F477522

General Info

Members Datasets Scaffolds Average Seq Length
723 283 1446 382

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0112414|Ga0501047_0112414_492_1628
Length 378
Sequence MRMLVLGAGLQGSACAYDLLQDKDVAEVRLADLHIDHLPEFLAPYSGPRLLPTPLDVRDHEAVLGAMRGCDAVMSAIPYYFNLDMARLAVQAGVHFCDLGGNTEIVFKQKELDADAKAKNITVVPDCGLAPGMVNILAEYGISQLDSVSSVKIFVGGLPQKPEPPLNYMLVYSLEGALDYYTTLSWVLRGGKRTQVKALSEIEPVKFDFANLEAFHTAGGLSTMAFRYEDKIPVMEYKTLRYPGHAKLMEDVREMGLLDNQPIDVKGTKVVPRDLFIATVQPKLTKPKGRDLVALRVVVTGTKGGKPASKTFELVDRYDEQHDISAMMRTTGYSLSITGLMQARGEVKPAGVHTPDECIPARPYIDALATRGIEIKES

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
237 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
238 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
249 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
250 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
258 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
259 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
260 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
261 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
262 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
263 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
264 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
267 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
270 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
271 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.11
Rhizosphere 98.76
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0112414 3300049581 Bacteria 2606
2 Ga0065712_10081653 3300005290 Bacteria 2963
3 Ga0065712_10084477 3300005290 Bacteria 2760
4 Ga0065715_10090060 3300005293 Bacteria 7761
5 Ga0070658_10016972 3300005327 Bacteria 5826
6 Ga0070658_10023203 3300005327 Bacteria 4982
7 Ga0070658_10027634 3300005327 Bacteria 4551
8 Ga0070676_10004143 3300005328 Bacteria 7613
9 Ga0070683_100001771 3300005329 Bacteria 16815
10 Ga0070683_100002337 3300005329 Bacteria 15043
11 Ga0070683_100005783 3300005329 Bacteria 10339
12 Ga0070683_100024074 3300005329 Bacteria 5449
13 Ga0070683_100024256 3300005329 Bacteria 5431
14 Ga0070683_100028791 3300005329 Bacteria 5024
15 Ga0070683_100030147 3300005329 Bacteria 4919
16 Ga0070683_100068760 3300005329 Unclassified 3300
17 Ga0070683_100278282 3300005329 Bacteria 1592
18 Ga0070690_100047288 3300005330 Bacteria 2737
19 Ga0070690_100119021 3300005330 Unclassified 1771
20 Ga0070670_100002906 3300005331 Bacteria 14177
21 Ga0070670_100003101 3300005331 Bacteria 13754
22 Ga0070670_100020759 3300005331 Bacteria 5647
23 Ga0070670_100044348 3300005331 Bacteria 3824
24 Ga0070670_100320688 3300005331 Bacteria 1358
25 Ga0068869_100002687 3300005334 Bacteria 10760
26 Ga0068869_100005469 3300005334 Bacteria 7994
27 Ga0070666_10047462 3300005335 Bacteria 2883
28 Ga0070666_10051859 3300005335 Unclassified 2764
29 Ga0070680_100000549 3300005336 Bacteria 25684
30 Ga0070680_100003550 3300005336 Bacteria 11631
31 Ga0070680_100015134 3300005336 Bacteria 6041
32 Ga0070680_100020891 3300005336 Bacteria 5198
33 Ga0070680_100045895 3300005336 Bacteria 3553
34 Ga0070680_100064090 3300005336 Unclassified 3011
35 Ga0070680_100221882 3300005336 Bacteria 1596
36 Ga0070680_100319240 3300005336 Bacteria 1318
37 Ga0068868_100018977 3300005338 Bacteria 5146
38 Ga0070660_100009180 3300005339 Bacteria 6945
39 Ga0070660_100091391 3300005339 Bacteria 2401
40 Ga0070689_100001477 3300005340 Bacteria 14990
41 Ga0070689_100003049 3300005340 Bacteria 11034
42 Ga0070689_100162151 3300005340 Bacteria 1808
43 Ga0070691_10032212 3300005341 Bacteria 2462
44 Ga0070691_10036146 3300005341 Bacteria 2327
45 Ga0070687_100002767 3300005343 Bacteria 6664
46 Ga0070661_100001095 3300005344 Bacteria 19154
47 Ga0070661_100001986 3300005344 Bacteria 14147
48 Ga0070661_100011217 3300005344 Bacteria 6243
49 Ga0070661_100035132 3300005344 Bacteria 3638
50 Ga0070661_100073416 3300005344 Bacteria 2519
51 Ga0070661_100079498 3300005344 Bacteria 2420
52 Ga0070661_100096312 3300005344 Bacteria 2196
53 Ga0070661_100135612 3300005344 Bacteria 1852
54 Ga0070661_100224555 3300005344 Unclassified 1442
55 Ga0070692_10007664 3300005345 Bacteria 4771
56 Ga0070692_10020004 3300005345 Bacteria 3239
57 Ga0070692_10141547 3300005345 Bacteria 1362
58 Ga0070668_100001458 3300005347 Bacteria 17089
59 Ga0070668_100010400 3300005347 Bacteria 6914
60 Ga0070668_100011615 3300005347 Bacteria 6556
61 Ga0070669_100005793 3300005353 Bacteria 8908
62 Ga0070669_100007548 3300005353 Bacteria 7786
63 Ga0070669_100040156 3300005353 Bacteria 3401
64 Ga0070669_100098081 3300005353 Bacteria 2207
65 Ga0070675_100003257 3300005354 Bacteria 12303
66 Ga0070675_100004973 3300005354 Bacteria 10144
67 Ga0070675_100006583 3300005354 Bacteria 8933
68 Ga0070675_100307032 3300005354 Bacteria 1399
69 Ga0070671_100009928 3300005355 Bacteria 7646
70 Ga0070671_100027176 3300005355 Bacteria 4707
71 Ga0070674_100021183 3300005356 Bacteria 4168
72 Ga0070674_100022833 3300005356 Bacteria 4038
73 Ga0070674_100098041 3300005356 Bacteria 2130
74 Ga0070673_100015225 3300005364 Bacteria 5395
75 Ga0070688_100000737 3300005365 Bacteria 16121
76 Ga0070659_100001063 3300005366 Bacteria 20075
77 Ga0070659_100081119 3300005366 Bacteria 2590
78 Ga0070659_100164567 3300005366 Bacteria 1814
79 Ga0070667_100006637 3300005367 Bacteria 9618
80 Ga0070667_100016113 3300005367 Bacteria 6183
81 Ga0070709_10004619 3300005434 Bacteria 7435
82 Ga0070714_100003646 3300005435 Bacteria 11531
83 Ga0070714_100022033 3300005435 Bacteria 5220
84 Ga0070714_100023449 3300005435 Bacteria 5070
