F477528

General Info

Members Datasets Scaffolds Average Seq Length
723 298 1446 189

Family's Representative Sequence

Representative Sequence 3300050496|nmdc:mga07m45_168854_c1|nmdc:mga07m45_168854_c1_330_1004
Length 224
Sequence MSKHSNVKPLQGAGTGQDARQDGSQNAGANNQAAPQPRLVLDEAALEEAKRSINEGAVTPSYGPWREDIIKLLNDALATELVCVMRYKRHHFTAQGLSSPKIADEFLVHAHEEEAHSDQIAERIVQLGGEPDYSPSTLVQRSHADYDASTDLKAMIRANLVAERVAIEAYTQMITLIGDKDSTTRRILEGILEQEQEHADELKDWLVDTPGFRPGRPGRFPNAA

Samples

Sample ID Description Type Environment
1 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
109 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
168 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
223 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
228 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
241 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
242 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
251 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
284 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
285 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
286 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
287 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
288 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
291 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
292 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
293 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
294 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
295 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
296 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
297 2721755523 Delftia sp. HK171 Isolate Unclassified
298 2839138175 Delftia acidovorans B15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 1.24
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.45
Nodule 0.28
Rhizoplane 4.29
Rhizosphere 77.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga07m45_168854_c1 3300050496 Bacteria 1271
2 SwRhRL2b_contig_1478476 2162886007 Bacteria 2167
3 rootH1_10013796 3300003316 Bacteria 7476
4 rootL2_10098162 3300003322 Bacteria 1674
5 JGI26128J50194_1003503 3300003347 Bacteria 1039
6 Ga0058861_11619911 3300004800 Bacteria 973
7 Ga0058861_12064541 3300004800 Bacteria 1061
8 Ga0058862_12783857 3300004803 Bacteria 1067
9 Ga0058862_12887129 3300004803 Bacteria 1315
10 Ga0065704_10265140 3300005289 Bacteria 956
11 Ga0065715_10556065 3300005293 Bacteria 737
12 Ga0070658_10060629 3300005327 Bacteria 3081
13 Ga0070658_10124126 3300005327 Bacteria 2148
14 Ga0070658_10206478 3300005327 Bacteria 1659
15 Ga0070676_10006586 3300005328 Bacteria 6211
16 Ga0070676_10007272 3300005328 Bacteria 5939
17 Ga0070676_10030031 3300005328 Bacteria 3096
18 Ga0070676_10214649 3300005328 Bacteria 1268
19 Ga0070683_100006074 3300005329 Bacteria 10125
20 Ga0070683_100080496 3300005329 Bacteria 3049
21 Ga0070683_100093039 3300005329 Bacteria 2832
22 Ga0070690_100220572 3300005330 Bacteria 1328
23 Ga0070670_100001745 3300005331 Bacteria 17708
24 Ga0070670_100004301 3300005331 Bacteria 11917
25 Ga0070670_100028046 3300005331 Bacteria 4845
26 Ga0070670_100037838 3300005331 Bacteria 4150
27 Ga0070670_100051506 3300005331 Bacteria 3535
28 Ga0070670_100104722 3300005331 Bacteria 2437
29 Ga0070670_100140394 3300005331 Bacteria 2089
30 Ga0070670_100299475 3300005331 Bacteria 1406
31 Ga0070670_100304072 3300005331 Bacteria 1395
32 Ga0070677_10009792 3300005333 Bacteria 3260
33 Ga0070677_10078627 3300005333 Bacteria 1406
34 Ga0070677_10129044 3300005333 Bacteria 1152
35 Ga0068869_100001602 3300005334 Bacteria 13459
36 Ga0068869_100008924 3300005334 Bacteria 6489
37 Ga0068869_100041422 3300005334 Bacteria 3298
38 Ga0070666_10472212 3300005335 Bacteria 907
39 Ga0070680_100060434 3300005336 Bacteria 3101
40 Ga0070682_100149571 3300005337 Bacteria 1601
41 Ga0068868_100000817 3300005338 Bacteria 21119
42 Ga0068868_100012461 3300005338 Bacteria 6217
43 Ga0068868_100012926 3300005338 Bacteria 6107
44 Ga0068868_100028037 3300005338 Bacteria 4301
45 Ga0068868_100283886 3300005338 Bacteria 1402
46 Ga0070660_100019566 3300005339 Bacteria 4964
47 Ga0070689_100592452 3300005340 Bacteria 959
48 Ga0070661_100003596 3300005344 Bacteria 10673
49 Ga0070661_100120828 3300005344 Bacteria 1962
50 Ga0070661_100129066 3300005344 Bacteria 1898
51 Ga0070668_100028025 3300005347 Bacteria 4275
52 Ga0070668_100072039 3300005347 Bacteria 2692
53 Ga0070669_100064263 3300005353 Bacteria 2702
54 Ga0070669_100077881 3300005353 Bacteria 2464
55 Ga0070669_100095691 3300005353 Bacteria 2233
56 Ga0070669_100543249 3300005353 Bacteria 968
57 Ga0070675_100000645 3300005354 Bacteria 24112
58 Ga0070675_100002008 3300005354 Bacteria 15087
59 Ga0070675_100006349 3300005354 Bacteria 9077
60 Ga0070675_100008417 3300005354 Bacteria 8005
61 Ga0070675_100257792 3300005354 Bacteria 1528
62 Ga0070675_100559785 3300005354 Bacteria 1034
63 Ga0070675_100575884 3300005354 Bacteria 1020
64 Ga0070671_100000447 3300005355 Bacteria 28650
65 Ga0070671_100004894 3300005355 Bacteria 10657
66 Ga0070671_100012144 3300005355 Bacteria 6931
67 Ga0070671_100039651 3300005355 Bacteria 3910
68 Ga0070671_100091425 3300005355 Bacteria 2549
69 Ga0070671_100097029 3300005355 Bacteria 2472
70 Ga0070671_100318707 3300005355 Bacteria 1325
71 Ga0070671_100344048 3300005355 Bacteria 1272
72 Ga0070671_100740940 3300005355 Bacteria 854
73 Ga0070674_100023022 3300005356 Bacteria 4025
74 Ga0070674_100144153 3300005356 Bacteria 1791
75 Ga0070673_100000849 3300005364 Bacteria 17119
76 Ga0070673_100006404 3300005364 Bacteria 7653
77 Ga0070673_100007948 3300005364 Bacteria 7028
78 Ga0070673_100024638 3300005364 Bacteria 4416
79 Ga0070673_100373709 3300005364 Bacteria 1269
80 Ga0070688_100149596 3300005365 Bacteria 1595
81 Ga0070659_100039255 3300005366 Bacteria 3695
82 Ga0070659_100422239 3300005366 Bacteria 1128
83 Ga0070659_100466649 3300005366 Bacteria 1073
84 Ga0070667_100005214 3300005367 Bacteria 10863
85 Ga0070667_100047562 3300005367 Bacteria 3609
86 Ga0070667_100072903 3300005367 Bacteria 2927
87 Ga0070667_100125838 3300005367 Bacteria 2233
88 Ga0070667_100132594 3300005367 Bacteria 2176
89 Ga0070667_100151538 3300005367 Bacteria 2037
90 Ga0070700_100045554 3300005441 Bacteria 2706
91 Ga0070700_100768326 3300005441 Bacteria 773
92 Ga0070708_100622855 3300005445 Bacteria 1017
93 Ga0070663_100019782 3300005455 Bacteria 4445
94 Ga0070663_100286836 3300005455 Bacteria 1313
95 Ga0070663_100297830 3300005455 Bacteria 1290
96 Ga0070678_100002278 3300005456 Bacteria 10445
97 Ga0070678_100009433 3300005456 Bacteria 5914
98 Ga0070678_100039805 3300005456 Bacteria 3320
99 Ga0070678_100512661 3300005456 Bacteria 1060
100 Ga0070678_100535740 3300005456 Bacteria 1038
101 Ga0070662_100002751 3300005457 Bacteria 10876
102 Ga0070662_100072992 3300005457 Bacteria 2535
103 Ga0070662_100119282 3300005457 Bacteria 2020
104 Ga0070662_100144365 3300005457 Bacteria 1847
105 Ga0070662_100147009 3300005457 Bacteria 1832
106 Ga0070662_100375703 3300005457 Bacteria 1169
107 Ga0070662_100795538 3300005457 Bacteria 804
108 Ga0070681_10257814 3300005458 Bacteria 1656
109 Ga0070681_10321116 3300005458 Bacteria 1458
110 Ga0068867_100003138 3300005459 Bacteria 11652
111 Ga0068867_100071226 3300005459 Bacteria 2600
112 Ga0068867_100108540 3300005459 Bacteria 2129
113 Ga0068867_100161169 3300005459 Bacteria 1769
114 Ga0068867_100677582 3300005459 Bacteria 908
115 Ga0070706_100003875 3300005467 Bacteria 14614
116 Ga0070707_100247756 3300005468 Bacteria 1734
117 Ga0070679_100008455 3300005530 Bacteria 9689
118 Ga0070684_100055276 3300005535 Bacteria 3460
119 Ga0070684_100088787 3300005535 Bacteria 2747
120 Ga0068853_100183854 3300005539 Bacteria 1896
121 Ga0068853_100557199 3300005539 Bacteria 1086
