F477539

General Info

Members Datasets Scaffolds Average Seq Length
723 610 344 126

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8024501048|8024504520
Length 113
Sequence SIKIPGPDHPITVEHNPCRVVVTLGGRTIADSRDALTLREASLLQRTDHRTHCPYKGDAAYYSIIPGGERAENAVWTYEVPNAAVSNIKGHLAFYPDRVDSIEEMASPEAGTF

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
10 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
14 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
15 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
18 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
21 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
22 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
23 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
24 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
25 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
26 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
27 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
28 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
29 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
30 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
31 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
32 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
33 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
34 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
35 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
36 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
37 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
38 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
39 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
40 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
41 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
42 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
43 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
44 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
45 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
46 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
47 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
48 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
51 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
52 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
53 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
54 2643221557 Ensifer sp. Root558 Isolate Unclassified
55 2643221599 Rhizobium sp. Root708 Isolate Unclassified
56 2643221610 Ensifer sp. Root74 Isolate Unclassified
57 2643221668 Ensifer sp. Root423 Isolate Unclassified
58 2643221675 Ensifer sp. Root1298 Isolate Unclassified
59 2643221680 Ensifer sp. Root1312 Isolate Unclassified
60 2643221723 Ensifer sp. Root278 Isolate Unclassified
61 2643221726 Ensifer sp. Root954 Isolate Unclassified
62 2718217882 Rhizobium sp. N741 Isolate Nodule
63 2718217927 Rhizobium sp. N324 Isolate Nodule
64 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
65 2718218009 Rhizobium sp. N561 Isolate Nodule
66 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
67 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
68 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
69 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
70 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
71 2718218363 Rhizobium sp. N113 Isolate Nodule
72 2718218365 Rhizobium sp. N731 Isolate Nodule
73 2718218366 Rhizobium sp. N621 Isolate Nodule
74 2718218423 Rhizobium sp. N941 Isolate Nodule
75 2721755514 Rhizobium sp. N6212 Isolate Nodule
76 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
77 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
78 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
79 2721755809 Rhizobium sp. N541 Isolate Nodule
80 2721755810 Rhizobium sp. N871 Isolate Nodule
81 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
82 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
83 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
84 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
85 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
86 2728369365 Rhizobium sp. N1341 Isolate Nodule
87 2728369397 Rhizobium sp. N1314 Isolate Nodule
88 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
89 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
90 2791355256 Rhizobium sp. M10 Isolate Nodule
91 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
92 2791355260 Rhizobium sp. L9 Isolate Nodule
93 2791355261 Rhizobium sp. J15 Isolate Nodule
94 2791355262 Rhizobium sp. M1 Isolate Nodule
95 2791355264 Rhizobium sp. S9 Isolate Nodule
96 2791355265 Rhizobium sp. H4 Isolate Nodule
97 2791355266 Rhizobium sp. L43 Isolate Nodule
98 2791355267 Rhizobium sp. L18 Isolate Nodule
99 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
100 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
101 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
102 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
103 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
104 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
105 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
106 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
107 2802429633 Rhizobium anhuiense J3 Isolate Nodule
108 2802429634 Rhizobium anhuiense S10 Isolate Nodule
109 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
110 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
111 2802429637 Rhizobium anhuiense C15 Isolate Nodule
112 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
113 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
114 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
115 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
116 2838048938 Rhizobium pisi 27/80 Isolate Nodule
117 2838061910 Rhizobium phaseoli L15 Isolate Nodule
118 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
119 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
120 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
121 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
122 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
123 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
124 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
125 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
126 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
127 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
128 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
129 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
130 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
131 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
132 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
133 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
134 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
135 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
136 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
137 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
138 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
139 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
140 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
141 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
142 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
143 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
144 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
145 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
146 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
147 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
148 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
149 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
150 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
151 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
152 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
153 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
154 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
155 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
156 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
157 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
158 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
159 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
160 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
161 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
162 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
163 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
164 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
165 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
166 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
167 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
168 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
169 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
170 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
171 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
172 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
173 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
174 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
175 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
176 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
177 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
178 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
179 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
180 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
181 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
182 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
183 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
184 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
185 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
186 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
187 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
188 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
189 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
190 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
191 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
192 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
193 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
194 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
195 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
196 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
197 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
198 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
199 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
200 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
201 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
202 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
203 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
204 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
205 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
206 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
207 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
208 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
209 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
210 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