85 Ga0070714_100027115 3300005435 Bacteria 4740
86 Ga0070714_100034410 3300005435 Bacteria 4243
87 Ga0070713_100000500 3300005436 Bacteria 25055
88 Ga0070713_100001301 3300005436 Bacteria 15977
89 Ga0070710_10030065 3300005437 Unclassified 2920
90 Ga0070710_10061176 3300005437 Bacteria 2144
91 Ga0070711_100054934 3300005439 Bacteria 2749
92 Ga0070700_100010430 3300005441 Bacteria 5131
93 Ga0070694_100066499 3300005444 Unclassified 2473
94 Ga0070708_100000113 3300005445 Bacteria 53689
95 Ga0070663_100004575 3300005455 Bacteria 8147
96 Ga0070663_100033945 3300005455 Bacteria 3529
97 Ga0070678_100079345 3300005456 Bacteria 2482
98 Ga0070678_100270633 3300005456 Bacteria 1432
99 Ga0070662_100001788 3300005457 Bacteria 13224
100 Ga0070662_100002560 3300005457 Bacteria 11194
101 Ga0070662_100044354 3300005457 Bacteria 3185
102 Ga0070662_100095194 3300005457 Bacteria 2244
103 Ga0070681_10000861 3300005458 Bacteria 25522
104 Ga0070681_10004075 3300005458 Bacteria 13799
105 Ga0070681_10008859 3300005458 Bacteria 9884
106 Ga0070681_10029584 3300005458 Bacteria 5501
107 Ga0070681_10040316 3300005458 Bacteria 4679
108 Ga0070681_10043560 3300005458 Bacteria 4495
109 Ga0070681_10076680 3300005458 Bacteria 3301
110 Ga0070681_10114256 3300005458 Bacteria 2639
111 Ga0070681_10144659 3300005458 Bacteria 2307
112 Ga0068867_100080884 3300005459 Bacteria 2448
113 Ga0070706_100053613 3300005467 Bacteria 3722
114 Ga0070707_100021762 3300005468 Bacteria 6061
115 Ga0070707_100081710 3300005468 Bacteria 3120
116 Ga0070698_100006904 3300005471 Bacteria 12304
117 Ga0070699_100028391 3300005518 Bacteria 4825
118 Ga0070679_100001943 3300005530 Bacteria 18571
119 Ga0070679_100010961 3300005530 Bacteria 8613
120 Ga0070679_100028027 3300005530 Bacteria 5550
121 Ga0070679_100041584 3300005530 Bacteria 4574
122 Ga0070679_100121493 3300005530 Bacteria 2597
123 Ga0070679_100202275 3300005530 Bacteria 1951
124 Ga0070684_100001622 3300005535 Bacteria 16280
125 Ga0070684_100011747 3300005535 Bacteria 6985
126 Ga0070684_100015964 3300005535 Bacteria 6132
127 Ga0070684_100021992 3300005535 Bacteria 5314
128 Ga0070684_100026336 3300005535 Bacteria 4897
129 Ga0070684_100029462 3300005535 Bacteria 4652
130 Ga0070684_100032204 3300005535 Bacteria 4467
131 Ga0070684_100038352 3300005535 Bacteria 4116
132 Ga0070684_100053268 3300005535 Bacteria 3522
133 Ga0070684_100086941 3300005535 Unclassified 2775
134 Ga0070684_100259676 3300005535 Bacteria 1589
135 Ga0070697_100208590 3300005536 Unclassified 1663
136 Ga0068853_100006109 3300005539 Bacteria 9536
137 Ga0068853_100010958 3300005539 Bacteria 7347
138 Ga0068853_100364986 3300005539 Bacteria 1346
139 Ga0070672_100007183 3300005543 Bacteria 7538
140 Ga0070672_100010189 3300005543 Bacteria 6510
141 Ga0070672_100105768 3300005543 Bacteria 2288
142 Ga0070672_100210472 3300005543 Bacteria 1628
143 Ga0070693_100002407 3300005547 Bacteria 8612
144 Ga0070693_100033878 3300005547 Bacteria 2822
145 Ga0068855_100003991 3300005563 Bacteria 18026
146 Ga0068855_100041900 3300005563 Bacteria 5426
147 Ga0068855_100131469 3300005563 Bacteria 2858
148 Ga0068855_100576250 3300005563 Unclassified 1216
149 Ga0070664_100002366 3300005564 Bacteria 15153
150 Ga0070664_100004858 3300005564 Bacteria 10764
151 Ga0070664_100017055 3300005564 Bacteria 5961
152 Ga0070664_100064031 3300005564 Bacteria 3136
153 Ga0070664_100110325 3300005564 Bacteria 2400
154 Ga0070664_100301608 3300005564 Unclassified 1448
155 Ga0068857_100000717 3300005577 Bacteria 24710
156 Ga0068857_100009343 3300005577 Bacteria 8512
157 Ga0068857_100070735 3300005577 Bacteria 3108
158 Ga0068857_100156821 3300005577 Bacteria 2064
159 Ga0068857_100172358 3300005577 Bacteria 1967
160 Ga0068854_100066377 3300005578 Bacteria 2626
161 Ga0068854_100105728 3300005578 Bacteria 2116
162 Ga0068856_100005061 3300005614 Bacteria 13048
163 Ga0068856_100094553 3300005614 Bacteria 2976
164 Ga0068856_100106727 3300005614 Bacteria 2795
165 Ga0070702_100001089 3300005615 Bacteria 10851
166 Ga0068852_100003092 3300005616 Bacteria 11588
167 Ga0068852_100006855 3300005616 Bacteria 8277
168 Ga0068852_100034319 3300005616 Bacteria 4219
169 Ga0068852_100052452 3300005616 Bacteria 3505
170 Ga0068852_100218227 3300005616 Bacteria 1813
171 Ga0068852_100246204 3300005616 Bacteria 1711
172 Ga0068859_100006482 3300005617 Bacteria 11879
173 Ga0068859_100017946 3300005617 Bacteria 7112
174 Ga0068859_100474574 3300005617 Bacteria 1346
175 Ga0068864_100011237 3300005618 Bacteria 7399
176 Ga0068864_100354437 3300005618 Bacteria 1385
177 Ga0068861_100029036 3300005719 Unclassified 4041
178 Ga0068861_100206280 3300005719 Bacteria 1653
179 Ga0068851_10009966 3300005834 Bacteria 4424
180 Ga0068851_10056643 3300005834 Bacteria 2000
181 Ga0068870_10001495 3300005840 Bacteria 9465
182 Ga0068870_10002245 3300005840 Bacteria 8023
183 Ga0068863_100003586 3300005841 Bacteria 15317
184 Ga0068863_100013098 3300005841 Bacteria 8001
185 Ga0068858_100024866 3300005842 Bacteria 5576
186 Ga0068860_100007588 3300005843 Bacteria 10856
187 Ga0068860_100031055 3300005843 Bacteria 5136
188 Ga0068860_100381459 3300005843 Bacteria 1391
189 Ga0068862_100006543 3300005844 Bacteria 9670
190 Ga0068862_100044812 3300005844 Bacteria 3773
191 Ga0081539_10028031 3300005985 Bacteria 3551
192 Ga0070717_10005385 3300006028 Bacteria 9339
193 Ga0070717_10246668 3300006028 Bacteria 1576
194 Ga0070712_100053730 3300006175 Bacteria 2814
195 Ga0097621_100003544 3300006237 Bacteria 10775
196 Ga0068871_100005248 3300006358 Bacteria 9068