122 Ga0068853_101375436 3300005539 Bacteria 683
123 Ga0070672_100003527 3300005543 Bacteria 10133
124 Ga0070672_100016440 3300005543 Bacteria 5297
125 Ga0070672_100043773 3300005543 Bacteria 3455
126 Ga0070672_100078947 3300005543 Bacteria 2634
127 Ga0070672_100122290 3300005543 Bacteria 2132
128 Ga0070672_100140357 3300005543 Bacteria 1992
129 Ga0070672_100200255 3300005543 Bacteria 1670
130 Ga0070672_100235637 3300005543 Bacteria 1538
131 Ga0070693_100045157 3300005547 Bacteria 2496
132 Ga0070693_100061519 3300005547 Bacteria 2183
133 Ga0070693_100157758 3300005547 Bacteria 1442
134 Ga0070665_100294192 3300005548 Bacteria 1626
135 Ga0068855_100035319 3300005563 Bacteria 5954
136 Ga0070664_100005318 3300005564 Bacteria 10330
137 Ga0070664_100153427 3300005564 Bacteria 2034
138 Ga0070664_100171342 3300005564 Bacteria 1925
139 Ga0070664_100411334 3300005564 Bacteria 1238
140 Ga0070664_100648113 3300005564 Bacteria 981
141 Ga0068857_100006324 3300005577 Bacteria 10141
142 Ga0068857_100008703 3300005577 Bacteria 8784
143 Ga0068857_100769954 3300005577 Bacteria 918
144 Ga0068854_100059166 3300005578 Bacteria 2768
145 Ga0068854_100247735 3300005578 Bacteria 1421
146 Ga0068854_100654128 3300005578 Bacteria 902
147 Ga0068856_100016721 3300005614 Bacteria 7106
148 Ga0068856_101148368 3300005614 Bacteria 794
149 Ga0070702_100199288 3300005615 Bacteria 1324
150 Ga0068852_100006482 3300005616 Bacteria 8460
151 Ga0068852_100009825 3300005616 Bacteria 7116
152 Ga0068852_100224370 3300005616 Bacteria 1788
153 Ga0068852_100391734 3300005616 Bacteria 1365
154 Ga0068852_100611801 3300005616 Bacteria 1095
155 Ga0068852_100986814 3300005616 Bacteria 861
156 Ga0068852_101863798 3300005616 Bacteria 624
157 Ga0068859_100010902 3300005617 Bacteria 9149
158 Ga0068859_100056464 3300005617 Bacteria 3952
159 Ga0068864_100010764 3300005618 Bacteria 7560
160 Ga0068864_100020157 3300005618 Bacteria 5578
161 Ga0068864_100023365 3300005618 Bacteria 5191
162 Ga0068864_100028825 3300005618 Bacteria 4697
163 Ga0068864_100059015 3300005618 Bacteria 3318
164 Ga0068864_100190555 3300005618 Bacteria 1879
165 Ga0068864_100290483 3300005618 Bacteria 1528
166 Ga0068866_10081591 3300005718 Bacteria 1738
167 Ga0068861_100012100 3300005719 Bacteria 6014
168 Ga0068861_100013496 3300005719 Bacteria 5719
169 Ga0068861_100121653 3300005719 Bacteria 2106
170 Ga0068861_100496416 3300005719 Bacteria 1102
171 Ga0068851_10001882 3300005834 Bacteria 9216
172 Ga0068851_10036429 3300005834 Bacteria 2463
173 Ga0068851_10446899 3300005834 Bacteria 768
174 Ga0068870_10006257 3300005840 Bacteria 5240
175 Ga0068863_100017066 3300005841 Bacteria 6963
176 Ga0068863_100036728 3300005841 Bacteria 4666
177 Ga0068863_100114107 3300005841 Bacteria 2574
178 Ga0068863_100178683 3300005841 Bacteria 2037
179 Ga0068863_100182471 3300005841 Bacteria 2014
180 Ga0068863_100183328 3300005841 Bacteria 2010
181 Ga0068858_100001778 3300005842 Bacteria 21987
182 Ga0068858_100003042 3300005842 Bacteria 16806
183 Ga0068858_100009320 3300005842 Bacteria 9373
184 Ga0068858_100274611 3300005842 Bacteria 1604
185 Ga0068860_100001532 3300005843 Bacteria 24896
186 Ga0068860_100011063 3300005843 Bacteria 8896
187 Ga0068860_100021372 3300005843 Bacteria 6266
188 Ga0068860_100059376 3300005843 Bacteria 3636
189 Ga0068860_100132361 3300005843 Bacteria 2394
190 Ga0068860_100255321 3300005843 Bacteria 1708
191 Ga0068860_100484125 3300005843 Bacteria 1233
192 Ga0068862_100138670 3300005844 Bacteria 2157
193 Ga0068862_100390621 3300005844 Bacteria 1300
194 Ga0068862_100954913 3300005844 Bacteria 845
195 Ga0075365_10393226 3300006038 Bacteria 978
196 Ga0075365_10546472 3300006038 Bacteria 819
197 Ga0075368_10051329 3300006042 Bacteria 1640
198 Ga0075368_10085703 3300006042 Bacteria 1285
199 Ga0075368_10188365 3300006042 Bacteria 871
200 Ga0075363_100032654 3300006048 Bacteria 2705
201 Ga0075363_100041736 3300006048 Bacteria 2421
202 Ga0075363_100087293 3300006048 Bacteria 1713
203 Ga0075363_100349994 3300006048 Bacteria 863
204 Ga0075363_100647143 3300006048 Bacteria 636
205 Ga0075364_10021140 3300006051 Bacteria 4099
206 Ga0075364_10116017 3300006051 Bacteria 1790
207 Ga0075364_10252708 3300006051 Bacteria 1198
208 Ga0075364_10394652 3300006051 Bacteria 944
209 Ga0070716_100218091 3300006173 Bacteria 1280
210 Ga0075362_10010612 3300006177 Bacteria 3603
211 Ga0075362_10077845 3300006177 Bacteria 1524
212 Ga0075362_10210738 3300006177 Bacteria 948
213 Ga0075362_10246626 3300006177 Bacteria 878
214 Ga0075367_10000994 3300006178 Bacteria 11616
215 Ga0075367_10025190 3300006178 Bacteria 3362
216 Ga0075367_10036883 3300006178 Bacteria 2837
217 Ga0075367_10058602 3300006178 Bacteria 2292
218 Ga0075367_10074223 3300006178 Bacteria 2051
219 Ga0075367_10143686 3300006178 Bacteria 1479
220 Ga0075367_10168971 3300006178 Bacteria 1362
221 Ga0075369_10006340 3300006186 Bacteria 4469
222 Ga0075369_10011393 3300006186 Bacteria 3499
223 Ga0075366_10000338 3300006195 Bacteria 21537
224 Ga0075366_10000572 3300006195 Bacteria 17243
225 Ga0075366_10003160 3300006195 Bacteria 8625
226 Ga0075366_10021751 3300006195 Bacteria 3729
227 Ga0075366_10048018 3300006195 Bacteria 2530
228 Ga0075366_10062613 3300006195 Bacteria 2211
229 Ga0075366_10143035 3300006195 Bacteria 1447
230 Ga0075366_10146639 3300006195 Bacteria 1428
231 Ga0075366_10175928 3300006195 Bacteria 1299
232 Ga0075366_10202070 3300006195 Bacteria 1209
233 Ga0075366_10292567 3300006195 Bacteria 996
234 Ga0097621_100010835 3300006237 Bacteria 6688
235 Ga0097621_100111553 3300006237 Bacteria 2311
236 Ga0097621_100139768 3300006237 Bacteria 2069
237 Ga0097621_100614233 3300006237 Bacteria 995
238 Ga0075370_10000078 3300006353 Bacteria 29531
239 Ga0075370_10001594 3300006353 Bacteria 9991
240 Ga0075370_10008748 3300006353 Bacteria 5223
241 Ga0075370_10013700 3300006353 Bacteria 4315
242 Ga0075370_10027744 3300006353 Bacteria 3144
243 Ga0068871_100027802 3300006358 Bacteria 4428
244 Ga0068871_100029851 3300006358 Bacteria 4287
245 Ga0068871_100086047 3300006358 Bacteria 2611
246 Ga0068871_100916051 3300006358 Bacteria 813
247 Ga0068865_100081934 3300006881 Bacteria 2319
248 Ga0068865_100191108 3300006881 Bacteria 1583
249 Ga0097620_100010902 3300006931 Bacteria 9149
250 Ga0097620_100056463 3300006931 Bacteria 3952
251 Ga0079104_1000027 3300006946 Bacteria 212641
252 Ga0075435_100352270 3300007076 Bacteria 1262
253 Ga0105244_10095889 3300009036 Bacteria 1455
254 Ga0105250_10000066 3300009092 Bacteria 100012
255 Ga0105245_10011416 3300009098 Bacteria 7734
256 Ga0105245_10033697 3300009098 Bacteria 4539
257 Ga0105245_10717010 3300009098 Bacteria 1034
258 Ga0105245_10837162 3300009098 Bacteria 960
259 Ga0105247_10441980 3300009101 Bacteria 936
260 Ga0105247_10589527 3300009101 Bacteria 823
261 Ga0105243_10021378 3300009148 Bacteria 4910
262 Ga0105243_10030960 3300009148 Bacteria 4123
263 Ga0105243_10075579 3300009148 Bacteria 2735
264 Ga0105241_10209396 3300009174 Bacteria 1633
265 Ga0105242_10173845 3300009176 Bacteria 1895
266 Ga0105242_10591182 3300009176 Bacteria 1071
267 Ga0105242_10865110 3300009176 Bacteria 901
268 Ga0105242_10947910 3300009176 Bacteria 864
269 Ga0105242_11572786 3300009176 Bacteria 690
270 Ga0105248_10009834 3300009177 Bacteria 10536
271 Ga0105248_10028210 3300009177 Bacteria 6252
272 Ga0105248_10033846 3300009177 Bacteria 5710
273 Ga0105248_10034665 3300009177 Bacteria 5647
274 Ga0105248_10280827 3300009177 Bacteria 1875
275 Ga0105248_10327842 3300009177 Bacteria 1724
276 Ga0105248_10382586 3300009177 Bacteria 1585
277 Ga0105248_10609014 3300009177 Bacteria 1232
278 Ga0105237_10108754 3300009545 Bacteria 2763
279 Ga0105237_10135165 3300009545 Bacteria 2460