211 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
212 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
213 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
214 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
215 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
216 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
217 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
218 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
219 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
220 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
221 2933599457 Rhizobium phaseoli M3 Isolate Nodule
222 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
223 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
224 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
225 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
226 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
227 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
228 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
229 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
230 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
231 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
232 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
233 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
234 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
235 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
236 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
237 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
238 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
239 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
240 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
241 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
242 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
243 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
244 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
245 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
246 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
247 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
248 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
249 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
250 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
251 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
252 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
253 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
254 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
255 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
256 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
257 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
258 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
259 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
260 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
261 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
262 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
263 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
264 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
265 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
266 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
267 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
268 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
269 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
270 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
271 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
272 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
273 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
274 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
275 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
276 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
277 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
278 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
279 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
280 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
281 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
282 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
283 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
284 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
285 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
286 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
287 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
288 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
289 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
290 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
291 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
292 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
293 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
294 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
295 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
296 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
297 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
298 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
299 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
300 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
301 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
302 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
303 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
304 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
305 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
306 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
307 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
308 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
309 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
310 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
311 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
312 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
313 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
314 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
315 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
316 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
317 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
318 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
319 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
320 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
321 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
322 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
323 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
324 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
325 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
326 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
327 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
328 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
329 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
330 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
331 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
332 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
333 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
334 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
335 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
336 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
337 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
338 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
339 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
340 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
341 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
342 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
343 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
344 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
345 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
346 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
347 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
348 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
349 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
350 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
351 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
352 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
353 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
354 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
355 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
356 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
357 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
358 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
359 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
360 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
361 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
362 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
363 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
364 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
365 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
366 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
367 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
368 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
369 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
370 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
371 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
372 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
373 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
374 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
375 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
376 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
377 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
378 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
379 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
380 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
381 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
382 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
383 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
384 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
385 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
386 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
387 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
388 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
389 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
390 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
391 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
392 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
393 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
394 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
395 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
396 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
397 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
398 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
399 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
400 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
401 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
402 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
403 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