197 Ga0075428_100021717 3300006844 Bacteria 7106
198 Ga0075428_100039125 3300006844 Bacteria 5220
199 Ga0075428_100115978 3300006844 Bacteria 2918
200 Ga0075430_100000793 3300006846 Bacteria 24501
201 Ga0075430_100002235 3300006846 Bacteria 16039
202 Ga0075430_100029727 3300006846 Unclassified 4638
203 Ga0075430_100038768 3300006846 Unclassified 4035
204 Ga0075431_100006586 3300006847 Bacteria 11540
205 Ga0075431_100012430 3300006847 Bacteria 8594
206 Ga0075431_100015003 3300006847 Bacteria 7843
207 Ga0075431_100054203 3300006847 Bacteria 4135
208 Ga0075433_10009057 3300006852 Bacteria 7951
209 Ga0075433_10009137 3300006852 Bacteria 7914
210 Ga0075434_100016868 3300006871 Bacteria 7026
211 Ga0075434_100062318 3300006871 Bacteria 3712
212 Ga0075429_100152357 3300006880 Bacteria 2024
213 Ga0075429_100231675 3300006880 Bacteria 1618
214 Ga0068865_100000586 3300006881 Bacteria 20440
215 Ga0068865_100183177 3300006881 Bacteria 1614
216 Ga0075436_100013334 3300006914 Bacteria 5631
217 Ga0097620_100006482 3300006931 Bacteria 11879
218 Ga0097620_100017945 3300006931 Bacteria 7112
219 Ga0097620_100474529 3300006931 Bacteria 1346
220 Ga0105240_10003364 3300009093 Bacteria 24876
221 Ga0105240_10052489 3300009093 Bacteria 5124
222 Ga0105240_10059371 3300009093 Bacteria 4774
223 Ga0105240_10066191 3300009093 Bacteria 4484
224 Ga0105240_10068136 3300009093 Bacteria 4408
225 Ga0105240_10183389 3300009093 Bacteria 2468
226 Ga0105240_10306399 3300009093 Bacteria 1815
227 Ga0111539_10021037 3300009094 Bacteria 8033
228 Ga0111539_10072464 3300009094 Bacteria 4062
229 Ga0105245_10002700 3300009098 Bacteria 15971
230 Ga0105245_10045342 3300009098 Bacteria 3927
231 Ga0105245_10269171 3300009098 Bacteria 1661
232 Ga0114129_10041167 3300009147 Bacteria 6512
233 Ga0114129_10072761 3300009147 Unclassified 4791
234 Ga0114129_10160092 3300009147 Bacteria 3076
235 Ga0114129_10175372 3300009147 Bacteria 2920
236 Ga0105241_10000247 3300009174 Bacteria 40769
237 Ga0105241_10005331 3300009174 Bacteria 9501
238 Ga0105241_10056445 3300009174 Bacteria 3011
239 Ga0105242_10011773 3300009176 Bacteria 6732
240 Ga0105242_10012041 3300009176 Bacteria 6657
241 Ga0105242_10174315 3300009176 Bacteria 1892
242 Ga0105248_10009852 3300009177 Bacteria 10527
243 Ga0105248_10082814 3300009177 Bacteria 3609
244 Ga0105248_10168962 3300009177 Bacteria 2465
245 Ga0105248_10345888 3300009177 Unclassified 1674
246 Ga0105237_10003172 3300009545 Bacteria 19740
247 Ga0105237_10042668 3300009545 Bacteria 4573
248 Ga0105237_10307223 3300009545 Bacteria 1589
249 Ga0105238_10056549 3300009551 Unclassified 3935
250 Ga0105249_10000101 3300009553 Bacteria 119072
251 Ga0105249_10004615 3300009553 Bacteria 11898
252 Ga0105249_10004803 3300009553 Bacteria 11664
253 Ga0105239_10261897 3300010375 Bacteria 1944
254 Ga0105246_10001462 3300011119 Bacteria 14019
255 Ga0105246_10047544 3300011119 Bacteria 2931
256 Ga0157373_10010660 3300013100 Bacteria 6762
257 Ga0157373_10025939 3300013100 Bacteria 4235
258 Ga0157373_10026650 3300013100 Bacteria 4172
259 Ga0157373_10052510 3300013100 Bacteria 2901
260 Ga0157373_10111015 3300013100 Bacteria 1928
261 Ga0157371_10002940 3300013102 Bacteria 15887
262 Ga0157371_10032850 3300013102 Bacteria 3732
263 Ga0157371_10067814 3300013102 Bacteria 2525
264 Ga0157371_10137497 3300013102 Bacteria 1740
265 Ga0157371_10151369 3300013102 Unclassified 1655
266 Ga0157370_10000502 3300013104 Bacteria 48831
267 Ga0157370_10006161 3300013104 Bacteria 13307
268 Ga0157370_10020281 3300013104 Bacteria 6639
269 Ga0157370_10047558 3300013104 Bacteria 4112
270 Ga0157370_10047966 3300013104 Bacteria 4092
271 Ga0157370_10138333 3300013104 Bacteria 2269
272 Ga0157370_10268509 3300013104 Unclassified 1576
273 Ga0157370_10358166 3300013104 Bacteria 1345
274 Ga0157369_10008069 3300013105 Bacteria 12073
275 Ga0157369_10013726 3300013105 Bacteria 9157
276 Ga0157369_10049380 3300013105 Unclassified 4561
277 Ga0157369_10084347 3300013105 Bacteria 3396
278 Ga0157369_10161668 3300013105 Bacteria 2364
279 Ga0157374_10006651 3300013296 Bacteria 9820
280 Ga0157374_10148559 3300013296 Bacteria 2278
281 Ga0157378_10011577 3300013297 Bacteria 7723
282 Ga0157378_10090410 3300013297 Bacteria 2782
283 Ga0163162_10007004 3300013306 Bacteria 10935
284 Ga0163162_10036042 3300013306 Bacteria 4929
285 Ga0163162_10080676 3300013306 Bacteria 3322
286 Ga0163162_10122464 3300013306 Bacteria 2705
287 Ga0157372_10017080 3300013307 Bacteria 7790
288 Ga0157372_10019557 3300013307 Bacteria 7298
289 Ga0157372_10031570 3300013307 Bacteria 5800
290 Ga0157372_10037089 3300013307 Bacteria 5373
291 Ga0157372_10041619 3300013307 Bacteria 5081
292 Ga0157372_10046786 3300013307 Bacteria 4804
293 Ga0157372_10049069 3300013307 Bacteria 4693
294 Ga0157372_10090546 3300013307 Bacteria 3478
295 Ga0157372_10096466 3300013307 Bacteria 3370
296 Ga0157372_10117978 3300013307 Bacteria 3044
297 Ga0157372_10160729 3300013307 Bacteria 2596
298 Ga0157372_10161731 3300013307 Unclassified 2588
299 Ga0157372_10234105 3300013307 Bacteria 2130
300 Ga0157375_10012024 3300013308 Bacteria 7664
301 Ga0157375_10020448 3300013308 Bacteria 6048
302 Ga0157375_10022647 3300013308 Bacteria 5784
303 Ga0157375_10055592 3300013308 Bacteria 3903
304 Ga0157375_10326379 3300013308 Bacteria 1699
305 Ga0157375_10498927 3300013308 Bacteria 1381
306 Ga0163163_10004994 3300014325 Bacteria 11426
307 Ga0163163_10005080 3300014325 Bacteria 11339
308 Ga0157380_10028884 3300014326 Bacteria 4235
309 Ga0157380_10161166 3300014326 Bacteria 1950