280 Ga0105237_10191308 3300009545 Bacteria 2046
281 Ga0105238_10048218 3300009551 Bacteria 4294
282 Ga0105249_10007703 3300009553 Bacteria 9382
283 Ga0105249_10101350 3300009553 Bacteria 2708
284 Ga0105249_10189177 3300009553 Bacteria 2008
285 Ga0105239_10044544 3300010375 Bacteria 4863
286 Ga0105246_10116960 3300011119 Bacteria 1969
287 Ga0157371_10050840 3300013102 Bacteria 2946
288 Ga0157371_10278416 3300013102 Bacteria 1208
289 Ga0157369_10012395 3300013105 Bacteria 9679
290 Ga0157369_10494080 3300013105 Bacteria 1266
291 Ga0157369_10737838 3300013105 Bacteria 1013
292 Ga0157374_10020102 3300013296 Bacteria 5921
293 Ga0157374_10094104 3300013296 Bacteria 2863
294 Ga0157374_10127395 3300013296 Bacteria 2461
295 Ga0157374_10155549 3300013296 Bacteria 2225
296 Ga0157374_10259799 3300013296 Bacteria 1710
297 Ga0157378_10007346 3300013297 Bacteria 9626
298 Ga0157378_10165579 3300013297 Bacteria 2071
299 Ga0157378_10251920 3300013297 Bacteria 1691
300 Ga0163162_10004496 3300013306 Bacteria 13433
301 Ga0163162_10007911 3300013306 Bacteria 10361
302 Ga0163162_10049229 3300013306 Bacteria 4224
303 Ga0163162_10077704 3300013306 Bacteria 3383
304 Ga0163162_10141278 3300013306 Bacteria 2521
305 Ga0163162_10147959 3300013306 Bacteria 2465
306 Ga0163162_10309648 3300013306 Bacteria 1712
307 Ga0157372_10006672 3300013307 Bacteria 12280
308 Ga0157372_10112467 3300013307 Bacteria 3120
309 Ga0157375_10002273 3300013308 Bacteria 16621
310 Ga0157375_10002432 3300013308 Bacteria 16129
311 Ga0157375_10013048 3300013308 Bacteria 7383
312 Ga0157375_10032562 3300013308 Bacteria 4945
313 Ga0157375_10049207 3300013308 Bacteria 4129
314 Ga0157375_10061488 3300013308 Bacteria 3729
315 Ga0157375_10100746 3300013308 Bacteria 2970
316 Ga0157375_10866469 3300013308 Bacteria 1049
317 Ga0157375_11678172 3300013308 Bacteria 752
318 Ga0163163_10068734 3300014325 Bacteria 3525
319 Ga0157380_10050406 3300014326 Bacteria 3288
320 Ga0157380_10072379 3300014326 Bacteria 2792
321 Ga0157380_10745078 3300014326 Bacteria 990
322 Ga0157377_10001827 3300014745 Bacteria 9282
323 Ga0157379_10000831 3300014968 Bacteria 25043
324 Ga0157379_10002292 3300014968 Bacteria 15954
325 Ga0157379_10060808 3300014968 Bacteria 3378
326 Ga0157379_10195358 3300014968 Bacteria 1829
327 Ga0157376_10015083 3300014969 Bacteria 5826
328 Ga0157376_10025024 3300014969 Bacteria 4697
329 Ga0157376_10074130 3300014969 Bacteria 2901
330 Ga0157376_10116532 3300014969 Bacteria 2360
331 Ga0157376_10471311 3300014969 Bacteria 1229
332 Ga0157376_11400390 3300014969 Bacteria 731
333 Ga0163161_10029665 3300017792 Bacteria 3889
334 Ga0163161_10191652 3300017792 Bacteria 1572
335 Ga0163161_10221218 3300017792 Bacteria 1466
336 Ga0206353_11891134 3300020082 Bacteria 990
337 Ga0213874_10083972 3300021377 Bacteria 1036
338 Ga0207673_1003255 3300025290 Bacteria 1893
339 Ga0207656_10002935 3300025321 Bacteria 5816
340 Ga0207656_10098347 3300025321 Bacteria 1338
341 Ga0207696_1001715 3300025711 Bacteria 11373
342 Ga0207682_10127223 3300025893 Bacteria 1135
343 Ga0207642_10093309 3300025899 Bacteria 1492
344 Ga0207642_10246594 3300025899 Bacteria 1011
345 Ga0207688_10014425 3300025901 Bacteria 4295
346 Ga0207688_10186816 3300025901 Bacteria 1238
347 Ga0207688_10314867 3300025901 Bacteria 959
348 Ga0207680_10038552 3300025903 Bacteria 2766
349 Ga0207647_10186611 3300025904 Bacteria 1203
350 Ga0207645_10002401 3300025907 Bacteria 14741
351 Ga0207645_10020877 3300025907 Bacteria 4279
352 Ga0207645_10021707 3300025907 Bacteria 4184
353 Ga0207643_10016863 3300025908 Bacteria 3984
354 Ga0207705_10205893 3300025909 Bacteria 1491
355 Ga0207705_10331212 3300025909 Bacteria 1171
356 Ga0207684_10006507 3300025910 Bacteria 10647
357 Ga0207654_10289056 3300025911 Bacteria 1111
358 Ga0207707_10045834 3300025912 Bacteria 3809
359 Ga0207671_10047573 3300025914 Bacteria 3175
360 Ga0207671_10110420 3300025914 Bacteria 2092
361 Ga0207660_10213625 3300025917 Bacteria 1511
362 Ga0207660_10486365 3300025917 Bacteria 1000
363 Ga0207662_10022664 3300025918 Bacteria 3603
364 Ga0207662_10214491 3300025918 Bacteria 1251
365 Ga0207657_10174343 3300025919 Bacteria 1741
366 Ga0207657_10190536 3300025919 Bacteria 1654
367 Ga0207649_10008521 3300025920 Bacteria 5592
368 Ga0207649_10109774 3300025920 Bacteria 1841
369 Ga0207649_10159609 3300025920 Bacteria 1561
370 Ga0207652_10010316 3300025921 Bacteria 7522
371 Ga0207652_11086502 3300025921 Bacteria 700
372 Ga0207681_10017756 3300025923 Bacteria 4472
373 Ga0207681_10376435 3300025923 Bacteria 1142
374 Ga0207694_10151877 3300025924 Bacteria 1866
375 Ga0207650_10015100 3300025925 Bacteria 5373
376 Ga0207650_10034296 3300025925 Bacteria 3680
377 Ga0207650_10203415 3300025925 Bacteria 1587
378 Ga0207650_10339946 3300025925 Bacteria 1233
379 Ga0207650_10340255 3300025925 Bacteria 1232
380 Ga0207659_10000294 3300025926 Bacteria 30347
381 Ga0207659_10021665 3300025926 Bacteria 4270
382 Ga0207659_10033410 3300025926 Bacteria 3541
383 Ga0207659_10210303 3300025926 Bacteria 1559
384 Ga0207659_10401009 3300025926 Bacteria 1147
385 Ga0207687_10098665 3300025927 Bacteria 2145
386 Ga0207644_10000271 3300025931 Bacteria 34644
387 Ga0207644_10006430 3300025931 Bacteria 7658
388 Ga0207644_10025499 3300025931 Bacteria 4065
389 Ga0207644_10057898 3300025931 Bacteria 2799
390 Ga0207644_10067917 3300025931 Bacteria 2599
391 Ga0207644_10109188 3300025931 Bacteria 2090
392 Ga0207644_10188781 3300025931 Bacteria 1619
393 Ga0207644_10771878 3300025931 Bacteria 803
394 Ga0207690_10220109 3300025932 Bacteria 1452
395 Ga0207690_10987787 3300025932 Bacteria 700
396 Ga0207706_10007092 3300025933 Bacteria 10366
397 Ga0207706_10038544 3300025933 Bacteria 4239
398 Ga0207706_10076383 3300025933 Bacteria 2946
399 Ga0207706_10196611 3300025933 Bacteria 1769
400 Ga0207686_10116303 3300025934 Bacteria 1812
401 Ga0207709_10000783 3300025935 Bacteria 24875
402 Ga0207709_10033518 3300025935 Bacteria 3017
403 Ga0207670_10008173 3300025936 Bacteria 5891
404 Ga0207669_10171256 3300025937 Bacteria 1545
405 Ga0207669_10436699 3300025937 Bacteria 1034
406 Ga0207704_10050918 3300025938 Bacteria 2501
407 Ga0207704_10065583 3300025938 Bacteria 2274
408 Ga0207704_10096454 3300025938 Bacteria 1958
409 Ga0207704_10216495 3300025938 Bacteria 1414
410 Ga0207665_10490192 3300025939 Bacteria 948
411 Ga0207691_10002171 3300025940 Bacteria 19187
412 Ga0207691_10015460 3300025940 Bacteria 7257
413 Ga0207691_10038643 3300025940 Bacteria 4417
414 Ga0207691_10076681 3300025940 Bacteria 3012
415 Ga0207691_10133561 3300025940 Bacteria 2191
416 Ga0207691_10207396 3300025940 Bacteria 1704
417 Ga0207691_10898551 3300025940 Bacteria 742
418 Ga0207711_10018082 3300025941 Bacteria 5860
419 Ga0207711_10038940 3300025941 Bacteria 4043
420 Ga0207711_10043971 3300025941 Bacteria 3811
421 Ga0207711_10166962 3300025941 Bacteria 1995
422 Ga0207711_10190839 3300025941 Bacteria 1867
423 Ga0207689_10001229 3300025942 Bacteria 24643
424 Ga0207689_10036508 3300025942 Bacteria 4079
425 Ga0207689_10046964 3300025942 Bacteria 3567
426 Ga0207661_10265137 3300025944 Bacteria 1531
427 Ga0207679_10144055 3300025945 Bacteria 1930
428 Ga0207679_10717053 3300025945 Bacteria 908
429 Ga0207667_10050241 3300025949 Bacteria 4400
430 Ga0207651_10002910 3300025960 Bacteria 8266
431 Ga0207651_10005880 3300025960 Bacteria 6346
432 Ga0207651_10099534 3300025960 Bacteria 2153
433 Ga0207651_10332487 3300025960 Bacteria 1274
434 Ga0207651_10479777 3300025960 Bacteria 1071
435 Ga0207712_10992936 3300025961 Bacteria 745
436 Ga0207668_10071745 3300025972 Bacteria 2475
437 Ga0207668_10473935 3300025972 Bacteria 1072
438 Ga0207640_10021415 3300025981 Bacteria 3852
439 Ga0207640_10284002 3300025981 Bacteria 1301
440 Ga0207640_11168614 3300025981 Bacteria 683