404 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
405 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
406 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
407 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
408 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
409 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
410 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
411 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
412 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
413 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
414 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
415 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
416 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
417 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
418 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
419 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
420 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
421 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
422 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
423 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
424 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
425 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
426 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
428 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
429 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
430 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
432 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
433 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
450 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
451 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
452 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
454 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
455 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
456 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
457 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
458 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
459 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
460 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
461 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
462 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
463 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
464 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
465 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
466 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
467 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
468 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
469 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
470 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
471 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
472 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
473 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
474 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
475 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
476 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
477 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
478 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
479 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
480 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
481 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
482 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
483 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
484 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
485 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
486 3300041500 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaT Metatranscriptome Unclassified
487 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
488 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
489 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
490 3300041504 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaT Metatranscriptome Unclassified
491 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
492 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
493 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
494 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
495 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
496 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
497 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
498 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
499 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
500 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
501 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
502 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
503 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
504 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
505 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
506 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
507 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
508 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
509 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
510 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
511 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
512 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
513 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
514 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
515 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
516 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
517 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
518 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
519 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
520 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
521 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
522 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
523 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
524 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
525 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
526 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
527 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
528 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
529 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
530 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
531 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
532 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
533 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
534 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
535 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
536 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
537 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
538 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
539 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
540 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
541 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
542 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
543 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
544 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
545 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
546 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
547 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
548 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
549 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
550 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
551 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
552 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
553 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
554 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
555 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
556 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
557 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
558 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
559 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
560 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
561 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
562 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
563 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
564 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
565 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
566 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
567 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
568 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
569 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
570 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
571 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
572 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
573 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
574 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
575 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
576 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
577 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
578 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
579 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
580 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
581 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
582 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
583 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
585 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
586 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
587 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
588 8005275841 Rhizobium sp. N4311 Isolate Nodule
589 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
590 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
591 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
592 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
593 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
594 8005382845 Rhizobium sp. R634 Isolate Nodule
595 8005395548 Rhizobium sp. R339 Isolate Nodule
596 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
597 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
598 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
599 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
600 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
601 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
602 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
603 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
604 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
605 8018176218 Rhizobium sp. N122 Isolate Nodule
606 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
607 8024501048 Rhizobium sp. H4 Isolate Nodule
608 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
609 8056382006 Rhizobium croatiense 13T Isolate Nodule
610 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.33
Metatranscriptomes 1.24
Isolates 52.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.43
Nodule 50.48
Rhizoplane 4.15
Rhizosphere 17.7
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10228434 3300001990 Bacteria 549
2 JGI24735J21928_10000112 3300002067 Bacteria 29556