310 Ga0182008_10007043 3300014497 Bacteria 6232
311 Ga0157377_10002965 3300014745 Bacteria 7592
312 Ga0157379_10020295 3300014968 Bacteria 5875
313 Ga0157379_10349492 3300014968 Bacteria 1353
314 Ga0157376_10001117 3300014969 Bacteria 17602
315 Ga0157376_10004634 3300014969 Bacteria 9582
316 Ga0163161_10027936 3300017792 Bacteria 4003
317 Ga0207697_10011739 3300025315 Bacteria 3697
318 Ga0207697_10029248 3300025315 Bacteria 2254
319 Ga0207682_10047328 3300025893 Bacteria 1770
320 Ga0207688_10025972 3300025901 Bacteria 3219
321 Ga0207680_10053746 3300025903 Bacteria 2419
322 Ga0207699_10012234 3300025906 Bacteria 4361
323 Ga0207699_10027475 3300025906 Bacteria 3151
324 Ga0207699_10038204 3300025906 Bacteria 2750
325 Ga0207645_10000153 3300025907 Bacteria 54084
326 Ga0207643_10004278 3300025908 Bacteria 7682
327 Ga0207643_10004496 3300025908 Bacteria 7495
328 Ga0207705_10019925 3300025909 Bacteria 4798
329 Ga0207705_10036612 3300025909 Bacteria 3511
330 Ga0207705_10062483 3300025909 Bacteria 2690
331 Ga0207705_10133029 3300025909 Bacteria 1852
332 Ga0207684_10060442 3300025910 Bacteria 3219
333 Ga0207654_10000514 3300025911 Bacteria 22189
334 Ga0207707_10000782 3300025912 Bacteria 31165
335 Ga0207707_10001939 3300025912 Bacteria 18822
336 Ga0207707_10003206 3300025912 Bacteria 14524
337 Ga0207707_10005437 3300025912 Bacteria 11137
338 Ga0207707_10013095 3300025912 Bacteria 7227
339 Ga0207707_10020354 3300025912 Bacteria 5793
340 Ga0207707_10023642 3300025912 Bacteria 5374
341 Ga0207707_10023667 3300025912 Bacteria 5371
342 Ga0207707_10031739 3300025912 Bacteria 4623
343 Ga0207707_10040113 3300025912 Unclassified 4091
344 Ga0207707_10111448 3300025912 Bacteria 2392
345 Ga0207707_10134433 3300025912 Bacteria 2162
346 Ga0207695_10002156 3300025913 Bacteria 29802
347 Ga0207695_10003956 3300025913 Bacteria 20476
348 Ga0207695_10014103 3300025913 Bacteria 9488
349 Ga0207695_10023946 3300025913 Bacteria 6886
350 Ga0207695_10029961 3300025913 Bacteria 6001
351 Ga0207695_10040495 3300025913 Bacteria 4994
352 Ga0207695_10058182 3300025913 Bacteria 4013
353 Ga0207695_10061244 3300025913 Bacteria 3891
354 Ga0207695_10122104 3300025913 Bacteria 2572
355 Ga0207695_10295615 3300025913 Bacteria 1511
356 Ga0207671_10116363 3300025914 Bacteria 2039
357 Ga0207671_10127052 3300025914 Bacteria 1954
358 Ga0207693_10014675 3300025915 Bacteria 6294
359 Ga0207693_10033775 3300025915 Bacteria 4036
360 Ga0207663_10186653 3300025916 Bacteria 1485
361 Ga0207660_10001287 3300025917 Bacteria 16800
362 Ga0207660_10001807 3300025917 Bacteria 14252
363 Ga0207660_10003312 3300025917 Bacteria 10521
364 Ga0207660_10051039 3300025917 Bacteria 2939
365 Ga0207660_10130053 3300025917 Bacteria 1915
366 Ga0207660_10153178 3300025917 Bacteria 1773
367 Ga0207660_10243624 3300025917 Bacteria 1417
368 Ga0207662_10000185 3300025918 Bacteria 29675
369 Ga0207662_10001799 3300025918 Bacteria 10518
370 Ga0207657_10000713 3300025919 Bacteria 35357
371 Ga0207657_10011742 3300025919 Bacteria 8676
372 Ga0207657_10018659 3300025919 Bacteria 6612
373 Ga0207657_10030381 3300025919 Bacteria 4904
374 Ga0207657_10052529 3300025919 Bacteria 3536
375 Ga0207657_10053474 3300025919 Bacteria 3498
376 Ga0207657_10240789 3300025919 Bacteria 1444
377 Ga0207657_10306183 3300025919 Bacteria 1258
378 Ga0207649_10003130 3300025920 Bacteria 9072
379 Ga0207649_10004512 3300025920 Bacteria 7557
380 Ga0207649_10012999 3300025920 Bacteria 4640
381 Ga0207649_10046875 3300025920 Bacteria 2657
382 Ga0207649_10108100 3300025920 Bacteria 1853
383 Ga0207649_10144061 3300025920 Bacteria 1634
384 Ga0207652_10002270 3300025921 Bacteria 16314
385 Ga0207652_10004093 3300025921 Bacteria 11897
386 Ga0207652_10004744 3300025921 Bacteria 11024
387 Ga0207652_10018115 3300025921 Bacteria 5773
388 Ga0207652_10026718 3300025921 Unclassified 4810
389 Ga0207652_10026844 3300025921 Bacteria 4798
390 Ga0207652_10055128 3300025921 Bacteria 3418
391 Ga0207652_10114915 3300025921 Unclassified 2391
392 Ga0207652_10181242 3300025921 Bacteria 1893
393 Ga0207681_10001909 3300025923 Bacteria 13353
394 Ga0207681_10011942 3300025923 Bacteria 5349
395 Ga0207681_10024634 3300025923 Bacteria 3863
396 Ga0207681_10101658 3300025923 Bacteria 2074
397 Ga0207650_10009271 3300025925 Bacteria 6725
398 Ga0207650_10010411 3300025925 Bacteria 6375
399 Ga0207650_10140240 3300025925 Bacteria 1900
400 Ga0207650_10160745 3300025925 Bacteria 1779
401 Ga0207650_10190795 3300025925 Bacteria 1637
402 Ga0207650_10218544 3300025925 Bacteria 1533
403 Ga0207659_10010030 3300025926 Bacteria 5933
404 Ga0207659_10236050 3300025926 Bacteria 1477
405 Ga0207687_10072092 3300025927 Bacteria 2470
406 Ga0207700_10016132 3300025928 Bacteria 4952
407 Ga0207700_10073114 3300025928 Bacteria 2646
408 Ga0207700_10299243 3300025928 Bacteria 1389
409 Ga0207664_10016792 3300025929 Bacteria 5347
410 Ga0207664_10027454 3300025929 Bacteria 4315
411 Ga0207664_10296320 3300025929 Bacteria 1422
412 Ga0207690_10001509 3300025932 Bacteria 14547
413 Ga0207690_10010481 3300025932 Bacteria 5510
414 Ga0207690_10042127 3300025932 Bacteria 2996
415 Ga0207690_10050334 3300025932 Bacteria 2781
416 Ga0207706_10000879 3300025933 Bacteria 30864
417 Ga0207706_10002763 3300025933 Bacteria 17067
418 Ga0207706_10134899 3300025933 Bacteria 2171
419 Ga0207686_10009522 3300025934 Bacteria 5271
420 Ga0207686_10047931 3300025934 Unclassified 2644
421 Ga0207686_10074752 3300025934 Bacteria 2191
422 Ga0207670_10025219 3300025936 Bacteria 3728
423 Ga0207670_10070917 3300025936 Bacteria 2408
424 Ga0207704_10037336 3300025938 Bacteria 2806