441 Ga0207640_11177783 3300025981 Bacteria 680
442 Ga0207658_10005475 3300025986 Bacteria 8703
443 Ga0207658_10059302 3300025986 Bacteria 2851
444 Ga0207658_10091920 3300025986 Bacteria 2356
445 Ga0207658_10471495 3300025986 Bacteria 1114
446 Ga0207658_10598878 3300025986 Bacteria 990
447 Ga0207677_10001260 3300026023 Bacteria 13640
448 Ga0207677_10018379 3300026023 Bacteria 4194
449 Ga0207677_10053748 3300026023 Bacteria 2744
450 Ga0207677_10211503 3300026023 Bacteria 1549
451 Ga0207677_10219044 3300026023 Bacteria 1525
452 Ga0207677_10907588 3300026023 Bacteria 794
453 Ga0207703_10002318 3300026035 Bacteria 16623
454 Ga0207703_10004141 3300026035 Bacteria 11961
455 Ga0207703_10242822 3300026035 Bacteria 1620
456 Ga0207703_10775736 3300026035 Bacteria 914
457 Ga0207703_11183016 3300026035 Bacteria 735
458 Ga0207639_10039137 3300026041 Bacteria 3531
459 Ga0207639_10746819 3300026041 Bacteria 910
460 Ga0207678_10024832 3300026067 Bacteria 5232
461 Ga0207678_10029296 3300026067 Bacteria 4804
462 Ga0207678_10105464 3300026067 Bacteria 2405
463 Ga0207678_10144900 3300026067 Bacteria 2027
464 Ga0207708_10019968 3300026075 Bacteria 5052
465 Ga0207708_10777722 3300026075 Bacteria 823
466 Ga0207702_10074645 3300026078 Bacteria 2927
467 Ga0207641_10002118 3300026088 Bacteria 18764
468 Ga0207641_10033231 3300026088 Bacteria 4286
469 Ga0207641_10061994 3300026088 Bacteria 3190
470 Ga0207641_10071329 3300026088 Bacteria 2987
471 Ga0207641_10106169 3300026088 Bacteria 2482
472 Ga0207641_10139612 3300026088 Bacteria 2185
473 Ga0207648_10007552 3300026089 Bacteria 10669
474 Ga0207648_10008627 3300026089 Bacteria 9851
475 Ga0207648_10070648 3300026089 Bacteria 3043
476 Ga0207648_10141072 3300026089 Bacteria 2123
477 Ga0207648_10218673 3300026089 Bacteria 1693
478 Ga0207648_10402468 3300026089 Bacteria 1240
479 Ga0207648_10625592 3300026089 Bacteria 994
480 Ga0207676_10000529 3300026095 Bacteria 32022
481 Ga0207676_10014031 3300026095 Bacteria 5754
482 Ga0207676_10107171 3300026095 Bacteria 2330
483 Ga0207676_10273976 3300026095 Bacteria 1529
484 Ga0207676_10494790 3300026095 Bacteria 1160
485 Ga0207676_10869916 3300026095 Bacteria 882
486 Ga0207674_10009772 3300026116 Bacteria 10928
487 Ga0207674_10019048 3300026116 Bacteria 7438
488 Ga0207674_10047833 3300026116 Bacteria 4382
489 Ga0207674_10596426 3300026116 Bacteria 1067
490 Ga0207675_100001299 3300026118 Bacteria 25047
491 Ga0207675_100018432 3300026118 Bacteria 6509
492 Ga0207675_100020087 3300026118 Bacteria 6230
493 Ga0207675_100034019 3300026118 Bacteria 4749
494 Ga0207683_10001558 3300026121 Bacteria 20630
495 Ga0207683_10009835 3300026121 Bacteria 8158
496 Ga0207683_10063417 3300026121 Bacteria 3255
497 Ga0207683_10085082 3300026121 Bacteria 2811
498 Ga0207683_10281626 3300026121 Bacteria 1519
499 Ga0207683_10373532 3300026121 Bacteria 1310
500 Ga0207683_10662593 3300026121 Bacteria 967
501 Ga0207698_10032623 3300026142 Bacteria 3776
502 Ga0207698_10043100 3300026142 Bacteria 3378
503 Ga0207698_10082545 3300026142 Bacteria 2598
504 Ga0207698_10160617 3300026142 Bacteria 1965
505 Ga0207698_10499380 3300026142 Bacteria 1184
506 Ga0209281_1000002 3300027111 Bacteria 1924012
507 Ga0209995_1013289 3300027471 Bacteria 1348
508 Ga0209968_1001280 3300027526 Bacteria 3838
509 Ga0209966_1000052 3300027695 Bacteria 50827
510 Ga0209813_10012524 3300027866 Bacteria 2245
511 Ga0209813_10014393 3300027866 Bacteria 2129
512 Ga0209974_10013878 3300027876 Bacteria 2684
513 Ga0268266_10054888 3300028379 Bacteria 3424
514 Ga0268266_10818338 3300028379 Bacteria 900
515 Ga0268265_10120375 3300028380 Bacteria 2162
516 Ga0268264_10007004 3300028381 Bacteria 9460
517 Ga0268264_10020606 3300028381 Bacteria 5387
518 Ga0268264_10026590 3300028381 Bacteria 4729
519 Ga0268264_10177745 3300028381 Bacteria 1930
520 Ga0307517_10000150 3300028786 Bacteria 110446
521 Ga0307517_10115049 3300028786 Bacteria 2021
522 Ga0307517_10169646 3300028786 Bacteria 1438
523 Ga0307515_10021958 3300028794 Bacteria 11281
524 Ga0307515_10036892 3300028794 Bacteria 7885
525 Ga0307515_10188302 3300028794 Bacteria 1984
526 Ga0307515_10223085 3300028794 Bacteria 1697
527 Ga0307515_10442224 3300028794 Bacteria 917
528 Ga0307512_10034669 3300030522 Bacteria 4314
529 Ga0307513_10010461 3300031456 Bacteria 11629
530 Ga0307513_10031788 3300031456 Bacteria 5969
531 Ga0307513_10174407 3300031456 Bacteria 2023
532 Ga0307509_10000854 3300031507 Bacteria 52492
533 Ga0307509_10079378 3300031507 Bacteria 3397
534 Ga0307509_10124674 3300031507 Bacteria 2545
535 Ga0307509_10332379 3300031507 Bacteria 1251
536 Ga0307508_10013671 3300031616 Bacteria 7411
537 Ga0307508_10076985 3300031616 Bacteria 2914
538 Ga0307508_10106665 3300031616 Bacteria 2400
539 Ga0307508_10332606 3300031616 Bacteria 1110
540 Ga0307516_10001996 3300031730 Bacteria 27905
541 Ga0307516_10012323 3300031730 Bacteria 9224
542 Ga0307516_10235711 3300031730 Bacteria 1531
543 Ga0307516_10440189 3300031730 Bacteria 960
544 Ga0307413_10355417 3300031824 Bacteria 1132
545 Ga0307409_100007060 3300031995 Bacteria 6683
546 Ga0307416_100000264 3300032002 Bacteria 27854
547 Ga0307414_10969790 3300032004 Bacteria 782
548 Ga0307411_10588687 3300032005 Bacteria 955
549 Ga0307415_100001450 3300032126 Bacteria 11365
550 Ga0307507_10154471 3300033179 Bacteria 1715
551 Ga0307510_10014085 3300033180 Bacteria 9470
552 Ga0307510_10068950 3300033180 Bacteria 3545
553 Ga0307510_10303518 3300033180 Bacteria 1058
554 Ga0373926_0047320 3300035083 Bacteria 1545
555 Ga0373944_0014471 3300035089 Bacteria 2202
556 Ga0373923_0054013 3300035111 Bacteria 1690
557 Ga0373932_0248945 3300035112 Bacteria 648
558 Ga0373953_0236901 3300035117 Bacteria 792
559 Ga0373946_0222080 3300035171 Bacteria 913
560 Ga0373955_0025375 3300035172 Bacteria 3043
561 Ga0373955_0105093 3300035172 Bacteria 1626
562 Ga0373955_0232121 3300035172 Bacteria 1104
563 Ga0373962_0027988 3300035242 Bacteria 1527
564 Ga0373931_0027606 3300035691 Bacteria 2899
565 Ga0373935_0101308 3300035692 Bacteria 1899
566 Ga0373935_0342623 3300035692 Bacteria 1064
567 Ga0373927_0170934 3300035695 Bacteria 1425
568 Ga0373933_0294654 3300035724 Bacteria 1050
569 Ga0373937_0023021 3300036401 Bacteria 5604
570 Ga0373937_0296720 3300036401 Bacteria 1527
571 Ga0373925_0035452 3300037068 Bacteria 3681
572 Ga0436363_1145370 3300039450 Bacteria 1236
573 Ga0451793_0370606 3300041452 Bacteria 1623
574 Ga0451793_0827258 3300041452 Bacteria 1095
575 Ga0451798_0658955 3300041458 Bacteria 1098
576 Ga0451851_1293312 3300041507 Bacteria 852
577 Ga0451855_0889723 3300041511 Bacteria 910
578 Ga0451853_1340569 3300041512 Bacteria 4407
579 Ga0451853_2476695 3300041512 Bacteria 1021
580 Ga0451853_2949518 3300041512 Bacteria 1573
581 Ga0451577_0793418 3300042876 Bacteria 856
582 Ga0453684_0246295 3300044712 Bacteria 2055
583 Ga0453684_0337786 3300044712 Bacteria 1702
584 Ga0451576_0050941 3300045051 Bacteria 4342
585 Ga0495592_0000468 3300046454 Bacteria 29698
586 Ga0495603_0615918 3300046455 Bacteria 621
587 Ga0495590_0019699 3300046457 Bacteria 2401
588 Ga0495639_0143038 3300046475 Bacteria 1151
589 Ga0495662_0476374 3300046476 Bacteria 612
590 Ga0495585_0390071 3300046492 Bacteria 672
591 Ga0495607_0038242 3300046501 Bacteria 2875
592 Ga0495606_0081765 3300046507 Bacteria 2007
593 Ga0495610_0039941 3300046512 Bacteria 2369
594 Ga0495610_0128320 3300046512 Bacteria 1104
595 Ga0495620_0089815 3300046515 Bacteria 1234
596 Ga0495632_0095277 3300046519 Bacteria 1407
597 Ga0495643_0035786 3300046522 Bacteria 2732
598 Ga0495648_0172098 3300046524 Bacteria 1109
599 Ga0495666_0036886 3300046526 Bacteria 2380
600 Ga0495642_0280035 3300046528 Bacteria 730
601 Ga0495640_0494869 3300046533 Bacteria 744