3 JGI24738J21930_10085541 3300002075 Bacteria 663
4 JGI25158J39367_1003557 3300002739 Bacteria 2394
5 JGI25152J39213_1022971 3300002773 Bacteria 1069
6 JGI25152J39213_1024815 3300002773 Bacteria 1001
7 JGI25150J39212_1037030 3300002774 Bacteria 645
8 JGI25159J45721_1000005 3300002987 Bacteria 214315
9 JGI25151J46595_10002195 3300003187 Bacteria 12080
10 JGI25151J46595_10007863 3300003187 Bacteria 5180
11 JGI25151J46595_10013315 3300003187 Bacteria 3706
12 JGI25153J46596_10003219 3300003215 Bacteria 9174
13 rootL2_10157544 3300003322 Bacteria 3758
14 JGI25160J50197_1000005 3300003354 Bacteria 417280
15 JGI25160J50197_1001364 3300003354 Bacteria 12298
16 JGI25160J50197_1032310 3300003354 Bacteria 1332
17 JGI25161J50226_1001207 3300003374 Bacteria 8456
18 JGI25161J50226_1007029 3300003374 Bacteria 1952
19 Ga0055526_1002019 3300003771 Bacteria 13965
20 Ga0055526_1002391 3300003771 Bacteria 12714
21 Ga0055526_1007448 3300003771 Bacteria 5683
22 Ga0055526_1071970 3300003771 Bacteria 698
23 Ga0055524_1002000 3300003775 Bacteria 10889
24 Ga0055524_1009423 3300003775 Bacteria 3971
25 Ga0055524_1021453 3300003775 Bacteria 2140
26 Ga0055524_1022349 3300003775 Bacteria 2069
27 Ga0055524_1023323 3300003775 Bacteria 1996
28 Ga0055536_1006614 3300003781 Bacteria 5346
29 Ga0055536_1026976 3300003781 Bacteria 1599
30 Ga0055528_1000193 3300003790 Bacteria 51831
31 Ga0055528_1015491 3300003790 Bacteria 2752
32 Ga0055528_1026719 3300003790 Bacteria 1648
33 Ga0055528_1029764 3300003790 Bacteria 1467
34 Ga0055540_1000293 3300003792 Bacteria 44565
35 Ga0055531_10006560 3300003794 Bacteria 6577
36 Ga0055531_10009964 3300003794 Bacteria 4792
37 Ga0055543_1000175 3300004625 Bacteria 53715
38 Ga0055543_1001092 3300004625 Bacteria 11814
39 Ga0065165_1000002 3300005262 Bacteria 444192
40 Ga0065165_1019402 3300005262 Bacteria 2429
41 Ga0070658_10993442 3300005327 Bacteria 730
42 Ga0070658_11701338 3300005327 Unclassified 546
43 Ga0070670_100837046 3300005331 Bacteria 832
44 Ga0070666_10464235 3300005335 Unclassified 915
45 Ga0070668_102239249 3300005347 Bacteria 505
46 Ga0070675_100967657 3300005354 Bacteria 781
47 Ga0070671_100021234 3300005355 Bacteria 5303
48 Ga0070713_100350218 3300005436 Bacteria 1370
49 Ga0070711_100093608 3300005439 Bacteria 2170
50 Ga0070711_100829253 3300005439 Bacteria 786
51 Ga0070663_102095408 3300005455 Bacteria 510
52 Ga0070678_100107491 3300005456 Bacteria 2176
53 Ga0070685_10000502 3300005466 Bacteria 22579
54 Ga0070665_100773131 3300005548 Bacteria 973
55 Ga0070665_101176417 3300005548 Bacteria 778
56 Ga0068852_100734450 3300005616 Bacteria 999
57 Ga0068864_100013301 3300005618 Bacteria 6815
58 Ga0075365_10016689 3300006038 Bacteria 4474
59 Ga0075368_10022317 3300006042 Bacteria 2409
60 Ga0075363_100227726 3300006048 Bacteria 1070
61 Ga0075364_10435951 3300006051 Bacteria 895
62 Ga0070712_100098532 3300006175 Bacteria 2156
63 Ga0075362_10011274 3300006177 Bacteria 3517
64 Ga0075367_10018190 3300006178 Bacteria 3873
65 Ga0075367_10208756 3300006178 Bacteria 1221
66 Ga0075369_10007739 3300006186 Bacteria 4107
67 Ga0075366_10314909 3300006195 Bacteria 958
68 Ga0075370_10022110 3300006353 Bacteria 3489
69 Ga0075370_10292148 3300006353 Bacteria 969
70 Ga0075370_10444430 3300006353 Bacteria 780
71 Ga0075370_10486161 3300006353 Bacteria 744
72 Ga0079104_1002809 3300006946 Bacteria 8765
73 Ga0099794_10801292 3300007265 Bacteria 504
74 Ga0099795_10159571 3300007788 Bacteria 929
75 Ga0105251_10000157 3300009011 Bacteria 69461
76 Ga0105240_10006517 3300009093 Bacteria 17137
77 Ga0105237_10249246 3300009545 Bacteria 1778
78 Ga0105238_10003745 3300009551 Bacteria 15117
79 Ga0105238_10165069 3300009551 Bacteria 2190
80 Ga0123341_1007449 3300009765 Bacteria 9975
81 Ga0123342_1039178 3300009766 Bacteria 1814
82 Ga0099796_10149368 3300010159 Bacteria 919
83 Ga0105239_10007296 3300010375 Bacteria 12693
84 Ga0157369_10559518 3300013105 Bacteria 1182
85 Ga0171463_1002 3300013249 Bacteria 1274851
86 Ga0157374_10212166 3300013296 Unclassified 1898
87 Ga0163162_10337013 3300013306 Bacteria 1641
88 Ga0163162_10783131 3300013306 Bacteria 1072
89 Ga0163162_12933944 3300013306 Unclassified 548
90 Ga0157372_10095179 3300013307 Bacteria 3393
91 Ga0157376_10842135 3300014969 Bacteria 932
92 Ga0183363_1023 3300015690 Bacteria 55133
93 Ga0214542_1019610 3300021321 Bacteria 5255
94 Ga0214543_1000012 3300021327 Bacteria 338982
95 Ga0213876_10231270 3300021384 Bacteria 983
96 Ga0213875_10004158 3300021388 Bacteria 8017
97 Ga0228711_1025331 3300022739 Bacteria 4013
98 Ga0228711_1028169 3300022739 Bacteria 3293
99 Ga0228710_1007199 3300022740 Bacteria 16543
100 Ga0209436_101014 3300025208 Bacteria 10762
101 Ga0207425_1005869 3300025245 Bacteria 3436
102 Ga0209129_1000348 3300025258 Bacteria 39224
103 Ga0209129_1001467 3300025258 Bacteria 13113
104 Ga0209129_1029929 3300025258 Bacteria 914
105 Ga0209673_1000010 3300025273 Bacteria 596656
106 Ga0209673_1000025 3300025273 Bacteria 404572
107 Ga0209673_1001435 3300025273 Bacteria 22697
108 Ga0209673_1004596 3300025273 Bacteria 7319
109 Ga0209673_1011399 3300025273 Bacteria 3670
110 Ga0209130_1000010 3300025284 Bacteria 444920
111 Ga0209676_1000093 3300025292 Bacteria 250231
112 Ga0209676_1006657 3300025292 Bacteria 5636
113 Ga0209676_1014879 3300025292 Bacteria 2897
114 Ga0209676_1064184 3300025292 Bacteria 900
115 Ga0209676_1103557 3300025292 Bacteria 601
116 Ga0209025_1000459 3300025294 Bacteria 79660
117 Ga0209025_1002036 3300025294 Bacteria 23065
118 Ga0209025_1002049 3300025294 Bacteria 22963
119 Ga0209025_1075280 3300025294 Bacteria 1175
120 Ga0209025_1082169 3300025294 Bacteria 1089
121 Ga0209564_1000025 3300025295 Bacteria 520535
122 Ga0209564_1000618 3300025295 Bacteria 54453
123 Ga0209564_1005421 3300025295 Bacteria 7300
124 Ga0209564_1007171 3300025295 Bacteria 5810
125 Ga0209758_1001930 3300025297 Bacteria 22532
126 Ga0209758_1002703 3300025297 Bacteria 17489
127 Ga0209758_1039615 3300025297 Bacteria 1790
128 Ga0209050_1003463 3300025298 Bacteria 11602
129 Ga0209050_1010478 3300025298 Bacteria 4561
130 Ga0209050_1023688 3300025298 Bacteria 2150
131 Ga0209256_1000342 3300025299 Bacteria 76053
132 Ga0209256_1000561 3300025299 Bacteria 53094
133 Ga0209256_1001944 3300025299 Bacteria 18788
134 Ga0209256_1005420 3300025299 Bacteria 7366
135 Ga0209256_1025557 3300025299 Bacteria 1717
136 Ga0209256_1041324 3300025299 Bacteria 1172
137 Ga0207426_1000036 3300025302 Bacteria 444920
138 Ga0207426_1000218 3300025302 Bacteria 135865
139 Ga0207426_1004157 3300025302 Bacteria 7237
140 Ga0209051_1000097 3300025303 Bacteria 167378
141 Ga0209051_1012827 3300025303 Bacteria 4031
142 Ga0209051_1038041 3300025303 Bacteria 1756
143 Ga0209257_1000200 3300025304 Bacteria 147538
144 Ga0209257_1003354 3300025304 Bacteria 13858
145 Ga0209257_1003539 3300025304 Bacteria 13281
146 Ga0207647_10030195 3300025904 Bacteria 3499
147 Ga0207705_10869450 3300025909 Bacteria 699
148 Ga0207695_10000418 3300025913 Bacteria 94702
149 Ga0207671_10104364 3300025914 Bacteria 2150
150 Ga0207663_10108607 3300025916 Bacteria 1879
151 Ga0207694_10000646 3300025924 Bacteria 31421
152 Ga0207694_10173433 3300025924 Bacteria 1747
153 Ga0207644_10102509 3300025931 Bacteria 2152
154 Ga0207711_10009529 3300025941 Bacteria 8100
155 Ga0207668_10345332 3300025972 Bacteria 1243
156 Ga0207678_11627912 3300026067 Bacteria 568
157 Ga0207641_10356731 3300026088 Bacteria 1395
158 Ga0207648_10777698 3300026089 Unclassified 890
159 Ga0207683_10450205 3300026121 Bacteria 1187
160 Ga0207698_10856128 3300026142 Bacteria 914
161 Ga0209281_1000087 3300027111 Bacteria 246142
162 Ga0209281_1000188 3300027111 Bacteria 141823
163 Ga0209282_1000008 3300027666 Bacteria 248526
164 Ga0209813_10035128 3300027866 Bacteria 1499
165 Ga0268266_10673529 3300028379 Bacteria 996
166 Ga0307511_10001559 3300030521 Bacteria 24304
167 Ga0265328_10019487 3300031239 Bacteria 2605
168 Ga0265331_10000009 3300031250 Bacteria 314950
169 Ga0265331_10005418 3300031250 Bacteria 7706
170 Ga0265331_10028104 3300031250 Bacteria 2814
171 Ga0265327_10000776 3300031251 Bacteria 49288
172 Ga0265327_10006581 3300031251 Bacteria 9235
173 Ga0307509_10732830 3300031507 Bacteria 654
174 Ga0307408_100272501 3300031548 Bacteria 1406
175 Ga0265314_10009172 3300031711 Bacteria 8392
176 Ga0315914_1004687 3300031967 Bacteria 20341
177 Ga0307411_11730094 3300032005 Bacteria 579
178 Ga0315913_1002699 3300033430 Bacteria 21030
179 Ga0315915_1000009 3300033464 Bacteria 252178
180 Ga0315915_1018884 3300033464 Bacteria 6018
181 Ga0373937_0406937 3300036401 Bacteria 1291
182 Ga0436364_1497633 3300037853 Bacteria 14473
183 Ga0395901_0790237 3300038443 Bacteria 939
184 Ga0436365_0937741 3300039437 Bacteria 2273
185 Ga0436360_0012437 3300039438 Unclassified 595
186 Ga0436361_0265461 3300039447 Bacteria 3239
187 Ga0436363_0238267 3300039450 Bacteria 923
188 Ga0439436_0070567 3300041404 Bacteria 974
189 Ga0439436_0215240 3300041404 Bacteria 552
190 Ga0439461_0218792 3300041410 Bacteria 518
191 Ga0439465_0004579 3300041413 Bacteria 4463
192 Ga0439465_0239510 3300041413 Bacteria 669
193 Ga0439465_0365387 3300041413 Bacteria 546
194 Ga0451787_351301 3300041441 Bacteria 2888
195 Ga0451789_1201109 3300041443 Bacteria 1051
196 Ga0451797_0204869 3300041453 Bacteria 735
197 Ga0451795_0323099 3300041456 Bacteria 560
198 Ga0451795_0410131 3300041456 Bacteria 787
199 Ga0451798_0423063 3300041458 Bacteria 1285
200 Ga0451800_1170929 3300041459 Bacteria 1393
201 Ga0451802_0402245 3300041460 Bacteria 961
202 Ga0451833_0408963 3300041491 Bacteria 3172
203 Ga0451835_0110663 3300041492 Bacteria 3526
204 Ga0451839_1572218 3300041496 Bacteria 3517
205 Ga0451840_09573 3300041497 Bacteria 556
206 Ga0451841_0854225 3300041498 Bacteria 774
207 Ga0451841_0887259 3300041498 Bacteria 1270
208 Ga0451844_23037 3300041500 Bacteria 688
209 Ga0451845_0594539 3300041501 Bacteria 6643
210 Ga0451845_0834058 3300041501 Bacteria 995
211 Ga0451846_33112 3300041502 Bacteria 894
212 Ga0451847_0727637 3300041503 Bacteria 1286
213 Ga0451848_12133 3300041504 Bacteria 668
214 Ga0451849_0011697 3300041505 Bacteria 1347
215 Ga0451850_23357 3300041506 Bacteria 927
216 Ga0451851_1089516 3300041507 Bacteria 3721
217 Ga0451854_10243 3300041510 Bacteria 644
218 Ga0451853_2330629 3300041512 Bacteria 1790
219 Ga0452268_25436 3300041907 Bacteria 1234
220 Ga0452271_24104 3300041916 Bacteria 1039
221 Ga0439432_116185 3300042006 Bacteria 794
222 Ga0439449_0011618 3300042007 Bacteria 3312
223 Ga0439449_0062378 3300042007 Bacteria 1375
224 Ga0439452_078932 3300042010 Bacteria 719
225 Ga0495617_211745 3300046452 Bacteria 604
226 Ga0495592_0166545 3300046454 Bacteria 1512
227 Ga0495590_0006558 3300046457 Bacteria 4539
228 Ga0495629_0407740 3300046459 Bacteria 923
229 Ga0495638_0005482 3300046460 Bacteria 9433
230 Ga0495662_0058166 3300046476 Bacteria 1867
231 Ga0495585_0086222 3300046492 Bacteria 1696
232 Ga0495596_0056361 3300046500 Bacteria 1535
233 Ga0495596_0119979 3300046500 Bacteria 1021
234 Ga0495607_0192980 3300046501 Bacteria 1013
235 Ga0495606_0003502 3300046507 Bacteria 16624
236 Ga0495606_0035499 3300046507 Bacteria 3407
237 Ga0495606_0227755 3300046507 Bacteria 1046
238 Ga0495606_0643868 3300046507 Bacteria 514