425 Ga0207691_10000397 3300025940 Bacteria 43567
426 Ga0207691_10000749 3300025940 Bacteria 32096
427 Ga0207691_10003860 3300025940 Bacteria 14544
428 Ga0207691_10010879 3300025940 Bacteria 8731
429 Ga0207691_10047039 3300025940 Bacteria 3962
430 Ga0207691_10227204 3300025940 Bacteria 1617
431 Ga0207711_10075508 3300025941 Bacteria 2933
432 Ga0207711_10092216 3300025941 Bacteria 2666
433 Ga0207689_10000090 3300025942 Bacteria 73443
434 Ga0207689_10011150 3300025942 Bacteria 7714
435 Ga0207661_10001833 3300025944 Bacteria 14521
436 Ga0207661_10001922 3300025944 Bacteria 14269
437 Ga0207661_10004305 3300025944 Bacteria 9966
438 Ga0207661_10006980 3300025944 Bacteria 8010
439 Ga0207661_10015159 3300025944 Bacteria 5666
440 Ga0207661_10027982 3300025944 Bacteria 4313
441 Ga0207661_10068504 3300025944 Bacteria 2890
442 Ga0207661_10079683 3300025944 Bacteria 2700
443 Ga0207661_10106798 3300025944 Bacteria 2360
444 Ga0207661_10118191 3300025944 Bacteria 2253
445 Ga0207679_10000718 3300025945 Bacteria 22034
446 Ga0207679_10001374 3300025945 Bacteria 15341
447 Ga0207679_10002015 3300025945 Bacteria 12616
448 Ga0207679_10147336 3300025945 Bacteria 1911
449 Ga0207679_10327117 3300025945 Bacteria 1329
450 Ga0207667_10014828 3300025949 Bacteria 8866
451 Ga0207667_10064734 3300025949 Bacteria 3815
452 Ga0207667_10154296 3300025949 Bacteria 2363
453 Ga0207667_10514592 3300025949 Unclassified 1213
454 Ga0207712_10001045 3300025961 Bacteria 19541
455 Ga0207712_10002151 3300025961 Bacteria 12865
456 Ga0207712_10050233 3300025961 Bacteria 2911
457 Ga0207668_10008090 3300025972 Bacteria 6261
458 Ga0207668_10343607 3300025972 Bacteria 1245
459 Ga0207640_10006098 3300025981 Bacteria 6589
460 Ga0207640_10020969 3300025981 Bacteria 3886
461 Ga0207640_10186518 3300025981 Unclassified 1560
462 Ga0207658_10010012 3300025986 Bacteria 6442
463 Ga0207658_10162584 3300025986 Bacteria 1831
464 Ga0207658_10250589 3300025986 Bacteria 1504
465 Ga0207658_10338339 3300025986 Bacteria 1307
466 Ga0207677_10108359 3300026023 Bacteria 2062
467 Ga0207703_10065814 3300026035 Bacteria 2979
468 Ga0207703_10224238 3300026035 Unclassified 1682
469 Ga0207639_10099866 3300026041 Bacteria 2343
470 Ga0207639_10300106 3300026041 Bacteria 1420
471 Ga0207639_10347886 3300026041 Bacteria 1323
472 Ga0207678_10002110 3300026067 Bacteria 18003
473 Ga0207678_10003898 3300026067 Bacteria 13417
474 Ga0207708_10019029 3300026075 Bacteria 5171
475 Ga0207702_10196355 3300026078 Bacteria 1868
476 Ga0207641_10004963 3300026088 Bacteria 11413
477 Ga0207641_10207157 3300026088 Bacteria 1811
478 Ga0207648_10027682 3300026089 Bacteria 5031
479 Ga0207648_10035275 3300026089 Bacteria 4407
480 Ga0207648_10037271 3300026089 Bacteria 4282
481 Ga0207648_10145057 3300026089 Bacteria 2094
482 Ga0207676_10002465 3300026095 Bacteria 13201
483 Ga0207674_10001731 3300026116 Bacteria 27880
484 Ga0207674_10008305 3300026116 Bacteria 12019
485 Ga0207674_10009777 3300026116 Bacteria 10924
486 Ga0207674_10117210 3300026116 Bacteria 2634
487 Ga0207674_10382911 3300026116 Bacteria 1360
488 Ga0207674_10416682 3300026116 Bacteria 1298
489 Ga0207675_100000559 3300026118 Bacteria 36406
490 Ga0207675_100037958 3300026118 Bacteria 4495
491 Ga0207675_100076336 3300026118 Bacteria 3138
492 Ga0207683_10352570 3300026121 Bacteria 1351
493 Ga0207698_10010970 3300026142 Bacteria 5855
494 Ga0207698_10024269 3300026142 Bacteria 4253
495 Ga0207698_10126446 3300026142 Unclassified 2175
496 Ga0207698_10201943 3300026142 Bacteria 1781
497 Ga0209981_1001396 3300027378 Bacteria 3058
498 Ga0209995_1001481 3300027471 Unclassified 3624
499 Ga0209995_1001669 3300027471 Bacteria 3446
500 Ga0209968_1001761 3300027526 Bacteria 3280
501 Ga0209966_1000441 3300027695 Bacteria 11684
502 Ga0209998_10000136 3300027717 Bacteria 28757
503 Ga0209974_10007960 3300027876 Unclassified 3634
504 Ga0207428_10046895 3300027907 Bacteria 3472
505 Ga0268266_10186117 3300028379 Bacteria 1894
506 Ga0268265_10003111 3300028380 Bacteria 12104
507 Ga0268265_10148319 3300028380 Bacteria 1974
508 Ga0268264_10004414 3300028381 Bacteria 12001
509 Ga0268264_10030393 3300028381 Bacteria 4427
510 Ga0268264_10046560 3300028381 Bacteria 3602
511 Ga0307408_100004895 3300031548 Bacteria 9016
512 Ga0307408_100026289 3300031548 Bacteria 3996
513 Ga0307408_100061048 3300031548 Bacteria 2750
514 Ga0307405_10016894 3300031731 Bacteria 3991
515 Ga0307405_10088740 3300031731 Bacteria 2041
516 Ga0307405_10089210 3300031731 Bacteria 2036
517 Ga0307413_10000105 3300031824 Bacteria 21472
518 Ga0307413_10011344 3300031824 Bacteria 4375
519 Ga0307413_10023525 3300031824 Bacteria 3340
520 Ga0307413_10024315 3300031824 Bacteria 3300
521 Ga0307410_10004694 3300031852 Bacteria 7106
522 Ga0307410_10014058 3300031852 Bacteria 4695
523 Ga0307410_10029091 3300031852 Bacteria 3513
524 Ga0307410_10097567 3300031852 Unclassified 2100
525 Ga0307410_10102393 3300031852 Bacteria 2055
526 Ga0307410_10114261 3300031852 Bacteria 1958
527 Ga0307406_10000140 3300031901 Bacteria 43235
528 Ga0307406_10011549 3300031901 Bacteria 5018
529 Ga0307406_10101542 3300031901 Bacteria 1960
530 Ga0307406_10198837 3300031901 Bacteria 1473
531 Ga0307407_10002546 3300031903 Bacteria 7167
532 Ga0307407_10006759 3300031903 Bacteria 5132
533 Ga0307407_10012266 3300031903 Bacteria 4112
534 Ga0307407_10016921 3300031903 Bacteria 3644
535 Ga0307407_10025315 3300031903 Unclassified 3126
536 Ga0307412_10008549 3300031911 Bacteria 5850
537 Ga0307412_10009191 3300031911 Bacteria 5665
538 Ga0307412_10019840 3300031911 Bacteria 4080