602 Ga0495586_0084861 3300046535 Bacteria 1744
603 Ga0495598_0042641 3300046537 Bacteria 1333
604 Ga0495621_0121241 3300046539 Bacteria 1011
605 Ga0495597_0000105 3300046542 Bacteria 75105
606 Ga0495597_0079995 3300046542 Bacteria 1399
607 Ga0495645_0129388 3300046543 Bacteria 1771
608 Ga0495622_0097136 3300046557 Bacteria 1351
609 Ga0495611_0149019 3300046648 Bacteria 1092
610 Ga0495625_0014128 3300046660 Bacteria 6390
611 Ga0495625_0015885 3300046660 Bacteria 5941
612 Ga0495635_0307240 3300046663 Bacteria 1063
613 Ga0495599_0168667 3300046678 Bacteria 1351
614 Ga0495599_0264270 3300046678 Bacteria 1045
615 Ga0495647_0109269 3300046681 Bacteria 1153
616 Ga0495647_0189294 3300046681 Bacteria 898
617 Ga0495658_0091900 3300046683 Bacteria 1798
618 Ga0495658_0202274 3300046683 Bacteria 1238
619 Ga0495658_0335902 3300046683 Bacteria 959
620 Ga0495613_0054625 3300046689 Bacteria 2936
621 Ga0495670_0372618 3300046691 Bacteria 770
622 Ga0495649_0000490 3300046694 Bacteria 33953
623 Ga0495660_0037547 3300046810 Bacteria 2697
624 Ga0495676_0070779 3300047321 Bacteria 2684
625 Ga0495687_005678 3300047443 Bacteria 7878
626 Ga0495687_006139 3300047443 Bacteria 7445
627 Ga0495673_0068661 3300047469 Bacteria 1497
628 Ga0495684_0201910 3300047471 Bacteria 1465
629 Ga0495686_0009179 3300047472 Bacteria 7157
630 Ga0495686_0120087 3300047472 Bacteria 1568
631 Ga0495686_0129170 3300047472 Bacteria 1499
632 Ga0495626_0074245 3300048091 Bacteria 1522
633 Ga0496101_0055941 3300048904 Bacteria 2851
634 Ga0496101_0462943 3300048904 Bacteria 1001
635 Ga0496101_0545534 3300048904 Bacteria 917
636 Ga0496101_0701322 3300048904 Bacteria 799
637 Ga0496103_0112301 3300048906 Bacteria 1732
638 Ga0496105_0161058 3300048908 Bacteria 1842
639 Ga0496105_0413239 3300048908 Bacteria 1069
640 Ga0496106_0002400 3300048909 Bacteria 13956
641 Ga0496106_0111492 3300048909 Bacteria 2130
642 Ga0496106_0151329 3300048909 Bacteria 1831
643 Ga0496106_0705944 3300048909 Bacteria 804
644 Ga0496107_0134262 3300048910 Bacteria 1828
645 Ga0496108_0023077 3300048911 Bacteria 5118
646 Ga0496108_0023784 3300048911 Bacteria 5042
647 Ga0496108_0047569 3300048911 Bacteria 3586
648 Ga0496109_0054535 3300048912 Bacteria 3647
649 Ga0496110_0043425 3300048913 Bacteria 3925
650 Ga0496110_0111980 3300048913 Bacteria 2454
651 Ga0496110_0152289 3300048913 Bacteria 2094
652 Ga0496111_0327937 3300048914 Bacteria 1133
653 Ga0496112_0227860 3300048915 Bacteria 1818
654 Ga0496112_0482931 3300048915 Bacteria 1175
655 Ga0496113_0004694 3300048916 Bacteria 8429
656 Ga0496113_0309460 3300048916 Bacteria 1265
657 Ga0496114_0453552 3300048917 Bacteria 1135
658 Ga0496114_0460225 3300048917 Bacteria 1126
659 Ga0496114_0560414 3300048917 Bacteria 1009
660 Ga0496115_0150056 3300048918 Bacteria 1924
661 Ga0496123_0044147 3300048926 Bacteria 3051
662 Ga0496124_0219292 3300048927 Bacteria 1432
663 Ga0496125_0000484 3300048928 Bacteria 70115
664 Ga0496125_0095883 3300048928 Bacteria 2205
665 Ga0501306_011297 3300049127 Bacteria 1137
666 Ga0501306_022225 3300049127 Bacteria 894
667 Ga0501310_016099 3300049130 Bacteria 893
668 Ga0501324_013325 3300049540 Bacteria 778
669 nmdc:mga03683_175284_c1 3300050489 Bacteria 976
670 nmdc:mga03683_179905_c1 3300050489 Bacteria 964
671 nmdc:mga03683_27322_c1 3300050489 Bacteria 2258
672 nmdc:mga03683_85562_c1 3300050489 Bacteria 1368
673 nmdc:mga03n38_30182_c1 3300050490 Bacteria 2276
674 nmdc:mga03n38_7075_c1 3300050490 Bacteria 3944
675 nmdc:mga00v17_77617_c1 3300050491 Bacteria 2068
676 nmdc:mga0yw44_361824_c1 3300050492 Bacteria 978
677 nmdc:mga0k408_124709_c1 3300050493 Bacteria 1527
678 nmdc:mga0k408_13311_c1 3300050493 Bacteria 4509
679 nmdc:mga0k408_136893_c1 3300050493 Bacteria 1455
680 nmdc:mga0k408_14133_c1 3300050493 Bacteria 4392
681 nmdc:mga0k408_181098_c1 3300050493 Bacteria 1257
682 nmdc:mga0k408_201875_c1 3300050493 Bacteria 1187
683 nmdc:mga0k408_349852_c1 3300050493 Bacteria 881
684 nmdc:mga0k408_513_c1 3300050493 Bacteria 21294
685 nmdc:mga0k408_52521_c1 3300050493 Bacteria 2362
686 nmdc:mga06z11_107693_c1 3300050494 Bacteria 1539
687 nmdc:mga06z11_128821_c1 3300050494 Bacteria 1419
688 nmdc:mga06z11_1615_c1 3300050494 Bacteria 8419
689 nmdc:mga06z11_31901_c1 3300050494 Bacteria 2565
690 nmdc:mga04h51_18775_c1 3300050495 Bacteria 2041
691 nmdc:mga04h51_72322_c1 3300050495 Bacteria 1207
692 nmdc:mga07m45_111_c1 3300050496 Bacteria 32728
693 nmdc:mga07m45_12530_c1 3300050496 Bacteria 4483
694 nmdc:mga07m45_229683_c1 3300050496 Bacteria 1080
695 nmdc:mga07m45_392453_c1 3300050496 Bacteria 806
696 nmdc:mga07m45_67688_c1 3300050496 Bacteria 2030
697 nmdc:mga07m45_7608_c1 3300050496 Bacteria 5541
698 nmdc:mga07m45_956_c1 3300050496 Bacteria 12690
699 nmdc:mga08y16_375706_c1 3300050511 Bacteria 1457
700 nmdc:mga0rr50_711696_c1 3300050513 Bacteria 857
701 nmdc:mga0sz30_22904_c1 3300050516 Bacteria 2538
702 Ga0495601_0089120 3300053077 Bacteria 1984
703 Ga0495601_0115311 3300053077 Bacteria 1742
704 Ga0495601_0397468 3300053077 Bacteria 894
705 Ga0495595_0056528 3300053084 Bacteria 1829
706 Ga0495595_0167191 3300053084 Bacteria 1087
707 Ga0500578_0094922 3300053086 Bacteria 1892
708 Ga0500651_0004349 3300053093 Bacteria 7918
709 Ga0500651_0107521 3300053093 Bacteria 1705
710 Ga0500607_102171 3300053121 Bacteria 1422
711 Ga0500655_010862 3300053133 Bacteria 1646
712 Ga0500658_0005836 3300053134 Bacteria 4586
713 Ga0500559_0000069 3300053136 Bacteria 82288
714 Ga0500568_0015120 3300053139 Bacteria 3461
715 Ga0500622_0002191 3300053156 Bacteria 14440
716 Ga0500633_0015262 3300053160 Bacteria 2200
717 Ga0500636_0088601 3300053177 Bacteria 1775
718 Ga0500637_0488651 3300053178 Bacteria 614
719 Ga0500645_006293 3300053730 Bacteria 4258
720 2587755510 2585428062 Bacteria 6842168
721 2644301956 2643221654 Bacteria 5273570
722 2722886280 2721755523 Bacteria 6430384
723 2839141913 2839138175 Bacteria 6549354
724 nmdc:mga07m45_168854_c1
725 SwRhRL2b_contig_1478476
726 rootH1_10013796
727 rootL2_10098162
728 JGI26128J50194_1003503
729 Ga0058861_11619911
730 Ga0058861_12064541
731 Ga0058862_12783857
732 Ga0058862_12887129
733 Ga0065704_10265140
734 Ga0065715_10556065
735 Ga0070658_10060629
736 Ga0070658_10124126
737 Ga0070658_10206478
738 Ga0070676_10006586
739 Ga0070676_10007272
740 Ga0070676_10030031
741 Ga0070676_10214649
742 Ga0070683_100006074
743 Ga0070683_100080496
744 Ga0070683_100093039
745 Ga0070690_100220572
746 Ga0070670_100001745
747 Ga0070670_100004301
748 Ga0070670_100028046
749 Ga0070670_100037838
750 Ga0070670_100051506
751 Ga0070670_100104722
752 Ga0070670_100140394
753 Ga0070670_100299475
754 Ga0070670_100304072
755 Ga0070677_10009792
756 Ga0070677_10078627
757 Ga0070677_10129044
758 Ga0068869_100001602
759 Ga0068869_100008924
760 Ga0068869_100041422
761 Ga0070666_10472212
762 Ga0070680_100060434
763 Ga0070682_100149571
764 Ga0068868_100000817
765 Ga0068868_100012461
766 Ga0068868_100012926
767 Ga0068868_100028037
768 Ga0068868_100283886
769 Ga0070660_100019566
770 Ga0070689_100592452
771 Ga0070661_100003596
772 Ga0070661_100120828
773 Ga0070661_100129066
774 Ga0070668_100028025
775 Ga0070668_100072039
776 Ga0070669_100064263
777 Ga0070669_100077881
778 Ga0070669_100095691
779 Ga0070669_100543249
780 Ga0070675_100000645
781 Ga0070675_100002008
782 Ga0070675_100006349
783 Ga0070675_100008417
784 Ga0070675_100257792
785 Ga0070675_100559785
786 Ga0070675_100575884
787 Ga0070671_100000447
788 Ga0070671_100004894
789 Ga0070671_100012144
790 Ga0070671_100039651
791 Ga0070671_100091425
792 Ga0070671_100097029
793 Ga0070671_100318707
794 Ga0070671_100344048
795 Ga0070671_100740940
796 Ga0070674_100023022
797 Ga0070674_100144153
798 Ga0070673_100000849
799 Ga0070673_100006404
800 Ga0070673_100007948
