203 256 3.40.50.1000
af_Q2FWA2_5_277_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8865 203 259 3.40.50.1000
af_A0A1D6GSK2_41_144_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8756 222 253 3.40.50.1000
af_P0AGB0_183_315_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8626 131 267 3.40.50.1000
3m1yC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8564 85 265 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3D2UJY9-F1-model_v4 deleted 0.9777 155 267
AF-A0A2N2SD60-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9723 158 267 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A527FV55-F1-model_v4 deleted 0.9721 147 278
AF-A0A849IKB7-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9713 170 267 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A3B8Q769-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9708 181 267 GO:0000287
GO:0005737
GO:0006564
GO:0036424

Map