539 Ga0307412_10062268 3300031911 Bacteria 2511
540 Ga0307412_10100169 3300031911 Bacteria 2047
541 Ga0307409_100004295 3300031995 Bacteria 7972
542 Ga0307409_100009245 3300031995 Bacteria 6042
543 Ga0307409_100015150 3300031995 Bacteria 5046
544 Ga0307409_100016050 3300031995 Bacteria 4940
545 Ga0307416_100009468 3300032002 Bacteria 6379
546 Ga0307416_100023155 3300032002 Unclassified 4502
547 Ga0307416_100074002 3300032002 Bacteria 2844
548 Ga0307416_100112319 3300032002 Bacteria 2404
549 Ga0307416_100123534 3300032002 Bacteria 2314
550 Ga0307416_100465960 3300032002 Bacteria 1320
551 Ga0307414_10011602 3300032004 Bacteria 5176
552 Ga0307414_10045036 3300032004 Bacteria 3018
553 Ga0307414_10086723 3300032004 Bacteria 2311
554 Ga0307414_10124539 3300032004 Bacteria 1988
555 Ga0307414_10152219 3300032004 Bacteria 1826
556 Ga0307411_10000690 3300032005 Bacteria 12412
557 Ga0307411_10002482 3300032005 Bacteria 8183
558 Ga0307411_10089393 3300032005 Unclassified 2145
559 Ga0307411_10114337 3300032005 Bacteria 1939
560 Ga0307411_10230012 3300032005 Unclassified 1444
561 Ga0307415_100002193 3300032126 Bacteria 9663
562 Ga0307415_100005856 3300032126 Bacteria 6571
563 Ga0307415_100015307 3300032126 Bacteria 4537
564 Ga0307415_100093785 3300032126 Bacteria 2181
565 Ga0307415_100304106 3300032126 Bacteria 1322
566 Ga0373926_0005875 3300035083 Bacteria 4058
567 Ga0373923_0003585 3300035111 Bacteria 5001
568 Ga0373954_0025661 3300035118 Unclassified 2696
569 Ga0373956_0000730 3300035119 Bacteria 13495
570 Ga0373955_0000236 3300035172 Bacteria 22890
571 Ga0373931_0016894 3300035691 Unclassified 3599
572 Ga0373935_0006258 3300035692 Bacteria 7085
573 Ga0373935_0144508 3300035692 Bacteria 1609
574 Ga0373927_0006264 3300035695 Bacteria 8123
575 Ga0373927_0006820 3300035695 Bacteria 7771
576 Ga0373933_0002013 3300035724 Bacteria 11722
577 Ga0373933_0050154 3300035724 Bacteria 2490
578 Ga0373947_0001080 3300035725 Bacteria 16709
579 Ga0373937_0000392 3300036401 Bacteria 40806
580 Ga0373937_0398683 3300036401 Bacteria 1305
581 Ga0373925_0002415 3300037068 Bacteria 14985
582 Ga0373925_0008987 3300037068 Bacteria 7280
583 Ga0395905_0312902 3300037471 Bacteria 1459
584 Ga0466966_0013154 3300044684 Bacteria 5480
585 Ga0466959_0089740 3300045049 Bacteria 2208
586 Ga0466959_0152607 3300045049 Bacteria 1627
587 Ga0451576_0020396 3300045051 Bacteria 7220
588 Ga0451576_0025923 3300045051 Bacteria 6313
589 Ga0466967_0026687 3300045976 Bacteria 4789
590 Ga0495592_0001996 3300046454 Bacteria 14385
591 Ga0495603_0007103 3300046455 Bacteria 6720
592 Ga0495603_0021436 3300046455 Bacteria 3914
593 Ga0495629_0017485 3300046459 Bacteria 5138
594 Ga0495629_0055103 3300046459 Bacteria 2781
595 Ga0495651_0000063 3300046462 Bacteria 78974
596 Ga0495651_0060200 3300046462 Bacteria 2909
597 Ga0495653_0000886 3300046463 Bacteria 23137
598 Ga0495580_0012727 3300046472 Bacteria 6449
599 Ga0495582_0003745 3300046473 Bacteria 8569
600 Ga0495639_0000043 3300046475 Bacteria 55213
601 Ga0495662_0003464 3300046476 Bacteria 7995
602 Ga0495664_0092613 3300046477 Bacteria 1818
603 Ga0495594_0001133 3300046499 Bacteria 13906
604 Ga0495594_0015500 3300046499 Bacteria 4005
605 Ga0495594_0017749 3300046499 Bacteria 3763
606 Ga0495608_0000059 3300046511 Bacteria 89203
607 Ga0495608_0149875 3300046511 Unclassified 1487
608 Ga0495618_0071128 3300046514 Unclassified 2213
609 Ga0495628_0000161 3300046516 Bacteria 58486
610 Ga0495628_0083287 3300046516 Bacteria 2483
611 Ga0495630_0000005 3300046517 Bacteria 406219
612 Ga0495630_0002193 3300046517 Bacteria 13602
613 Ga0495666_0019437 3300046526 Bacteria 3371
614 Ga0495652_0061828 3300046529 Bacteria 3160
615 Ga0495665_0000754 3300046531 Bacteria 16781
616 Ga0495586_0009628 3300046535 Bacteria 5146
617 Ga0495586_0033101 3300046535 Bacteria 2773
618 Ga0495587_0001372 3300046536 Bacteria 16175
619 Ga0495587_0001838 3300046536 Bacteria 14159
620 Ga0495621_0021977 3300046539 Bacteria 2109
621 Ga0495645_0003100 3300046543 Bacteria 11264
622 Ga0495667_0001650 3300046559 Bacteria 14789
623 Ga0495667_0007235 3300046559 Bacteria 7533
624 Ga0495667_0008370 3300046559 Bacteria 7018
625 Ga0495667_0016089 3300046559 Bacteria 5056
626 Ga0495667_0114889 3300046559 Unclassified 1739
627 Ga0495635_0015368 3300046663 Bacteria 5354
628 Ga0495635_0070035 3300046663 Bacteria 2404
629 Ga0495635_0165684 3300046663 Bacteria 1504
630 Ga0495588_0000269 3300046674 Bacteria 40277
631 Ga0495588_0120602 3300046674 Unclassified 1382
632 Ga0495657_0002269 3300046675 Bacteria 16239
633 Ga0495599_0000332 3300046678 Bacteria 28163
634 Ga0495599_0025958 3300046678 Bacteria 3670
635 Ga0495599_0091873 3300046678 Bacteria 1894
636 Ga0495623_0000172 3300046679 Bacteria 40397
637 Ga0495623_0007254 3300046679 Bacteria 7196
638 Ga0495623_0084612 3300046679 Bacteria 1957
639 Ga0495646_0002358 3300046680 Bacteria 11568
640 Ga0495658_0000414 3300046683 Bacteria 23948
641 Ga0495658_0015700 3300046683 Bacteria 3888
642 Ga0495613_0045477 3300046689 Bacteria 3246
643 Ga0495613_0116168 3300046689 Unclassified 1925
644 Ga0495670_0123870 3300046691 Bacteria 1344
645 Ga0495600_0000234 3300046809 Bacteria 30653
646 Ga0495600_0018194 3300046809 Bacteria 4474
647 Ga0495600_0059345 3300046809 Bacteria 2499
648 Ga0495600_0173949 3300046809 Unclassified 1389
649 Ga0495581_0003022 3300047315 Bacteria 9627
650 Ga0495581_0022616 3300047315 Bacteria 3642
651 Ga0495604_0002817 3300047317 Bacteria 13960
652 Ga0495674_0000619 3300047319 Bacteria 33203
653 Ga0495674_0123363 3300047319 Bacteria 2187