801 Ga0070673_100024638
802 Ga0070673_100373709
803 Ga0070688_100149596
804 Ga0070659_100039255
805 Ga0070659_100422239
806 Ga0070659_100466649
807 Ga0070667_100005214
808 Ga0070667_100047562
809 Ga0070667_100072903
810 Ga0070667_100125838
811 Ga0070667_100132594
812 Ga0070667_100151538
813 Ga0070700_100045554
814 Ga0070700_100768326
815 Ga0070708_100622855
816 Ga0070663_100019782
817 Ga0070663_100286836
818 Ga0070663_100297830
819 Ga0070678_100002278
820 Ga0070678_100009433
821 Ga0070678_100039805
822 Ga0070678_100512661
823 Ga0070678_100535740
824 Ga0070662_100002751
825 Ga0070662_100072992
826 Ga0070662_100119282
827 Ga0070662_100144365
828 Ga0070662_100147009
829 Ga0070662_100375703
830 Ga0070662_100795538
831 Ga0070681_10257814
832 Ga0070681_10321116
833 Ga0068867_100003138
834 Ga0068867_100071226
835 Ga0068867_100108540
836 Ga0068867_100161169
837 Ga0068867_100677582
838 Ga0070706_100003875
839 Ga0070707_100247756
840 Ga0070679_100008455
841 Ga0070684_100055276
842 Ga0070684_100088787
843 Ga0068853_100183854
844 Ga0068853_100557199
845 Ga0068853_101375436
846 Ga0070672_100003527
847 Ga0070672_100016440
848 Ga0070672_100043773
849 Ga0070672_100078947
850 Ga0070672_100122290
851 Ga0070672_100140357
852 Ga0070672_100200255
853 Ga0070672_100235637
854 Ga0070693_100045157
855 Ga0070693_100061519
856 Ga0070693_100157758
857 Ga0070665_100294192
858 Ga0068855_100035319
859 Ga0070664_100005318
860 Ga0070664_100153427
861 Ga0070664_100171342
862 Ga0070664_100411334
863 Ga0070664_100648113
864 Ga0068857_100006324
865 Ga0068857_100008703
866 Ga0068857_100769954
867 Ga0068854_100059166
868 Ga0068854_100247735
869 Ga0068854_100654128
870 Ga0068856_100016721
871 Ga0068856_101148368
872 Ga0070702_100199288
873 Ga0068852_100006482
874 Ga0068852_100009825
875 Ga0068852_100224370
876 Ga0068852_100391734
877 Ga0068852_100611801
878 Ga0068852_100986814
879 Ga0068852_101863798
880 Ga0068859_100010902
881 Ga0068859_100056464
882 Ga0068864_100010764
883 Ga0068864_100020157
884 Ga0068864_100023365
885 Ga0068864_100028825
886 Ga0068864_100059015
887 Ga0068864_100190555
888 Ga0068864_100290483
889 Ga0068866_10081591
890 Ga0068861_100012100
891 Ga0068861_100013496
892 Ga0068861_100121653
893 Ga0068861_100496416
894 Ga0068851_10001882
895 Ga0068851_10036429
896 Ga0068851_10446899
897 Ga0068870_10006257
898 Ga0068863_100017066
899 Ga0068863_100036728
900 Ga0068863_100114107
901 Ga0068863_100178683
902 Ga0068863_100182471
903 Ga0068863_100183328
904 Ga0068858_100001778
905 Ga0068858_100003042
906 Ga0068858_100009320
907 Ga0068858_100274611
908 Ga0068860_100001532
909 Ga0068860_100011063
910 Ga0068860_100021372
911 Ga0068860_100059376
912 Ga0068860_100132361
913 Ga0068860_100255321
914 Ga0068860_100484125
915 Ga0068862_100138670
916 Ga0068862_100390621
917 Ga0068862_100954913
918 Ga0075365_10393226
919 Ga0075365_10546472
920 Ga0075368_10051329
921 Ga0075368_10085703
922 Ga0075368_10188365
923 Ga0075363_100032654
924 Ga0075363_100041736
925 Ga0075363_100087293
926 Ga0075363_100349994
927 Ga0075363_100647143
928 Ga0075364_10021140
929 Ga0075364_10116017
930 Ga0075364_10252708
931 Ga0075364_10394652
932 Ga0070716_100218091
933 Ga0075362_10010612
934 Ga0075362_10077845
935 Ga0075362_10210738
936 Ga0075362_10246626
937 Ga0075367_10000994
938 Ga0075367_10025190
939 Ga0075367_10036883
940 Ga0075367_10058602
941 Ga0075367_10074223
942 Ga0075367_10143686
943 Ga0075367_10168971
944 Ga0075369_10006340
945 Ga0075369_10011393
946 Ga0075366_10000338
947 Ga0075366_10000572
948 Ga0075366_10003160
949 Ga0075366_10021751
950 Ga0075366_10048018
951 Ga0075366_10062613
952 Ga0075366_10143035
953 Ga0075366_10146639
954 Ga0075366_10175928
955 Ga0075366_10202070
956 Ga0075366_10292567
957 Ga0097621_100010835
958 Ga0097621_100111553
959 Ga0097621_100139768
960 Ga0097621_100614233
961 Ga0075370_10000078
962 Ga0075370_10001594
963 Ga0075370_10008748
964 Ga0075370_10013700
965 Ga0075370_10027744
966 Ga0068871_100027802
967 Ga0068871_100029851
968 Ga0068871_100086047
969 Ga0068871_100916051
970 Ga0068865_100081934
971 Ga0068865_100191108
972 Ga0097620_100010902
973 Ga0097620_100056463
974 Ga0079104_1000027
975 Ga0075435_100352270
976 Ga0105244_10095889
977 Ga0105250_10000066
978 Ga0105245_10011416
979 Ga0105245_10033697
980 Ga0105245_10717010
981 Ga0105245_10837162
982 Ga0105247_10441980
983 Ga0105247_10589527
984 Ga0105243_10021378
985 Ga0105243_10030960
986 Ga0105243_10075579
987 Ga0105241_10209396
988 Ga0105242_10173845
989 Ga0105242_10591182
990 Ga0105242_10865110
991 Ga0105242_10947910
992 Ga0105242_11572786
993 Ga0105248_10009834
994 Ga0105248_10028210
995 Ga0105248_10033846
996 Ga0105248_10034665
997 Ga0105248_10280827
998 Ga0105248_10327842
999 Ga0105248_10382586
1000 Ga0105248_10609014
1001 Ga0105237_10108754
1002 Ga0105237_10135165
1003 Ga0105237_10191308
1004 Ga0105238_10048218
1005 Ga0105249_10007703
1006 Ga0105249_10101350
1007 Ga0105249_10189177
1008 Ga0105239_10044544
1009 Ga0105246_10116960
1010 Ga0157371_10050840
1011 Ga0157371_10278416
1012 Ga0157369_10012395
1013 Ga0157369_10494080
1014 Ga0157369_10737838
1015 Ga0157374_10020102
1016 Ga0157374_10094104
1017 Ga0157374_10127395
1018 Ga0157374_10155549
1019 Ga0157374_10259799
1020 Ga0157378_10007346
1021 Ga0157378_10165579
1022 Ga0157378_10251920
1023 Ga0163162_10004496
1024 Ga0163162_10007911
1025 Ga0163162_10049229
1026 Ga0163162_10077704
1027 Ga0163162_10141278
1028 Ga0163162_10147959
1029 Ga0163162_10309648
1030 Ga0157372_10006672
1031 Ga0157372_10112467
1032 Ga0157375_10002273
1033 Ga0157375_10002432
1034 Ga0157375_10013048
1035 Ga0157375_10032562
1036 Ga0157375_10049207
1037 Ga0157375_10061488
1038 Ga0157375_10100746
1039 Ga0157375_10866469
1040 Ga0157375_11678172
1041 Ga0163163_10068734
1042 Ga0157380_10050406
1043 Ga0157380_10072379
1044 Ga0157380_10745078
1045 Ga0157377_10001827
1046 Ga0157379_10000831
1047 Ga0157379_10002292
1048 Ga0157379_10060808
1049 Ga0157379_10195358
1050 Ga0157376_10015083
1051 Ga0157376_10025024
1052 Ga0157376_10074130
1053 Ga0157376_10116532
1054 Ga0157376_10471311
1055 Ga0157376_11400390
1056 Ga0163161_10029665
1057 Ga0163161_10191652
1058 Ga0163161_10221218
1059 Ga0206353_11891134
1060 Ga0213874_10083972
1061 Ga0207673_1003255
1062 Ga0207656_10002935
1063 Ga0207656_10098347
1064 Ga0207696_1001715
1065 Ga0207682_10127223
1066 Ga0207642_10093309
1067 Ga0207642_10246594
1068 Ga0207688_10014425
1069 Ga0207688_10186816
1070 Ga0207688_10314867
1071 Ga0207680_10038552
1072 Ga0207647_10186611
1073 Ga0207645_10002401
1074 Ga0207645_10020877
1075 Ga0207645_10021707
1076 Ga0207643_10016863
1077 Ga0207705_10205893
1078 Ga0207705_10331212
1079 Ga0207684_10006507
1080 Ga0207654_10289056
1081 Ga0207707_10045834
1082 Ga0207671_10047573
1083 Ga0207671_10110420
1084 Ga0207660_10213625
1085 Ga0207660_10486365
1086 Ga0207662_10022664
1087 Ga0207662_10214491
1088 Ga0207657_10174343
1089 Ga0207657_10190536
1090 Ga0207649_10008521
1091 Ga0207649_10109774
1092 Ga0207649_10159609
1093 Ga0207652_10010316
1094 Ga0207652_11086502
1095 Ga0207681_10017756
1096 Ga0207681_10376435
1097 Ga0207694_10151877
1098 Ga0207650_10015100
1099 Ga0207650_10034296
1100 Ga0207650_10203415
1101 Ga0207650_10339946
1102 Ga0207650_10340255
1103 Ga0207659_10000294
1104 Ga0207659_10021665
1105 Ga0207659_10033410
1106 Ga0207659_10210303
1107 Ga0207659_10401009
1108 Ga0207687_10098665
1109 Ga0207644_10000271
1110 Ga0207644_10006430
1111 Ga0207644_10025499
1112 Ga0207644_10057898
1113 Ga0207644_10067917
1114 Ga0207644_10109188
1115 Ga0207644_10188781
1116 Ga0207644_10771878
1117 Ga0207690_10220109
1118 Ga0207690_10987787
1119 Ga0207706_10007092
1120 Ga0207706_10038544
1121 Ga0207706_10076383
1122 Ga0207706_10196611
1123 Ga0207686_10116303
1124 Ga0207709_10000783