239 Ga0495610_0048151 3300046512 Bacteria 2093
240 Ga0495616_0000286 3300046513 Bacteria 40792
241 Ga0495616_0147595 3300046513 Bacteria 1066
242 Ga0495620_0015820 3300046515 Bacteria 3799
243 Ga0495631_0047769 3300046518 Bacteria 1878
244 Ga0495643_0008506 3300046522 Bacteria 6488
245 Ga0495648_0212103 3300046524 Bacteria 961
246 Ga0495587_0076635 3300046536 Bacteria 1942
247 Ga0495597_0055847 3300046542 Bacteria 1731
248 Ga0495597_0136917 3300046542 Bacteria 1012
249 Ga0495633_0020623 3300046558 Bacteria 3311
250 Ga0495611_0447683 3300046648 Bacteria 589
251 Ga0495625_0015924 3300046660 Bacteria 5932
252 Ga0495625_0229003 3300046660 Bacteria 1214
253 Ga0495659_0145654 3300046664 Bacteria 948
254 Ga0495661_0192528 3300046665 Bacteria 1073
255 Ga0495671_0039546 3300046692 Bacteria 2381
256 Ga0495604_0016100 3300047317 Bacteria 5972
257 Ga0495636_0000702 3300047318 Bacteria 12217
258 Ga0495636_0019474 3300047318 Bacteria 2729
259 Ga0495683_0002414 3300047323 Bacteria 11305
260 Ga0495683_0105763 3300047323 Bacteria 1349
261 Ga0495687_088925 3300047443 Bacteria 1188
262 Ga0495679_037614 3300047446 Bacteria 1521
263 Ga0495685_044280 3300047447 Bacteria 1518
264 Ga0495686_0012743 3300047472 Bacteria 5867
265 Ga0495686_0118120 3300047472 Bacteria 1583
266 Ga0495626_0101471 3300048091 Bacteria 1254
267 Ga0496100_0003583 3300048903 Bacteria 8113
268 Ga0496100_0357908 3300048903 Bacteria 1104
269 Ga0496101_0149517 3300048904 Bacteria 1785
270 Ga0496102_0373668 3300048905 Bacteria 1341
271 Ga0496103_0004586 3300048906 Bacteria 8366
272 Ga0496103_0017369 3300048906 Bacteria 4306
273 Ga0496104_0121231 3300048907 Bacteria 2510
274 Ga0496104_1532678 3300048907 Bacteria 569
275 Ga0496106_0012804 3300048909 Bacteria 6193
276 Ga0496106_0243145 3300048909 Bacteria 1438
277 Ga0496107_0002844 3300048910 Bacteria 11435
278 Ga0496107_0676852 3300048910 Bacteria 760
279 Ga0496109_0124307 3300048912 Bacteria 2405
280 Ga0496110_0006043 3300048913 Bacteria 9541
281 Ga0496111_0001680 3300048914 Bacteria 12890
282 Ga0496112_0007912 3300048915 Bacteria 9469
283 Ga0496112_0014139 3300048915 Bacteria 7393
284 Ga0496113_0021663 3300048916 Bacteria 4536
285 Ga0496113_0022649 3300048916 Bacteria 4448
286 Ga0496114_0915911 3300048917 Bacteria 758
287 Ga0496115_0000002 3300048918 Bacteria 365286
288 Ga0496116_0011367 3300048919 Bacteria 7379
289 Ga0496116_0104306 3300048919 Bacteria 1685
290 Ga0496117_0028436 3300048920 Bacteria 4329
291 Ga0496117_0028637 3300048920 Bacteria 4311
292 Ga0496117_0170439 3300048920 Bacteria 1264
293 Ga0496118_0003734 3300048921 Bacteria 18843
294 Ga0496118_0008298 3300048921 Bacteria 10760
295 Ga0496118_0029209 3300048921 Bacteria 4628
296 Ga0496118_0095486 3300048921 Bacteria 2029
297 Ga0496119_0148053 3300048922 Bacteria 1261
298 Ga0496121_0004293 3300048924 Bacteria 19319
299 Ga0496121_0015344 3300048924 Bacteria 8036
300 Ga0496121_0035981 3300048924 Bacteria 4422
301 Ga0496122_0000559 3300048925 Bacteria 76330
302 Ga0496122_0029336 3300048925 Bacteria 4642
303 Ga0496123_0000435 3300048926 Bacteria 75306
304 Ga0496123_0011378 3300048926 Bacteria 7719
305 Ga0496123_0103107 3300048926 Bacteria 1654
306 Ga0496124_0090024 3300048927 Bacteria 2504
307 Ga0496124_0175711 3300048927 Bacteria 1653
308 Ga0496125_0009320 3300048928 Bacteria 10120
309 Ga0496126_0000052 3300048929 Bacteria 312383
310 Ga0496126_0223499 3300048929 Bacteria 1580
311 Ga0496126_1265338 3300048929 Bacteria 539
312 Ga0495678_184219 3300049459 Bacteria 653
313 Ga0501241_047674 3300049758 Bacteria 841
314 nmdc:mga03683_5110_c1 3300050489 Bacteria 4406
315 nmdc:mga03n38_194719_c1 3300050490 Bacteria 1046
316 nmdc:mga0yw44_47653_c1 3300050492 Bacteria 2581
317 nmdc:mga0k408_13752_c1 3300050493 Bacteria 4445
318 nmdc:mga0k408_429503_c1 3300050493 Bacteria 785
319 nmdc:mga06z11_24810_c1 3300050494 Bacteria 2834
320 nmdc:mga04h51_41425_c1 3300050495 Bacteria 1505
321 nmdc:mga07m45_24722_c1 3300050496 Bacteria 2541
322 nmdc:mga07m45_271202_c1 3300050496 Bacteria 987
323 nmdc:mga07m45_35909_c1 3300050496 Bacteria 2758
324 nmdc:mga0sz30_9160_c1 3300050516 Bacteria 3757
325 Ga0500578_0376034 3300053086 Bacteria 824
326 Ga0500644_0072465 3300053088 Bacteria 1245
327 Ga0500646_0001480 3300053090 Bacteria 6190
328 Ga0500583_0021150 3300053092 Bacteria 2700
329 Ga0500555_006129 3300053103 Bacteria 3416
330 Ga0500594_0041149 3300053118 Bacteria 1265
331 Ga0500608_197576 3300053122 Bacteria 835
332 Ga0500614_032025 3300053123 Bacteria 1292
333 Ga0500628_020736 3300053129 Bacteria 1325
334 Ga0500658_0001117 3300053134 Bacteria 10985
335 Ga0500568_0024118 3300053139 Bacteria 2578
336 Ga0500604_0000890 3300053151 Bacteria 8257
337 Ga0500616_0000421 3300053153 Bacteria 56739
338 Ga0500616_0013504 3300053153 Bacteria 4739
339 Ga0500616_0235604 3300053153 Bacteria 790
340 Ga0500616_0304105 3300053153 Bacteria 661
341 Ga0500622_0162373 3300053156 Bacteria 1046
342 Ga0500633_0000143 3300053160 Bacteria 9436
343 Ga0500609_023687 3300053731 Bacteria 841
344 Ga0587107_098450 3300059652 Bacteria 575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8024501048 8024504520 107
2 3300005331 Ga0070670_100837046 Ga0070670_1008370461 112
3 3300048925 Ga0496122_0000559 Ga0496122_0000559_33370_33753 112
4 3300048926 Ga0496123_0000435 Ga0496123_0000435_41550_41933 112
5 3300048927 Ga0496124_0090024 Ga0496124_0090024_1982_2365 112
6 3300005327 Ga0070658_11701338 Ga0070658_117013381 115
7 3300005436 Ga0070713_100350218 Ga0070713_1003502183 116
8 3300005355 Ga0070671_100021234 Ga0070671_1000212347 120
9 3300005618 Ga0068864_100013301 Ga0068864_10001330110 120
10 3300025931 Ga0207644_10102509 Ga0207644_101025092 120
11 3300025941 Ga0207711_10009529 Ga0207711_100095294 120
12 3300026088 Ga0207641_10356731 Ga0207641_103567311 120
13 3300046507 Ga0495606_0643868 Ga0495606_0643868_117_482 120
14 3300048907 Ga0496104_0121231 Ga0496104_0121231_762_1124 120
15 3300048912 Ga0496109_0124307 Ga0496109_0124307_1247_1609 120
16 3300048915 Ga0496112_0007912 Ga0496112_0007912_6836_7198 120
17 3300048916 Ga0496113_0022649 Ga0496113_0022649_3390_3752 120
18 iso_pu_bacteria 2508501122 2509110687 120
19 iso_pu_bacteria 2510065057 2510303901 120
20 iso_pu_bacteria 2511231052 2511497973 120
21 iso_pu_bacteria 2512047086 2512529133 120
22 iso_pu_bacteria 2513237086 2513583738 120
23 iso_pu_bacteria 2513237089 2513604851 120
24 iso_pu_bacteria 2513237091 2513617260 120
25 iso_pu_bacteria 2513237140 2513882503 120
26 iso_pu_bacteria 2513237143 2513904062 120
27 iso_pu_bacteria 2513237156 2513988483 120
28 iso_pu_bacteria 2513237160 2514006562 120
29 iso_pu_bacteria 2515154107 2515612531 120
30 iso_pu_bacteria 2516653046 2516896382 120
31 iso_pu_bacteria 2517487022 2517565823 120
32 iso_pu_bacteria 2524023207 2524449810 120
33 iso_pu_bacteria 2551306084 2551676140 120
34 iso_pu_bacteria 2551306085 2551685607 120
35 iso_pu_bacteria 2551306086 2551691664 120
36 iso_pu_bacteria 2551306087 2551697505 120
37 iso_pu_bacteria 2551306089 2551710015 120
38 iso_pu_bacteria 2551306090 2551721146 120
39 iso_pu_bacteria 2551306091 2551730151 120
40 iso_pu_bacteria 2551306092 2551732324 120
41 iso_pu_bacteria 2551306093 2551739871 120
42 iso_pu_bacteria 2558860100 2558865041 120
43 iso_pu_bacteria 2802428858 2802721438 120
44 iso_pu_bacteria 2802428859 2802726708 120
45 iso_pu_bacteria 2802428860 2802732548 120
46 iso_pu_bacteria 2802428861 2802741336 120
47 iso_pu_bacteria 2802428862 2802747090 120
48 iso_pu_bacteria 2802428863 2802748854 120
49 iso_pu_bacteria 2838074704 2838077892 120
50 iso_pu_bacteria 2855825444 2855828793 120
51 iso_pu_bacteria 2855839649 2855843917 120
52 iso_pu_bacteria 2858800743 2858806841 120
53 iso_pu_bacteria 2896384573 2896388461 120
54 iso_pu_bacteria 2915980308 2915985642 120
55 iso_pu_bacteria 2915986958 2915993431 120
56 iso_pu_bacteria 2915993759 2915999305 120
57 iso_pu_bacteria 2916000859 2916002929 120
58 iso_pu_bacteria 2916014648 2916020712 120
59 iso_pu_bacteria 2916021584 2916027060 120
60 iso_pu_bacteria 2916028427 2916031583 120
61 iso_pu_bacteria 2916035215 2916036207 120
62 iso_pu_bacteria 2916041962 2916044189 120
63 iso_pu_bacteria 2916048683 2916052140 120
64 iso_pu_bacteria 2916055098 2916061347 120
65 iso_pu_bacteria 2916061851 2916064445 120
66 iso_pu_bacteria 2916068649 2916070299 120
67 iso_pu_bacteria 2916076590 2916081412 120
68 iso_pu_bacteria 2920760137 2920764889 120
69 iso_pu_bacteria 2921201388 2921206736 120
70 iso_pu_bacteria 2921208531 2921211597 120
71 iso_pu_bacteria 2921237296 2921238700 120
72 iso_pu_bacteria 2921244191 2921245544 120
73 iso_pu_bacteria 2921250672 2921251961 120
74 iso_pu_bacteria 2921257292 2921262352 120
75 iso_pu_bacteria 2921263974 2921267729 120
76 iso_pu_bacteria 2921282425 2921282544 120
77 iso_pu_bacteria 2921289301 2921289408 120
78 iso_pu_bacteria 2921296804 2921300617 120
79 iso_pu_bacteria 2924144063 2924145812 120
80 iso_pu_bacteria 2924150972 2924152658 120
81 iso_pu_bacteria 2924158325 2924159552 120
82 iso_pu_bacteria 2924165586 2924170090 120
83 iso_pu_bacteria 2924172951 2924178038 120
84 iso_pu_bacteria 2924179722 2924180150 120
85 iso_pu_bacteria 2924186466 2924190682 120
86 iso_pu_bacteria 2924193448 2924199432 120
87 iso_pu_bacteria 2924200457 2924205205 120
88 iso_pu_bacteria 2924207177 2924208297 120
89 iso_pu_bacteria 2924214083 2924215311 120
90 iso_pu_bacteria 2924221636 2924225319 120
91 iso_pu_bacteria 2924228884 2924229246 120
92 iso_pu_bacteria 2936996657 2937001915 120
93 iso_pu_bacteria 2937002841 2937008604 120
94 iso_pu_bacteria 2937009748 2937015916 120
95 iso_pu_bacteria 2937016420 2937022719 120
96 iso_pu_bacteria 2937023124 2937024135 120
97 iso_pu_bacteria 2937029754 2937034214 120
98 iso_pu_bacteria 2937036028 2937037415 120
99 iso_pu_bacteria 2937042894 2937047150 120
100 iso_pu_bacteria 2937049772 2937054457 120
101 iso_pu_bacteria 2937056579 2937061169 120
102 iso_pu_bacteria 2937063883 2937065324 120
103 iso_pu_bacteria 2937071275 2937072060 120
104 iso_pu_bacteria 2937078374 2937083602 120
105 iso_pu_bacteria 2937084907 2937086737 120
106 iso_pu_bacteria 2937091812 2937098623 120
107 iso_pu_bacteria 2937098957 2937105363 120
108 iso_pu_bacteria 2937106411 2937107917 120
109 iso_pu_bacteria 2937113482 2937114328 120
110 iso_pu_bacteria 2937119839 2937122715 120
111 iso_pu_bacteria 2937126314 2937128525 120
112 iso_pu_bacteria 2957375807 2957379339 120
113 iso_pu_bacteria 2957382221 2957386260 120
114 iso_pu_bacteria 2957388812 2957390360 120
115 iso_pu_bacteria 2957395598 2957401168 120
116 iso_pu_bacteria 2957402308 2957407968 120
117 iso_pu_bacteria 2957408893 2957409704 120
118 iso_pu_bacteria 2957415311 2957420573 120
119 iso_pu_bacteria 2957422303 2957423788 120
120 iso_pu_bacteria 2957430029 2957435976 120
121 iso_pu_bacteria 2957437181 2957438510 120
122 iso_pu_bacteria 2957443900 2957448873 120
123 iso_pu_bacteria 2957450854 2957451981 120
124 iso_pu_bacteria 2957457609 2957462975 120
125 iso_pu_bacteria 2957464669 2957467369 120
126 iso_pu_bacteria 2957471148 2957477705 120
127 iso_pu_bacteria 2957478035 2957484512 120
128 iso_pu_bacteria 2957484790 2957488066 120
129 iso_pu_bacteria 2957491536 2957497556 120
130 iso_pu_bacteria 2957498199 2957501494 120