654 Ga0495680_0004453 3300047322 Bacteria 13392
655 Ga0495680_0025358 3300047322 Bacteria 4908
656 Ga0495680_0053277 3300047322 Bacteria 3149
657 Ga0495675_0000755 3300047444 Bacteria 20242
658 Ga0495675_0043976 3300047444 Unclassified 2845
659 Ga0495684_0038885 3300047471 Bacteria 3646
660 Ga0495684_0059308 3300047471 Bacteria 2915
661 Ga0495684_0087679 3300047471 Bacteria 2358
662 Ga0495593_0000046 3300047673 Bacteria 50024
663 Ga0495602_0002738 3300048088 Bacteria 18009
664 Ga0495614_0000746 3300048089 Bacteria 13798
665 Ga0496108_0339537 3300048911 Bacteria 1310
666 Ga0496109_0098699 3300048912 Bacteria 2708
667 Ga0496109_0216884 3300048912 Bacteria 1799
668 Ga0496112_0001063 3300048915 Bacteria 20256
669 Ga0496112_0013636 3300048915 Bacteria 7511
670 Ga0496112_0052870 3300048915 Bacteria 3988
671 Ga0496113_0001553 3300048916 Bacteria 12887
672 Ga0496113_0025024 3300048916 Bacteria 4250
673 Ga0501291_003369 3300049514 Unclassified 1984
674 Ga0501292_002391 3300049515 Unclassified 2420
675 Ga0501032_0035943 3300049569 Bacteria 3384
676 Ga0501034_0240803 3300049571 Bacteria 1755
677 Ga0501038_0155116 3300049574 Bacteria 1865
678 Ga0501042_0009168 3300049578 Bacteria 6580
679 Ga0501043_0075362 3300049579 Bacteria 2650
680 Ga0501047_0016066 3300049581 Bacteria 7139
681 Ga0501047_0138805 3300049581 Unclassified 2310
682 Ga0501070_0023688 3300049586 Bacteria 5144
683 Ga0501070_0102494 3300049586 Bacteria 2367
684 Ga0501070_0242284 3300049586 Bacteria 1476
685 Ga0501073_0010595 3300049589 Bacteria 6745
686 Ga0501217_003480 3300049661 Unclassified 3182
687 Ga0501223_004129 3300049663 Unclassified 3129
688 Ga0501227_006812 3300049665 Unclassified 2451
689 Ga0501235_003835 3300049669 Unclassified 3246
690 Ga0501257_004766 3300049686 Unclassified 2968
691 Ga0501221_002088 3300049704 Unclassified 3324
692 Ga0501225_0007839 3300049705 Unclassified 3083
693 Ga0501234_002606 3300049707 Unclassified 2840
694 Ga0501079_0009087 3300049741 Bacteria 7525
695 Ga0501270_004827 3300049767 Bacteria 1534
696 Ga0501272_001445 3300049769 Unclassified 2251
697 Ga0501044_0250413 3300049823 Bacteria 1713
698 nmdc:mga05p37_31629_c1 3300050507 Bacteria 6465
699 nmdc:mga09592_139782_c1 3300050508 Bacteria 2087
700 nmdc:mga09592_73954_c1 3300050508 Bacteria 2896
701 nmdc:mga09592_97248_c1 3300050508 Unclassified 2519
702 nmdc:mga0qj67_10462_c1 3300050509 Bacteria 6931
703 nmdc:mga0qj67_138220_c1 3300050509 Bacteria 1975
704 nmdc:mga0qj67_9155_c1 3300050509 Bacteria 7352
705 nmdc:mga06r32_14564_c1 3300050510 Bacteria 7139
706 nmdc:mga06r32_33191_c1 3300050510 Bacteria 4861
707 nmdc:mga06r32_4770_c1 3300050510 Bacteria 12194
708 nmdc:mga08y16_231023_c1 3300050511 Bacteria 1913
709 nmdc:mga08y16_44546_c1 3300050511 Bacteria 4648
710 nmdc:mga0n895_195306_c1 3300050512 Bacteria 2055
711 nmdc:mga0n895_32219_c1 3300050512 Bacteria 5030
712 nmdc:mga0rr50_354496_c1 3300050513 Bacteria 1234
713 nmdc:mga0rr50_96670_c1 3300050513 Bacteria 2311
714 nmdc:mga08x19_61088_c1 3300050514 Bacteria 2442
715 nmdc:mga0a205_10900_c1 3300050515 Bacteria 8362
716 nmdc:mga0a205_29408_c1 3300050515 Bacteria 5257
717 nmdc:mga0a205_36312_c1 3300050515 Bacteria 3460
718 Ga0495601_0014503 3300053077 Bacteria 4749
719 Ga0495612_0000730 3300053078 Bacteria 13339
720 Ga0495595_0008696 3300053084 Unclassified 4179
721 Ga0495619_0194452 3300053085 Bacteria 1404
722 Ga0500583_0078960 3300053092 Unclassified 1587
723 Ga0590077_010516 3300059426 Unclassified 1904
724 Ga0501047_0112414
725 Ga0065712_10081653
726 Ga0065712_10084477
727 Ga0065715_10090060
728 Ga0070658_10016972
729 Ga0070658_10023203
730 Ga0070658_10027634
731 Ga0070676_10004143
732 Ga0070683_100001771
733 Ga0070683_100002337
734 Ga0070683_100005783
735 Ga0070683_100024074
736 Ga0070683_100024256
737 Ga0070683_100028791
738 Ga0070683_100030147
739 Ga0070683_100068760
740 Ga0070683_100278282
741 Ga0070690_100047288
742 Ga0070690_100119021
743 Ga0070670_100002906
744 Ga0070670_100003101
745 Ga0070670_100020759
746 Ga0070670_100044348
747 Ga0070670_100320688
748 Ga0068869_100002687
749 Ga0068869_100005469
750 Ga0070666_10047462
751 Ga0070666_10051859
752 Ga0070680_100000549
753 Ga0070680_100003550
754 Ga0070680_100015134
755 Ga0070680_100020891
756 Ga0070680_100045895
757 Ga0070680_100064090
758 Ga0070680_100221882
759 Ga0070680_100319240
760 Ga0068868_100018977
761 Ga0070660_100009180
762 Ga0070660_100091391
763 Ga0070689_100001477
764 Ga0070689_100003049
765 Ga0070689_100162151
766 Ga0070691_10032212
767 Ga0070691_10036146
768 Ga0070687_100002767
769 Ga0070661_100001095
770 Ga0070661_100001986
771 Ga0070661_100011217
772 Ga0070661_100035132
773 Ga0070661_100073416
774 Ga0070661_100079498
775 Ga0070661_100096312
776 Ga0070661_100135612
777 Ga0070661_100224555
778 Ga0070692_10007664
779 Ga0070692_10020004
780 Ga0070692_10141547
781 Ga0070668_100001458
782 Ga0070668_100010400
783 Ga0070668_100011615
784 Ga0070669_100005793
785 Ga0070669_100007548
786 Ga0070669_100040156
787 Ga0070669_100098081
788 Ga0070675_100003257
789 Ga0070675_100004973
790 Ga0070675_100006583
791 Ga0070675_100307032
792 Ga0070671_100009928
793 Ga0070671_100027176
794 Ga0070674_100021183
795 Ga0070674_100022833
796 Ga0070674_100098041
797 Ga0070673_100015225
798 Ga0070688_100000737
799 Ga0070659_100001063
800 Ga0070659_100081119
801 Ga0070659_100164567
802 Ga0070667_100006637
803 Ga0070667_100016113
804 Ga0070709_10004619
805 Ga0070714_100003646
806 Ga0070714_100022033
807 Ga0070714_100023449
808 Ga0070714_100027115
809 Ga0070714_100034410