1125 Ga0207709_10033518
1126 Ga0207670_10008173
1127 Ga0207669_10171256
1128 Ga0207669_10436699
1129 Ga0207704_10050918
1130 Ga0207704_10065583
1131 Ga0207704_10096454
1132 Ga0207704_10216495
1133 Ga0207665_10490192
1134 Ga0207691_10002171
1135 Ga0207691_10015460
1136 Ga0207691_10038643
1137 Ga0207691_10076681
1138 Ga0207691_10133561
1139 Ga0207691_10207396
1140 Ga0207691_10898551
1141 Ga0207711_10018082
1142 Ga0207711_10038940
1143 Ga0207711_10043971
1144 Ga0207711_10166962
1145 Ga0207711_10190839
1146 Ga0207689_10001229
1147 Ga0207689_10036508
1148 Ga0207689_10046964
1149 Ga0207661_10265137
1150 Ga0207679_10144055
1151 Ga0207679_10717053
1152 Ga0207667_10050241
1153 Ga0207651_10002910
1154 Ga0207651_10005880
1155 Ga0207651_10099534
1156 Ga0207651_10332487
1157 Ga0207651_10479777
1158 Ga0207712_10992936
1159 Ga0207668_10071745
1160 Ga0207668_10473935
1161 Ga0207640_10021415
1162 Ga0207640_10284002
1163 Ga0207640_11168614
1164 Ga0207640_11177783
1165 Ga0207658_10005475
1166 Ga0207658_10059302
1167 Ga0207658_10091920
1168 Ga0207658_10471495
1169 Ga0207658_10598878
1170 Ga0207677_10001260
1171 Ga0207677_10018379
1172 Ga0207677_10053748
1173 Ga0207677_10211503
1174 Ga0207677_10219044
1175 Ga0207677_10907588
1176 Ga0207703_10002318
1177 Ga0207703_10004141
1178 Ga0207703_10242822
1179 Ga0207703_10775736
1180 Ga0207703_11183016
1181 Ga0207639_10039137
1182 Ga0207639_10746819
1183 Ga0207678_10024832
1184 Ga0207678_10029296
1185 Ga0207678_10105464
1186 Ga0207678_10144900
1187 Ga0207708_10019968
1188 Ga0207708_10777722
1189 Ga0207702_10074645
1190 Ga0207641_10002118
1191 Ga0207641_10033231
1192 Ga0207641_10061994
1193 Ga0207641_10071329
1194 Ga0207641_10106169
1195 Ga0207641_10139612
1196 Ga0207648_10007552
1197 Ga0207648_10008627
1198 Ga0207648_10070648
1199 Ga0207648_10141072
1200 Ga0207648_10218673
1201 Ga0207648_10402468
1202 Ga0207648_10625592
1203 Ga0207676_10000529
1204 Ga0207676_10014031
1205 Ga0207676_10107171
1206 Ga0207676_10273976
1207 Ga0207676_10494790
1208 Ga0207676_10869916
1209 Ga0207674_10009772
1210 Ga0207674_10019048
1211 Ga0207674_10047833
1212 Ga0207674_10596426
1213 Ga0207675_100001299
1214 Ga0207675_100018432
1215 Ga0207675_100020087
1216 Ga0207675_100034019
1217 Ga0207683_10001558
1218 Ga0207683_10009835
1219 Ga0207683_10063417
1220 Ga0207683_10085082
1221 Ga0207683_10281626
1222 Ga0207683_10373532
1223 Ga0207683_10662593
1224 Ga0207698_10032623
1225 Ga0207698_10043100
1226 Ga0207698_10082545
1227 Ga0207698_10160617
1228 Ga0207698_10499380
1229 Ga0209281_1000002
1230 Ga0209995_1013289
1231 Ga0209968_1001280
1232 Ga0209966_1000052
1233 Ga0209813_10012524
1234 Ga0209813_10014393
1235 Ga0209974_10013878
1236 Ga0268266_10054888
1237 Ga0268266_10818338
1238 Ga0268265_10120375
1239 Ga0268264_10007004
1240 Ga0268264_10020606
1241 Ga0268264_10026590
1242 Ga0268264_10177745
1243 Ga0307517_10000150
1244 Ga0307517_10115049
1245 Ga0307517_10169646
1246 Ga0307515_10021958
1247 Ga0307515_10036892
1248 Ga0307515_10188302
1249 Ga0307515_10223085
1250 Ga0307515_10442224
1251 Ga0307512_10034669
1252 Ga0307513_10010461
1253 Ga0307513_10031788
1254 Ga0307513_10174407
1255 Ga0307509_10000854
1256 Ga0307509_10079378
1257 Ga0307509_10124674
1258 Ga0307509_10332379
1259 Ga0307508_10013671
1260 Ga0307508_10076985
1261 Ga0307508_10106665
1262 Ga0307508_10332606
1263 Ga0307516_10001996
1264 Ga0307516_10012323
1265 Ga0307516_10235711
1266 Ga0307516_10440189
1267 Ga0307413_10355417
1268 Ga0307409_100007060
1269 Ga0307416_100000264
1270 Ga0307414_10969790
1271 Ga0307411_10588687
1272 Ga0307415_100001450
1273 Ga0307507_10154471
1274 Ga0307510_10014085
1275 Ga0307510_10068950
1276 Ga0307510_10303518
1277 Ga0373926_0047320
1278 Ga0373944_0014471
1279 Ga0373923_0054013
1280 Ga0373932_0248945
1281 Ga0373953_0236901
1282 Ga0373946_0222080
1283 Ga0373955_0025375
1284 Ga0373955_0105093
1285 Ga0373955_0232121
1286 Ga0373962_0027988
1287 Ga0373931_0027606
1288 Ga0373935_0101308
1289 Ga0373935_0342623
1290 Ga0373927_0170934
1291 Ga0373933_0294654
1292 Ga0373937_0023021
1293 Ga0373937_0296720
1294 Ga0373925_0035452
1295 Ga0436363_1145370
1296 Ga0451793_0370606
1297 Ga0451793_0827258
1298 Ga0451798_0658955
1299 Ga0451851_1293312
1300 Ga0451855_0889723
1301 Ga0451853_1340569
1302 Ga0451853_2476695
1303 Ga0451853_2949518
1304 Ga0451577_0793418
1305 Ga0453684_0246295
1306 Ga0453684_0337786
1307 Ga0451576_0050941
1308 Ga0495592_0000468
1309 Ga0495603_0615918
1310 Ga0495590_0019699
1311 Ga0495639_0143038
1312 Ga0495662_0476374
1313 Ga0495585_0390071
1314 Ga0495607_0038242
1315 Ga0495606_0081765
1316 Ga0495610_0039941
1317 Ga0495610_0128320
1318 Ga0495620_0089815
1319 Ga0495632_0095277
1320 Ga0495643_0035786
1321 Ga0495648_0172098
1322 Ga0495666_0036886
1323 Ga0495642_0280035
1324 Ga0495640_0494869
1325 Ga0495586_0084861
1326 Ga0495598_0042641
1327 Ga0495621_0121241
1328 Ga0495597_0000105
1329 Ga0495597_0079995
1330 Ga0495645_0129388
1331 Ga0495622_0097136
1332 Ga0495611_0149019
1333 Ga0495625_0014128
1334 Ga0495625_0015885
1335 Ga0495635_0307240
1336 Ga0495599_0168667
1337 Ga0495599_0264270
1338 Ga0495647_0109269
1339 Ga0495647_0189294
1340 Ga0495658_0091900
1341 Ga0495658_0202274
1342 Ga0495658_0335902
1343 Ga0495613_0054625
1344 Ga0495670_0372618
1345 Ga0495649_0000490
1346 Ga0495660_0037547
1347 Ga0495676_0070779
1348 Ga0495687_005678
1349 Ga0495687_006139
1350 Ga0495673_0068661
1351 Ga0495684_0201910
1352 Ga0495686_0009179
1353 Ga0495686_0120087
1354 Ga0495686_0129170
1355 Ga0495626_0074245
1356 Ga0496101_0055941
1357 Ga0496101_0462943
1358 Ga0496101_0545534
1359 Ga0496101_0701322
1360 Ga0496103_0112301
1361 Ga0496105_0161058
1362 Ga0496105_0413239
1363 Ga0496106_0002400
1364 Ga0496106_0111492
1365 Ga0496106_0151329
1366 Ga0496106_0705944
1367 Ga0496107_0134262
1368 Ga0496108_0023077
1369 Ga0496108_0023784
1370 Ga0496108_0047569
1371 Ga0496109_0054535
1372 Ga0496110_0043425
1373 Ga0496110_0111980
1374 Ga0496110_0152289
1375 Ga0496111_0327937
1376 Ga0496112_0227860
1377 Ga0496112_0482931
1378 Ga0496113_0004694
1379 Ga0496113_0309460
1380 Ga0496114_0453552
1381 Ga0496114_0460225
1382 Ga0496114_0560414
1383 Ga0496115_0150056
1384 Ga0496123_0044147
1385 Ga0496124_0219292
1386 Ga0496125_0000484
1387 Ga0496125_0095883
1388 Ga0501306_011297
1389 Ga0501306_022225
1390 Ga0501310_016099
1391 Ga0501324_013325
1392 nmdc:mga03683_175284_c1
1393 nmdc:mga03683_179905_c1
1394 nmdc:mga03683_27322_c1
1395 nmdc:mga03683_85562_c1
1396 nmdc:mga03n38_30182_c1
1397 nmdc:mga03n38_7075_c1
1398 nmdc:mga00v17_77617_c1
1399 nmdc:mga0yw44_361824_c1
1400 nmdc:mga0k408_124709_c1
1401 nmdc:mga0k408_13311_c1
1402 nmdc:mga0k408_136893_c1
1403 nmdc:mga0k408_14133_c1
1404 nmdc:mga0k408_181098_c1
1405 nmdc:mga0k408_201875_c1
1406 nmdc:mga0k408_349852_c1
1407 nmdc:mga0k408_513_c1
1408 nmdc:mga0k408_52521_c1
1409 nmdc:mga06z11_107693_c1
1410 nmdc:mga06z11_128821_c1
1411 nmdc:mga06z11_1615_c1
1412 nmdc:mga06z11_31901_c1
1413 nmdc:mga04h51_18775_c1
1414 nmdc:mga04h51_72322_c1
1415 nmdc:mga07m45_111_c1
1416 nmdc:mga07m45_12530_c1
1417 nmdc:mga07m45_229683_c1
1418 nmdc:mga07m45_392453_c1
1419 nmdc:mga07m45_67688_c1
1420 nmdc:mga07m45_7608_c1
1421 nmdc:mga07m45_956_c1
1422 nmdc:mga08y16_375706_c1
1423 nmdc:mga0rr50_711696_c1
1424 nmdc:mga0sz30_22904_c1
1425 Ga0495601_0089120
1426 Ga0495601_0115311
1427 Ga0495601_0397468
1428 Ga0495595_0056528
1429 Ga0495595_0167191
1430 Ga0500578_0094922
1431 Ga0500651_0004349
1432 Ga0500651_0107521
1433 Ga0500607_102171
1434 Ga0500655_010862
1435 Ga0500658_0005836
1436 Ga0500559_0000069
1437 Ga0500568_0015120
1438 Ga0500622_0002191
1439 Ga0500633_0015262
1440 Ga0500636_0088601
1441 Ga0500637_0488651
1442 Ga0500645_006293
1443 2587755510
1444 2644301956
1445 2722886280
1446 2839141913