131 iso_pu_bacteria 2957505466 2957509703 120
132 iso_pu_bacteria 2960584000 2960589931 120
133 iso_pu_bacteria 2960591022 2960594545 120
134 iso_pu_bacteria 2960597568 2960598654 120
135 iso_pu_bacteria 2960603979 2960608693 120
136 iso_pu_bacteria 2960610863 2960615509 120
137 iso_pu_bacteria 2960617483 2960622990 120
138 iso_pu_bacteria 2960624210 2960629975 120
139 iso_pu_bacteria 2960631154 2960632349 120
140 iso_pu_bacteria 2960637947 2960641963 120
141 iso_pu_bacteria 2960645483 2960649644 120
142 iso_pu_bacteria 2960652885 2960658628 120
143 iso_pu_bacteria 2960660292 2960664589 120
144 iso_pu_bacteria 2960674078 2960678256 120
145 iso_pu_bacteria 2960680706 2960686377 120
146 iso_pu_bacteria 2960687367 2960690920 120
147 iso_pu_bacteria 2960693952 2960700821 120
148 iso_pu_bacteria 2964607997 2964614101 120
149 iso_pu_bacteria 2964615318 2964615885 120
150 iso_pu_bacteria 2964621998 2964625308 120
151 iso_pu_bacteria 2964628898 2964632432 120
152 iso_pu_bacteria 2964636051 2964636768 120
153 iso_pu_bacteria 2964643177 2964648493 120
154 iso_pu_bacteria 2964649959 2964656005 120
155 iso_pu_bacteria 2964656573 2964663739 120
156 iso_pu_bacteria 2964663802 2964670682 120
157 iso_pu_bacteria 2964670856 2964672076 120
158 iso_pu_bacteria 2964678106 2964682535 120
159 iso_pu_bacteria 2964685014 2964688452 120
160 iso_pu_bacteria 2964691889 2964698008 120
161 iso_pu_bacteria 2964698721 2964704615 120
162 iso_pu_bacteria 2964705432 2964709439 120
163 iso_pu_bacteria 2964712639 2964714234 120
164 iso_pu_bacteria 2964719344 2964720862 120
165 iso_pu_bacteria 2967664464 2967666555 120
166 iso_pu_bacteria 2967671571 2967674115 120
167 iso_pu_bacteria 2967678726 2967685143 120
168 iso_pu_bacteria 2967686174 2967692502 120
169 iso_pu_bacteria 2967693043 2967693691 120
170 iso_pu_bacteria 2967699805 2967706967 120
171 iso_pu_bacteria 2967706974 2967710928 120
172 iso_pu_bacteria 2967714385 2967715572 120
173 iso_pu_bacteria 2967721400 2967725092 120
174 iso_pu_bacteria 2967728569 2967732240 120
175 iso_pu_bacteria 2967735183 2967736036 120
176 iso_pu_bacteria 2967742019 2967743387 120
177 iso_pu_bacteria 2967748971 2967752844 120
178 iso_pu_bacteria 2967755722 2967762072 120
179 iso_pu_bacteria 2967762386 2967768228 120
180 iso_pu_bacteria 2967769361 2967775473 120
181 iso_pu_bacteria 2967775926 2967779928 120
182 iso_pu_bacteria 2970019648 2970022902 120
183 iso_pu_bacteria 2970026789 2970031311 120
184 iso_pu_bacteria 2970033650 2970037889 120
185 iso_pu_bacteria 2970040964 2970042010 120
186 iso_pu_bacteria 2970047711 2970053174 120
187 iso_pu_bacteria 2970054988 2970055499 120
188 iso_pu_bacteria 2970061556 2970065108 120
189 iso_pu_bacteria 2970068827 2970071702 120
190 iso_pu_bacteria 2970076120 2970080697 120
191 iso_pu_bacteria 2970082768 2970088655 120
192 iso_pu_bacteria 2970088815 2970094833 120
193 iso_pu_bacteria 2970095765 2970100531 120
194 iso_pu_bacteria 2970102677 2970103529 120
195 iso_pu_bacteria 2970109326 2970114725 120
196 iso_pu_bacteria 2970116247 2970116525 120
197 iso_pu_bacteria 2970122695 2970127092 120
198 iso_pu_bacteria 2970129317 2970130490 120
199 iso_pu_bacteria 2970136068 2970138556 120
200 iso_pu_bacteria 2970143518 2970147508 120
201 iso_pu_bacteria 2970149975 2970155183 120
202 iso_pu_bacteria 2970156795 2970157397 120
203 iso_pu_bacteria 2970164137 2970165735 120
204 iso_pu_bacteria 2970170962 2970177632 120
205 iso_pu_bacteria 2970177841 2970183028 120
206 iso_pu_bacteria 2970184632 2970185994 120
207 iso_pu_bacteria 2970191845 2970192180 120
208 iso_pu_bacteria 2977516862 2977521315 120
209 iso_pu_bacteria 2977523885 2977530306 120
210 iso_pu_bacteria 2977530762 2977535503 120
211 iso_pu_bacteria 2977537788 2977538968 120
212 iso_pu_bacteria 2977544691 2977551413 120
213 iso_pu_bacteria 2977551784 2977552547 120
214 iso_pu_bacteria 2977558990 2977563385 120
215 iso_pu_bacteria 2977565890 2977570775 120
216 iso_pu_bacteria 2977572785 2977579301 120
217 iso_pu_bacteria 2977579622 2977580843 120
218 iso_pu_bacteria 648276728 648737527 120
219 iso_pu_bacteria 8003992118 8003996487 120
220 iso_pu_bacteria 8003999396 8004004307 120
221 3300005439 Ga0070711_100093608 Ga0070711_1000936082 121
222 3300005439 Ga0070711_100829253 Ga0070711_1008292532 121
223 3300006175 Ga0070712_100098532 Ga0070712_1000985323 121
224 3300007265 Ga0099794_10801292 Ga0099794_108012922 121
225 3300007788 Ga0099795_10159571 Ga0099795_101595711 121
226 3300010159 Ga0099796_10149368 Ga0099796_101493682 121
227 3300013306 Ga0163162_12933944 Ga0163162_129339441 121
228 3300021388 Ga0213875_10004158 Ga0213875_100041584 121
229 3300025916 Ga0207663_10108607 Ga0207663_101086073 121
230 3300037853 Ga0436364_1497633 Ga0436364_1497633_5115_5483 121
231 3300041456 Ga0451795_0323099 Ga0451795_0323099_36_419 121
232 3300003794 Ga0055531_10006560 Ga0055531_100065604 122
233 3300025304 Ga0209257_1000200 Ga0209257_100020073 122
234 3300046460 Ga0495638_0005482 Ga0495638_0005482_3355_3732 122
235 3300046513 Ga0495616_0000286 Ga0495616_0000286_36300_36677 122
236 3300047472 Ga0495686_0012743 Ga0495686_0012743_2028_2405 122
237 3300053122 Ga0500608_197576 Ga0500608_197576_366_743 122
238 3300053156 Ga0500622_0162373 Ga0500622_0162373_107_484 122
239 iso_pu_bacteria 2509276019 2509377507 122
240 iso_pu_bacteria 2509276021 2509391939 122
241 iso_pu_bacteria 2509276033 2509447206 122
242 iso_pu_bacteria 2510461076 2510895466 122
243 iso_pu_bacteria 2510917026 2511173635 122
244 iso_pu_bacteria 2513237085 2513577038 122
245 iso_pu_bacteria 2513237146 2513925304 122
246 iso_pu_bacteria 2513237162 2514018220 122
247 iso_pu_bacteria 2515075009 2515113148 122
248 iso_pu_bacteria 2515154113 2515639089 122
249 iso_pu_bacteria 2515154114 2515645749 122
250 iso_pu_bacteria 2515154116 2515655262 122
251 iso_pu_bacteria 2515154134 2515739574 122
252 iso_pu_bacteria 2516653077 2517036808 122
253 iso_pu_bacteria 2516653085 2517077169 122
254 iso_pu_bacteria 2529292951 2530645866 122
255 iso_pu_bacteria 2585427526 2585524592 122
256 iso_pu_bacteria 2585427528 2585538287 122
257 iso_pu_bacteria 2585427593 2585836240 122
258 iso_pu_bacteria 2585427633 2585996541 122
259 iso_pu_bacteria 2585427634 2586001070 122
260 iso_pu_bacteria 2599185170 2599417215 122
261 iso_pu_bacteria 2599185352 2600193796 122
262 iso_pu_bacteria 2643221557 2643805348 122
263 iso_pu_bacteria 2643221599 2644007166 122
264 iso_pu_bacteria 2643221610 2644066928 122
265 iso_pu_bacteria 2643221668 2644379134 122
266 iso_pu_bacteria 2643221675 2644420290 122
267 iso_pu_bacteria 2643221680 2644453816 122
268 iso_pu_bacteria 2643221723 2644675057 122
269 iso_pu_bacteria 2643221726 2644686410 122
270 iso_pu_bacteria 2718217882 2719181887 122
271 iso_pu_bacteria 2718217927 2719386500 122
272 iso_pu_bacteria 2718217997 2719666243 122
273 iso_pu_bacteria 2718218009 2719732551 122
274 iso_pu_bacteria 2718218199 2720492663 122
275 iso_pu_bacteria 2718218232 2720614135 122
276 iso_pu_bacteria 2718218233 2720620902 122
277 iso_pu_bacteria 2718218235 2720632225 122
278 iso_pu_bacteria 2718218269 2720775953 122
279 iso_pu_bacteria 2718218363 2721147978 122
280 iso_pu_bacteria 2718218365 2721159429 122
281 iso_pu_bacteria 2718218366 2721164814 122
282 iso_pu_bacteria 2718218423 2721400204 122
283 iso_pu_bacteria 2721755514 2722840984 122
284 iso_pu_bacteria 2721755556 2723027553 122
285 iso_pu_bacteria 2721755684 2723561182 122
286 iso_pu_bacteria 2721755685 2723567803 122
287 iso_pu_bacteria 2721755809 2724039017 122
288 iso_pu_bacteria 2721755810 2724045307 122
289 iso_pu_bacteria 2721755819 2724090560 122
290 iso_pu_bacteria 2721755822 2724105068 122
291 iso_pu_bacteria 2721755823 2724110897 122
292 iso_pu_bacteria 2728369352 2730108489 122
293 iso_pu_bacteria 2728369365 2730165122 122
294 iso_pu_bacteria 2728369397 2730299061 122
295 iso_pu_bacteria 2738541333 2739032927 122
296 iso_pu_bacteria 2765235942 2766065962 122
297 iso_pu_bacteria 2791355256 2793294355 122
298 iso_pu_bacteria 2791355259 2793316000 122
299 iso_pu_bacteria 2791355260 2793319267 122
300 iso_pu_bacteria 2791355261 2793330867 122
301 iso_pu_bacteria 2791355262 2793334576 122
302 iso_pu_bacteria 2791355264 2793347159 122
303 iso_pu_bacteria 2791355265 2793351753 122
304 iso_pu_bacteria 2791355266 2793362049 122
305 iso_pu_bacteria 2791355267 2793368770 122
306 iso_pu_bacteria 2802429605 2805928716 122
307 iso_pu_bacteria 2802429606 2805937841 122
308 iso_pu_bacteria 2802429633 2806045065 122
309 iso_pu_bacteria 2802429634 2806050140 122
310 iso_pu_bacteria 2802429635 2806056978 122
311 iso_pu_bacteria 2802429636 2806064359 122
312 iso_pu_bacteria 2802429637 2806071626 122
313 iso_pu_bacteria 2838016132 2838021541 122
314 iso_pu_bacteria 2838022645 2838023764 122
315 iso_pu_bacteria 2838035591 2838038581 122
316 iso_pu_bacteria 2838042994 2838045050 122
317 iso_pu_bacteria 2838048938 2838054288 122
318 iso_pu_bacteria 2838061910 2838067642 122
319 iso_pu_bacteria 2838068647 2838070061 122
320 iso_pu_bacteria 2838661181 2838661497 122
321 iso_pu_bacteria 2838668709 2838670446 122
322 iso_pu_bacteria 2838680041 2838683369 122
323 iso_pu_bacteria 2838686498 2838686958 122
324 iso_pu_bacteria 2838694306 2838697687 122
325 iso_pu_bacteria 2838701080 2838702817 122
326 iso_pu_bacteria 2838707686 2838710803 122
327 iso_pu_bacteria 2838729681 2838730084 122
328 iso_pu_bacteria 2838742623 2838742901 122
329 iso_pu_bacteria 2841851746 2841852403 122
330 iso_pu_bacteria 2841864319 2841867043 122
331 iso_pu_bacteria 2842077413 2842078976 122
332 iso_pu_bacteria 2842110456 2842113176 122
333 iso_pu_bacteria 2842118031 2842118514 122
334 iso_pu_bacteria 2842146304 2842147925 122
335 iso_pu_bacteria 2842156927 2842158139 122
336 iso_pu_bacteria 2842163707 2842168702 122
337 iso_pu_bacteria 2842180545 2842181758 122
338 iso_pu_bacteria 2842192696 2842197442 122
339 iso_pu_bacteria 2842198810 2842199278 122
340 iso_pu_bacteria 2842205361 2842205384 122
341 iso_pu_bacteria 2842217011 2842218030 122
342 iso_pu_bacteria 2842229732 2842230192 122
343 iso_pu_bacteria 2842237096 2842240425 122
344 iso_pu_bacteria 2842243621 2842244079 122
345 iso_pu_bacteria 2842250916 2842252991 122
346 iso_pu_bacteria 2842257432 2842257835 122
347 iso_pu_bacteria 2842264693 2842266349 122
348 iso_pu_bacteria 2842271015 2842271504 122
349 iso_pu_bacteria 2842278818 2842278841 122
350 iso_pu_bacteria 2842285085 2842285516 122
351 iso_pu_bacteria 2842291075 2842292638 122
352 iso_pu_bacteria 2842304105 2842305135 122
353 iso_pu_bacteria 2842311132 2842317637 122
354 iso_pu_bacteria 2842317721 2842320797 122
355 iso_pu_bacteria 2842341865 2842347433 122
356 iso_pu_bacteria 2842363717 2842368868 122
357 iso_pu_bacteria 2842370503 2842374000 122
358 iso_pu_bacteria 2842377471 2842379036 122
359 iso_pu_bacteria 2842384541 2842385024 122
360 iso_pu_bacteria 2842395702 2842400258 122
361 iso_pu_bacteria 2842402390 2842402876 122
362 iso_pu_bacteria 2842409023 2842409752 122
363 iso_pu_bacteria 2842415677 2842416403 122
364 iso_pu_bacteria 2842422224 2842423675 122
365 iso_pu_bacteria 2842428310 2842430811 122
366 iso_pu_bacteria 2842434925 2842437202 122
367 iso_pu_bacteria 2842441272 2842443572 122
368 iso_pu_bacteria 2842447887 2842453922 122
369 iso_pu_bacteria 2842462802 2842464954 122
370 iso_pu_bacteria 2842469257 2842471820 122
371 iso_pu_bacteria 2842489311 2842492112 122
372 iso_pu_bacteria 2842495871 2842496667 122
373 iso_pu_bacteria 2844454524 2844458255 122
374 iso_pu_bacteria 2850079185 2850084759 122
375 iso_pu_bacteria 2857516855 2857517339 122
376 iso_pu_bacteria 2933016740 2933023608 122
377 iso_pu_bacteria 2933570622 2933570942 122
378 iso_pu_bacteria 2933586486 2933588767 122
379 iso_pu_bacteria 2933599457 2933600867 122
380 iso_pu_bacteria 2935894831 2935896927 122
381 iso_pu_bacteria 2935901341 2935901866 122
382 iso_pu_bacteria 2936367885 2936371949 122
383 iso_pu_bacteria 2936375103 2936379784 122
384 iso_pu_bacteria 3005409236 3005414480 122
385 iso_pu_bacteria 639633055 639649268 122
386 iso_pu_bacteria 8005275841 8005281301 122
387 iso_pu_bacteria 8005282627 8005286047 122
388 iso_pu_bacteria 8005289223 8005295599 122
389 iso_pu_bacteria 8005301065 8005303215 122
390 iso_pu_bacteria 8005307578 8005312923 122
391 iso_pu_bacteria 8005376324 8005381015 122
392 iso_pu_bacteria 8005382845 8005389032 122
393 iso_pu_bacteria 8005395548 8005396015 122
394 iso_pu_bacteria 8005430974 8005437371 122
395 iso_pu_bacteria 8005460587 8005463829 122
396 iso_pu_bacteria 8005497431 8005500983 122
397 iso_pu_bacteria 8005570704 8005573372 122
398 iso_pu_bacteria 8005619151 8005622351 122
399 iso_pu_bacteria 8005626139 8005629851 122
400 iso_pu_bacteria 8005668836 8005672402 122
401 iso_pu_bacteria 8005688590 8005692016 122
402 iso_pu_bacteria 8005695170 8005697497 122
403 iso_pu_bacteria 8018176218 8018176962 122
404 iso_pu_bacteria 8023680758 8023683077 122
405 iso_pu_bacteria 8056375014 8056376024 122
406 iso_pu_bacteria 8056382006 8056384334 122
407 iso_pu_bacteria 8057874678 8057877589 122
408 3300005354 Ga0070675_100967657 Ga0070675_1009676571 123
409 3300006946 Ga0079104_1002809 Ga0079104_10028096 123
410 3300013249 Ga0171463_1002 Ga0171463_1002903 123
411 3300015690 Ga0183363_1023 Ga0183363_102324 123
412 3300022739 Ga0228711_1025331 Ga0228711_10253313 123
413 3300022739 Ga0228711_1028169 Ga0228711_10281693 123
414 3300022740 Ga0228710_1007199 Ga0228710_10071992 123
415 3300027111 Ga0209281_1000087 Ga0209281_10000872 123
416 3300027111 Ga0209281_1000188 Ga0209281_1000188119 123
417 3300027666 Ga0209282_1000008 Ga0209282_10000083 123
418 3300031967 Ga0315914_1004687 Ga0315914_100468720 123
419 3300033430 Ga0315913_1002699 Ga0315913_100269921 123
420 3300033464 Ga0315915_1000009 Ga0315915_1000009213 123
421 3300033464 Ga0315915_1018884 Ga0315915_10188848 123
422 3300041413 Ga0439465_0239510 Ga0439465_0239510_32_406 123
423 3300042007 Ga0439449_0011618 Ga0439449_0011618_1915_2289 123
424 3300010375 Ga0105239_10007296 Ga0105239_1000729610 124
425 3300013296 Ga0157374_10212166 Ga0157374_102121662 124
426 3300013306 Ga0163162_10337013 Ga0163162_103370131 124
427 3300013306 Ga0163162_10783131 Ga0163162_107831312 124
428 3300014969 Ga0157376_10842135 Ga0157376_108421352 124
429 3300021384 Ga0213876_10231270 Ga0213876_102312701 124
430 3300026089 Ga0207648_10777698 Ga0207648_107776982 124
431 3300031250 Ga0265331_10000009 Ga0265331_10000009183 124
432 3300031711 Ga0265314_10009172 Ga0265314_1000917212 124
433 3300038443 Ga0395901_0790237 Ga0395901_0790237_343_720 124
434 3300039437 Ga0436365_0937741 Ga0436365_0937741_1555_1932 124
435 3300039450 Ga0436363_0238267 Ga0436363_0238267_345_722 124
436 3300041456 Ga0451795_0410131 Ga0451795_0410131_287_667 124
437 3300048906 Ga0496103_0017369 Ga0496103_0017369_3739_4116 124
438 3300048917 Ga0496114_0915911 Ga0496114_0915911_207_584 124
439 3300048918 Ga0496115_0000002 Ga0496115_0000002_53001_53378 124
440 3300048920 Ga0496117_0170439 Ga0496117_0170439_836_1213 124
441 3300048921 Ga0496118_0008298 Ga0496118_0008298_6236_6613 124
442 3300048924 Ga0496121_0035981 Ga0496121_0035981_1189_1566 124
443 3300048929 Ga0496126_0000052 Ga0496126_0000052_172_549 124
444 3300053153 Ga0500616_0304105 Ga0500616_0304105_228_608 124
445 3300001990 JGI24737J22298_10228434 JGI24737J22298_102284342 125
446 3300002067 JGI24735J21928_10000112 JGI24735J21928_100001129 125
447 3300002075 JGI24738J21930_10085541 JGI24738J21930_100855412 125
448 3300002739 JGI25158J39367_1003557 JGI25158J39367_10035572 125
449 3300002773 JGI25152J39213_1022971 JGI25152J39213_10229712 125
450 3300002773 JGI25152J39213_1024815 JGI25152J39213_10248151 125
451 3300002774 JGI25150J39212_1037030 JGI25150J39212_10370301 125
452 3300002987 JGI25159J45721_1000005 JGI25159J45721_100000515 125
453 3300003187 JGI25151J46595_10002195 JGI25151J46595_100021958 125
454 3300003187 JGI25151J46595_10007863 JGI25151J46595_100078632 125
455 3300003187 JGI25151J46595_10013315 JGI25151J46595_100133155 125
456 3300003215 JGI25153J46596_10003219 JGI25153J46596_100032199 125
457 3300003322 rootL2_10157544 rootL2_101575445 125
458 3300003354 JGI25160J50197_1000005 JGI25160J50197_1000005375 125
459 3300003354 JGI25160J50197_1001364 JGI25160J50197_100136412 125
460 3300003354 JGI25160J50197_1032310 JGI25160J50197_10323102 125
461 3300003374 JGI25161J50226_1001207 JGI25161J50226_10012079 125
462 3300003374 JGI25161J50226_1007029 JGI25161J50226_10070293 125
463 3300003771 Ga0055526_1002019 Ga0055526_100201912 125
464 3300003771 Ga0055526_1002391 Ga0055526_10023919 125
465 3300003771 Ga0055526_1007448 Ga0055526_10074481 125
466 3300003771 Ga0055526_1071970 Ga0055526_10719701 125
467 3300003775 Ga0055524_1002000 Ga0055524_10020004 125
468 3300003775 Ga0055524_1009423 Ga0055524_10094232 125
469 3300003775 Ga0055524_1021453 Ga0055524_10214532 125
470 3300003775 Ga0055524_1022349 Ga0055524_10223492 125
471 3300003775 Ga0055524_1023323 Ga0055524_10233232 125
472 3300003781 Ga0055536_1006614 Ga0055536_10066142 125
473 3300003781 Ga0055536_1026976 Ga0055536_10269762 125
474 3300003790 Ga0055528_1000193 Ga0055528_100019361 125
475 3300003790 Ga0055528_1015491 Ga0055528_10154915 125
476 3300003790 Ga0055528_1026719 Ga0055528_10267193 125
477 3300003790 Ga0055528_1029764 Ga0055528_10297642 125
478 3300003792 Ga0055540_1000293 Ga0055540_100029347 125
479 3300003794 Ga0055531_10009964 Ga0055531_100099642 125
480 3300004625 Ga0055543_1000175 Ga0055543_100017515 125
481 3300004625 Ga0055543_1001092 Ga0055543_10010925 125
482 3300005262 Ga0065165_1000002 Ga0065165_100000215 125
483 3300005262 Ga0065165_1019402 Ga0065165_10194021 125
484 3300005327 Ga0070658_10993442 Ga0070658_109934422 125
485 3300005335 Ga0070666_10464235 Ga0070666_104642351 125
486 3300005347 Ga0070668_102239249 Ga0070668_1022392491 125
487 3300005455 Ga0070663_102095408 Ga0070663_1020954081 125
488 3300005456 Ga0070678_100107491 Ga0070678_1001074913 125
489 3300005466 Ga0070685_10000502 Ga0070685_1000050214 125
490 3300005548 Ga0070665_100773131 Ga0070665_1007731312 125
491 3300005548 Ga0070665_101176417 Ga0070665_1011764171 125
492 3300005616 Ga0068852_100734450 Ga0068852_1007344502 125
493 3300006038 Ga0075365_10016689 Ga0075365_100166896 125
494 3300006042 Ga0075368_10022317 Ga0075368_100223174 125
495 3300006048 Ga0075363_100227726 Ga0075363_1002277262 125
496 3300006051 Ga0075364_10435951 Ga0075364_104359511 125
497 3300006177 Ga0075362_10011274 Ga0075362_100112743 125
498 3300006178 Ga0075367_10018190 Ga0075367_100181906 125
499 3300006178 Ga0075367_10208756 Ga0075367_102087561 125
500 3300006186 Ga0075369_10007739 Ga0075369_100077394 125
501 3300006195 Ga0075366_10314909 Ga0075366_103149092 125
502 3300006353 Ga0075370_10022110 Ga0075370_100221103 125
503 3300006353 Ga0075370_10292148 Ga0075370_102921482 125
504 3300006353 Ga0075370_10444430 Ga0075370_104444302 125
505 3300006353 Ga0075370_10486161 Ga0075370_104861611 125
506 3300009011 Ga0105251_10000157 Ga0105251_100001578 125
507 3300009093 Ga0105240_10006517 Ga0105240_1000651714 125
508 3300009545 Ga0105237_10249246 Ga0105237_102492461 125
509 3300009551 Ga0105238_10003745 Ga0105238_100037457 125
510 3300009551 Ga0105238_10165069 Ga0105238_101650693 125
511 3300009765 Ga0123341_1007449 Ga0123341_10074497 125
512 3300009766 Ga0123342_1039178 Ga0123342_10391782 125
513 3300013105 Ga0157369_10559518 Ga0157369_105595182 125
514 3300013307 Ga0157372_10095179 Ga0157372_100951793 125
515 3300021321 Ga0214542_1019610 Ga0214542_10196102 125
516 3300021327 Ga0214543_1000012 Ga0214543_100001288 125
517 3300025208 Ga0209436_101014 Ga0209436_1010143 125
518 3300025245 Ga0207425_1005869 Ga0207425_10058694 125
519 3300025258 Ga0209129_1000348 Ga0209129_100034846 125
520 3300025258 Ga0209129_1001467 Ga0209129_100146711 125
521 3300025258 Ga0209129_1029929 Ga0209129_10299292 125
522 3300025273 Ga0209673_1000010 Ga0209673_1000010334 125
523 3300025273 Ga0209673_1000025 Ga0209673_1000025348 125
524 3300025273 Ga0209673_1001435 Ga0209673_100143524 125
525 3300025273 Ga0209673_1004596 Ga0209673_10045965 125
526 3300025273 Ga0209673_1011399 Ga0209673_10113995 125
527 3300025284 Ga0209130_1000010 Ga0209130_100001015 125
528 3300025292 Ga0209676_1000093 Ga0209676_100009350 125
529 3300025292 Ga0209676_1006657 Ga0209676_10066576 125
530 3300025292 Ga0209676_1014879 Ga0209676_10148795 125
531 3300025292 Ga0209676_1064184 Ga0209676_10641842 125
532 3300025292 Ga0209676_1103557 Ga0209676_11035571 125
533 3300025294 Ga0209025_1000459 Ga0209025_100045973 125
534 3300025294 Ga0209025_1002036 Ga0209025_100203622 125
535 3300025294 Ga0209025_1002049 Ga0209025_100204912 125
536 3300025294 Ga0209025_1075280 Ga0209025_10752802 125
537 3300025294 Ga0209025_1082169 Ga0209025_10821692 125
538 3300025295 Ga0209564_1000025 Ga0209564_1000025383 125
539 3300025295 Ga0209564_1000618 Ga0209564_100061861 125
540 3300025295 Ga0209564_1005421 Ga0209564_10054212 125
541 3300025295 Ga0209564_1007171 Ga0209564_10071713 125
542 3300025297 Ga0209758_1001930 Ga0209758_100193023 125
543 3300025297 Ga0209758_1002703 Ga0209758_10027038 125
544 3300025297 Ga0209758_1039615 Ga0209758_10396152 125
545 3300025298 Ga0209050_1003463 Ga0209050_10034639 125
546 3300025298 Ga0209050_1010478 Ga0209050_10104782 125
547 3300025298 Ga0209050_1023688 Ga0209050_10236883 125
548 3300025299 Ga0209256_1000342 Ga0209256_100034213 125
549 3300025299 Ga0209256_1000561 Ga0209256_100056161 125
550 3300025299 Ga0209256_1001944 Ga0209256_100194412 125
551 3300025299 Ga0209256_1005420 Ga0209256_10054207 125
552 3300025299 Ga0209256_1025557 Ga0209256_10255572 125
553 3300025299 Ga0209256_1041324 Ga0209256_10413242 125
554 3300025302 Ga0207426_1000036 Ga0207426_100003615 125
555 3300025302 Ga0207426_1000218 Ga0207426_1000218120 125
556 3300025302 Ga0207426_1004157 Ga0207426_10041576 125
557 3300025303 Ga0209051_1000097 Ga0209051_1000097158 125
558 3300025303 Ga0209051_1012827 Ga0209051_10128275 125
559 3300025303 Ga0209051_1038041 Ga0209051_10380412 125
560 3300025304 Ga0209257_1003354 Ga0209257_100335414 125
561 3300025304 Ga0209257_1003539 Ga0209257_10035391 125
562 3300025904 Ga0207647_10030195 Ga0207647_100301952 125
563 3300025909 Ga0207705_10869450 Ga0207705_108694502 125
564 3300025913 Ga0207695_10000418 Ga0207695_1000041822 125
565 3300025914 Ga0207671_10104364 Ga0207671_101043642 125
566 3300025924 Ga0207694_10000646 Ga0207694_100006467 125