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

70

212

0.94

PF13668

Ferritin_2

Ferritin-like domain

68

208

0.79

PF02915

Rubrerythrin

Rubrerythrin

71

206

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xks-assembly1.cif.gz_E-2 e. coli bfr variant y45f 0.9547 37 177
3ghq-assembly1.cif.gz_A crystal structure of e. coli w35f bfr mutant 0.9546 38 177
3fvb-assembly1.cif.gz_A crystal structure of ferritin (bacterioferritin) from brucella melitensis 0.9544 37 177
4xks-assembly1.cif.gz_A e. coli bfr variant y45f 0.9537 37 177
1bcf-assembly1.cif.gz_A the structure of a unique, two-fold symmetric, haem-binding site 0.9535 38 177
ID Description Score Start End Superfamily
3fvbA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9544 37 177 1.20.1260.10
1bcfA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9535 38 177 1.20.1260.10
1jgcA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9533 37 177 1.20.1260.10
2vxiG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9527 37 177 1.20.1260.10
af_P0ABD3_1_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9509 38 177 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7X8HI02-F1-model_v4 Ferritin-like domain-containing protein 0.9902 76 177 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-F1VVE5-F1-model_v4 Putative bacterioferritin 0.9818 43 179 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A3M5D710-F1-model_v4 Ferritin-like diiron domain-containing protein 0.9814 85 180 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A534PC10-F1-model_v4 Bacterioferritin 0.9798 47 180 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0020037
AF-A0A656GYT0-F1-model_v4 deleted 0.9767 44 178

Map