567 3300025924 Ga0207694_10173433 Ga0207694_101734332 125
568 3300025972 Ga0207668_10345332 Ga0207668_103453321 125
569 3300026067 Ga0207678_11627912 Ga0207678_116279122 125
570 3300026121 Ga0207683_10450205 Ga0207683_104502053 125
571 3300026142 Ga0207698_10856128 Ga0207698_108561281 125
572 3300027866 Ga0209813_10035128 Ga0209813_100351283 125
573 3300028379 Ga0268266_10673529 Ga0268266_106735292 125
574 3300030521 Ga0307511_10001559 Ga0307511_100015596 125
575 3300031239 Ga0265328_10019487 Ga0265328_100194873 125
576 3300031250 Ga0265331_10005418 Ga0265331_100054184 125
577 3300031250 Ga0265331_10028104 Ga0265331_100281044 125
578 3300031251 Ga0265327_10000776 Ga0265327_1000077615 125
579 3300031251 Ga0265327_10006581 Ga0265327_100065815 125
580 3300031507 Ga0307509_10732830 Ga0307509_107328302 125
581 3300031548 Ga0307408_100272501 Ga0307408_1002725013 125
582 3300032005 Ga0307411_11730094 Ga0307411_117300941 125
583 3300036401 Ga0373937_0406937 Ga0373937_0406937_63_446 125
584 3300039438 Ga0436360_0012437 Ga0436360_0012437_186_566 125
585 3300039447 Ga0436361_0265461 Ga0436361_0265461_543_926 125
586 3300041404 Ga0439436_0070567 Ga0439436_0070567_223_621 125
587 3300041404 Ga0439436_0215240 Ga0439436_0215240_19_417 125
588 3300041410 Ga0439461_0218792 Ga0439461_0218792_37_435 125
589 3300041413 Ga0439465_0004579 Ga0439465_0004579_3417_3815 125
590 3300041413 Ga0439465_0365387 Ga0439465_0365387_65_445 125
591 3300041441 Ga0451787_351301 Ga0451787_351301_185_583 125
592 3300041443 Ga0451789_1201109 Ga0451789_1201109_340_738 125
593 3300041453 Ga0451797_0204869 Ga0451797_0204869_66_464 125
594 3300041458 Ga0451798_0423063 Ga0451798_0423063_797_1195 125
595 3300041459 Ga0451800_1170929 Ga0451800_1170929_886_1284 125
596 3300041460 Ga0451802_0402245 Ga0451802_0402245_345_743 125
597 3300041491 Ga0451833_0408963 Ga0451833_0408963_1095_1493 125
598 3300041492 Ga0451835_0110663 Ga0451835_0110663_1789_2187 125
599 3300041496 Ga0451839_1572218 Ga0451839_1572218_2245_2643 125
600 3300041497 Ga0451840_09573 Ga0451840_09573_19_417 125
601 3300041498 Ga0451841_0854225 Ga0451841_0854225_122_520 125
602 3300041498 Ga0451841_0887259 Ga0451841_0887259_586_984 125
603 3300041500 Ga0451844_23037 Ga0451844_23037_197_595 125
604 3300041501 Ga0451845_0594539 Ga0451845_0594539_2523_2921 125
605 3300041501 Ga0451845_0834058 Ga0451845_0834058_269_667 125
606 3300041502 Ga0451846_33112 Ga0451846_33112_40_438 125
607 3300041503 Ga0451847_0727637 Ga0451847_0727637_633_1031 125
608 3300041504 Ga0451848_12133 Ga0451848_12133_257_655 125
609 3300041505 Ga0451849_0011697 Ga0451849_0011697_550_948 125
610 3300041506 Ga0451850_23357 Ga0451850_23357_337_735 125
611 3300041507 Ga0451851_1089516 Ga0451851_1089516_764_1162 125
612 3300041510 Ga0451854_10243 Ga0451854_10243_12_410 125
613 3300041512 Ga0451853_2330629 Ga0451853_2330629_1004_1402 125
614 3300041907 Ga0452268_25436 Ga0452268_25436_19_417 125
615 3300041916 Ga0452271_24104 Ga0452271_24104_515_913 125
616 3300042006 Ga0439432_116185 Ga0439432_116185_29_427 125
617 3300042007 Ga0439449_0062378 Ga0439449_0062378_346_744 125
618 3300042010 Ga0439452_078932 Ga0439452_078932_64_462 125
619 3300046452 Ga0495617_211745 Ga0495617_211745_10_408 125
620 3300046454 Ga0495592_0166545 Ga0495592_0166545_670_1056 125
621 3300046457 Ga0495590_0006558 Ga0495590_0006558_1248_1625 125
622 3300046459 Ga0495629_0407740 Ga0495629_0407740_459_839 125
623 3300046476 Ga0495662_0058166 Ga0495662_0058166_346_726 125
624 3300046492 Ga0495585_0086222 Ga0495585_0086222_1198_1596 125
625 3300046500 Ga0495596_0056361 Ga0495596_0056361_1107_1484 125
626 3300046500 Ga0495596_0119979 Ga0495596_0119979_188_586 125
627 3300046501 Ga0495607_0192980 Ga0495607_0192980_270_668 125
628 3300046507 Ga0495606_0003502 Ga0495606_0003502_14485_14868 125
629 3300046507 Ga0495606_0035499 Ga0495606_0035499_2987_3385 125
630 3300046507 Ga0495606_0227755 Ga0495606_0227755_51_449 125
631 3300046512 Ga0495610_0048151 Ga0495610_0048151_684_1082 125
632 3300046513 Ga0495616_0147595 Ga0495616_0147595_329_727 125
633 3300046515 Ga0495620_0015820 Ga0495620_0015820_2054_2452 125
634 3300046518 Ga0495631_0047769 Ga0495631_0047769_908_1306 125
635 3300046522 Ga0495643_0008506 Ga0495643_0008506_1323_1721 125
636 3300046524 Ga0495648_0212103 Ga0495648_0212103_74_472 125
637 3300046536 Ga0495587_0076635 Ga0495587_0076635_923_1303 125
638 3300046542 Ga0495597_0055847 Ga0495597_0055847_492_869 125
639 3300046542 Ga0495597_0136917 Ga0495597_0136917_461_859 125
640 3300046558 Ga0495633_0020623 Ga0495633_0020623_238_636 125
641 3300046648 Ga0495611_0447683 Ga0495611_0447683_82_480 125
642 3300046660 Ga0495625_0015924 Ga0495625_0015924_5180_5578 125
643 3300046660 Ga0495625_0229003 Ga0495625_0229003_386_784 125
644 3300046664 Ga0495659_0145654 Ga0495659_0145654_492_872 125
645 3300046665 Ga0495661_0192528 Ga0495661_0192528_87_485 125
646 3300046692 Ga0495671_0039546 Ga0495671_0039546_600_998 125
647 3300047317 Ga0495604_0016100 Ga0495604_0016100_372_752 125
648 3300047318 Ga0495636_0000702 Ga0495636_0000702_2338_2718 125
649 3300047318 Ga0495636_0019474 Ga0495636_0019474_986_1384 125
650 3300047323 Ga0495683_0002414 Ga0495683_0002414_10501_10878 125
651 3300047323 Ga0495683_0105763 Ga0495683_0105763_860_1258 125
652 3300047443 Ga0495687_088925 Ga0495687_088925_161_559 125
653 3300047446 Ga0495679_037614 Ga0495679_037614_21_419 125
654 3300047447 Ga0495685_044280 Ga0495685_044280_959_1357 125
655 3300047472 Ga0495686_0118120 Ga0495686_0118120_427_810 125
656 3300048091 Ga0495626_0101471 Ga0495626_0101471_369_746 125
657 3300048903 Ga0496100_0003583 Ga0496100_0003583_2393_2770 125
658 3300048903 Ga0496100_0357908 Ga0496100_0357908_454_852 125
659 3300048904 Ga0496101_0149517 Ga0496101_0149517_854_1231 125
660 3300048905 Ga0496102_0373668 Ga0496102_0373668_882_1259 125
661 3300048906 Ga0496103_0004586 Ga0496103_0004586_3226_3603 125
662 3300048907 Ga0496104_1532678 Ga0496104_1532678_171_548 125
663 3300048909 Ga0496106_0012804 Ga0496106_0012804_2122_2499 125
664 3300048909 Ga0496106_0243145 Ga0496106_0243145_470_868 125
665 3300048910 Ga0496107_0002844 Ga0496107_0002844_648_1025 125
666 3300048910 Ga0496107_0676852 Ga0496107_0676852_36_434 125
667 3300048913 Ga0496110_0006043 Ga0496110_0006043_1675_2052 125
668 3300048914 Ga0496111_0001680 Ga0496111_0001680_8101_8478 125
669 3300048915 Ga0496112_0014139 Ga0496112_0014139_2505_2882 125
670 3300048916 Ga0496113_0021663 Ga0496113_0021663_3462_3839 125
671 3300048919 Ga0496116_0011367 Ga0496116_0011367_2265_2642 125
672 3300048919 Ga0496116_0104306 Ga0496116_0104306_1236_1634 125
673 3300048920 Ga0496117_0028436 Ga0496117_0028436_639_1037 125
674 3300048920 Ga0496117_0028637 Ga0496117_0028637_2282_2659 125
675 3300048921 Ga0496118_0003734 Ga0496118_0003734_1989_2387 125
676 3300048921 Ga0496118_0029209 Ga0496118_0029209_3559_3936 125
677 3300048921 Ga0496118_0095486 Ga0496118_0095486_840_1220 125
678 3300048922 Ga0496119_0148053 Ga0496119_0148053_785_1162 125
679 3300048924 Ga0496121_0004293 Ga0496121_0004293_6286_6669 125
680 3300048924 Ga0496121_0015344 Ga0496121_0015344_7577_7954 125
681 3300048925 Ga0496122_0029336 Ga0496122_0029336_292_669 125
682 3300048926 Ga0496123_0011378 Ga0496123_0011378_2160_2537 125
683 3300048926 Ga0496123_0103107 Ga0496123_0103107_910_1308 125
684 3300048927 Ga0496124_0175711 Ga0496124_0175711_495_872 125
685 3300048928 Ga0496125_0009320 Ga0496125_0009320_387_764 125
686 3300048929 Ga0496126_0223499 Ga0496126_0223499_528_926 125
687 3300048929 Ga0496126_1265338 Ga0496126_1265338_82_459 125
688 3300049459 Ga0495678_184219 Ga0495678_184219_236_634 125
689 3300049758 Ga0501241_047674 Ga0501241_047674_120_518 125
690 3300050489 nmdc:mga03683_5110_c1 nmdc:mga03683_5110_c1_1261_1659 125
691 3300050490 nmdc:mga03n38_194719_c1 nmdc:mga03n38_194719_c1_378_776 125
692 3300050492 nmdc:mga0yw44_47653_c1 nmdc:mga0yw44_47653_c1_770_1168 125
693 3300050493 nmdc:mga0k408_13752_c1 nmdc:mga0k408_13752_c1_2909_3307 125
694 3300050493 nmdc:mga0k408_429503_c1 nmdc:mga0k408_429503_c1_330_713 125
695 3300050494 nmdc:mga06z11_24810_c1 nmdc:mga06z11_24810_c1_163_561 125
696 3300050495 nmdc:mga04h51_41425_c1 nmdc:mga04h51_41425_c1_142_540 125
697 3300050496 nmdc:mga07m45_24722_c1 nmdc:mga07m45_24722_c1_50_463 125
698 3300050496 nmdc:mga07m45_271202_c1 nmdc:mga07m45_271202_c1_276_659 125
699 3300050496 nmdc:mga07m45_35909_c1 nmdc:mga07m45_35909_c1_76_474 125
700 3300050516 nmdc:mga0sz30_9160_c1 nmdc:mga0sz30_9160_c1_1235_1633 125
701 3300053086 Ga0500578_0376034 Ga0500578_0376034_93_491 125
702 3300053088 Ga0500644_0072465 Ga0500644_0072465_228_611 125
703 3300053090 Ga0500646_0001480 Ga0500646_0001480_3694_4077 125
704 3300053092 Ga0500583_0021150 Ga0500583_0021150_938_1321 125
705 3300053103 Ga0500555_006129 Ga0500555_006129_1461_1844 125
706 3300053118 Ga0500594_0041149 Ga0500594_0041149_776_1174 125
707 3300053123 Ga0500614_032025 Ga0500614_032025_202_582 125
708 3300053129 Ga0500628_020736 Ga0500628_020736_797_1195 125
709 3300053134 Ga0500658_0001117 Ga0500658_0001117_3378_3776 125
710 3300053139 Ga0500568_0024118 Ga0500568_0024118_963_1346 125
711 3300053151 Ga0500604_0000890 Ga0500604_0000890_508_891 125
712 3300053153 Ga0500616_0000421 Ga0500616_0000421_17291_17689 125
713 3300053153 Ga0500616_0013504 Ga0500616_0013504_684_1082 125
714 3300053153 Ga0500616_0235604 Ga0500616_0235604_257_640 125
715 3300053160 Ga0500633_0000143 Ga0500633_0000143_8444_8842 125
716 3300053731 Ga0500609_023687 Ga0500609_023687_123_521 125
717 3300059652 Ga0587107_098450 Ga0587107_098450_127_525 125
718 iso_pu_bacteria 2510065019 2510134043 125
719 iso_pu_bacteria 2513237084 2513567883 125
720 iso_pu_bacteria 2513237103 2513707702 125
721 iso_pu_bacteria 2517093000 2517095919 125
722 iso_pu_bacteria 2517287029 2517407494 125
723 iso_pu_bacteria 2724679232 2725952450 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

20

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8118 12 123
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.7982 12 123
3fxx-assembly1.cif.gz_A human epha3 kinase and juxtamembrane region bound to substrate kqwdnye[ptyr]iw 0.4963 55 80
6sgi-assembly1.cif.gz_A nek2 kinase bound to inhibitor 96 0.49 58 85
2xno-assembly1.cif.gz_A structure of nek2 bound to cct243779 0.4831 58 85
ID Description Score Start End Superfamily
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.861 8 121 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8468 8 121 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.838 9 119 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8119 9 119 2.170.150.40
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8112 21 119 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A1H7TDY3-F1-model_v4 Uncharacterized conserved protein, DUF427 family 0.9853 1 123
AF-A0A1H5SNV3-F1-model_v4 Uncharacterized conserved protein, DUF427 family 0.9844 2 122
AF-A0A2E5MNB7-F1-model_v4 DUF427 domain-containing protein 0.9842 12 123
AF-U2H8F6-F1-model_v4 DUF427 domain-containing protein 0.9839 4 123
AF-A0A2W7FN43-F1-model_v4 deleted 0.9818 2 122

Feature Viewer

pLDDT pTM Quality
96.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map