810 Ga0070713_100000500
811 Ga0070713_100001301
812 Ga0070710_10030065
813 Ga0070710_10061176
814 Ga0070711_100054934
815 Ga0070700_100010430
816 Ga0070694_100066499
817 Ga0070708_100000113
818 Ga0070663_100004575
819 Ga0070663_100033945
820 Ga0070678_100079345
821 Ga0070678_100270633
822 Ga0070662_100001788
823 Ga0070662_100002560
824 Ga0070662_100044354
825 Ga0070662_100095194
826 Ga0070681_10000861
827 Ga0070681_10004075
828 Ga0070681_10008859
829 Ga0070681_10029584
830 Ga0070681_10040316
831 Ga0070681_10043560
832 Ga0070681_10076680
833 Ga0070681_10114256
834 Ga0070681_10144659
835 Ga0068867_100080884
836 Ga0070706_100053613
837 Ga0070707_100021762
838 Ga0070707_100081710
839 Ga0070698_100006904
840 Ga0070699_100028391
841 Ga0070679_100001943
842 Ga0070679_100010961
843 Ga0070679_100028027
844 Ga0070679_100041584
845 Ga0070679_100121493
846 Ga0070679_100202275
847 Ga0070684_100001622
848 Ga0070684_100011747
849 Ga0070684_100015964
850 Ga0070684_100021992
851 Ga0070684_100026336
852 Ga0070684_100029462
853 Ga0070684_100032204
854 Ga0070684_100038352
855 Ga0070684_100053268
856 Ga0070684_100086941
857 Ga0070684_100259676
858 Ga0070697_100208590
859 Ga0068853_100006109
860 Ga0068853_100010958
861 Ga0068853_100364986
862 Ga0070672_100007183
863 Ga0070672_100010189
864 Ga0070672_100105768
865 Ga0070672_100210472
866 Ga0070693_100002407
867 Ga0070693_100033878
868 Ga0068855_100003991
869 Ga0068855_100041900
870 Ga0068855_100131469
871 Ga0068855_100576250
872 Ga0070664_100002366
873 Ga0070664_100004858
874 Ga0070664_100017055
875 Ga0070664_100064031
876 Ga0070664_100110325
877 Ga0070664_100301608
878 Ga0068857_100000717
879 Ga0068857_100009343
880 Ga0068857_100070735
881 Ga0068857_100156821
882 Ga0068857_100172358
883 Ga0068854_100066377
884 Ga0068854_100105728
885 Ga0068856_100005061
886 Ga0068856_100094553
887 Ga0068856_100106727
888 Ga0070702_100001089
889 Ga0068852_100003092
890 Ga0068852_100006855
891 Ga0068852_100034319
892 Ga0068852_100052452
893 Ga0068852_100218227
894 Ga0068852_100246204
895 Ga0068859_100006482
896 Ga0068859_100017946
897 Ga0068859_100474574
898 Ga0068864_100011237
899 Ga0068864_100354437
900 Ga0068861_100029036
901 Ga0068861_100206280
902 Ga0068851_10009966
903 Ga0068851_10056643
904 Ga0068870_10001495
905 Ga0068870_10002245
906 Ga0068863_100003586
907 Ga0068863_100013098
908 Ga0068858_100024866
909 Ga0068860_100007588
910 Ga0068860_100031055
911 Ga0068860_100381459
912 Ga0068862_100006543
913 Ga0068862_100044812
914 Ga0081539_10028031
915 Ga0070717_10005385
916 Ga0070717_10246668
917 Ga0070712_100053730
918 Ga0097621_100003544
919 Ga0068871_100005248
920 Ga0075428_100021717
921 Ga0075428_100039125
922 Ga0075428_100115978
923 Ga0075430_100000793
924 Ga0075430_100002235
925 Ga0075430_100029727
926 Ga0075430_100038768
927 Ga0075431_100006586
928 Ga0075431_100012430
929 Ga0075431_100015003
930 Ga0075431_100054203
931 Ga0075433_10009057
932 Ga0075433_10009137
933 Ga0075434_100016868
934 Ga0075434_100062318
935 Ga0075429_100152357
936 Ga0075429_100231675
937 Ga0068865_100000586
938 Ga0068865_100183177
939 Ga0075436_100013334
940 Ga0097620_100006482
941 Ga0097620_100017945
942 Ga0097620_100474529
943 Ga0105240_10003364
944 Ga0105240_10052489
945 Ga0105240_10059371
946 Ga0105240_10066191
947 Ga0105240_10068136
948 Ga0105240_10183389
949 Ga0105240_10306399
950 Ga0111539_10021037
951 Ga0111539_10072464
952 Ga0105245_10002700
953 Ga0105245_10045342
954 Ga0105245_10269171
955 Ga0114129_10041167
956 Ga0114129_10072761
957 Ga0114129_10160092
958 Ga0114129_10175372
959 Ga0105241_10000247
960 Ga0105241_10005331
961 Ga0105241_10056445
962 Ga0105242_10011773
963 Ga0105242_10012041
964 Ga0105242_10174315
965 Ga0105248_10009852
966 Ga0105248_10082814
967 Ga0105248_10168962
968 Ga0105248_10345888
969 Ga0105237_10003172
970 Ga0105237_10042668
971 Ga0105237_10307223
972 Ga0105238_10056549
973 Ga0105249_10000101
974 Ga0105249_10004615
975 Ga0105249_10004803
976 Ga0105239_10261897
977 Ga0105246_10001462
978 Ga0105246_10047544
979 Ga0157373_10010660
980 Ga0157373_10025939
981 Ga0157373_10026650
982 Ga0157373_10052510
983 Ga0157373_10111015
984 Ga0157371_10002940
985 Ga0157371_10032850
986 Ga0157371_10067814
987 Ga0157371_10137497
988 Ga0157371_10151369
989 Ga0157370_10000502
990 Ga0157370_10006161
991 Ga0157370_10020281
992 Ga0157370_10047558
993 Ga0157370_10047966
994 Ga0157370_10138333
995 Ga0157370_10268509
996 Ga0157370_10358166
997 Ga0157369_10008069
998 Ga0157369_10013726
999 Ga0157369_10049380
1000 Ga0157369_10084347
1001 Ga0157369_10161668
1002 Ga0157374_10006651
1003 Ga0157374_10148559
1004 Ga0157378_10011577
1005 Ga0157378_10090410
1006 Ga0163162_10007004
1007 Ga0163162_10036042
1008 Ga0163162_10080676
1009 Ga0163162_10122464
1010 Ga0157372_10017080
1011 Ga0157372_10019557
1012 Ga0157372_10031570
1013 Ga0157372_10037089
1014 Ga0157372_10041619
1015 Ga0157372_10046786
1016 Ga0157372_10049069
1017 Ga0157372_10090546
1018 Ga0157372_10096466
1019 Ga0157372_10117978
1020 Ga0157372_10160729
1021 Ga0157372_10161731
1022 Ga0157372_10234105
1023 Ga0157375_10012024
1024 Ga0157375_10020448
1025 Ga0157375_10022647
1026 Ga0157375_10055592
1027 Ga0157375_10326379
1028 Ga0157375_10498927
1029 Ga0163163_10004994
1030 Ga0163163_10005080
1031 Ga0157380_10028884
1032 Ga0157380_10161166
1033 Ga0182008_10007043
1034 Ga0157377_10002965
1035 Ga0157379_10020295
1036 Ga0157379_10349492
1037 Ga0157376_10001117
1038 Ga0157376_10004634
1039 Ga0163161_10027936
1040 Ga0207697_10011739
1041 Ga0207697_10029248
1042 Ga0207682_10047328
1043 Ga0207688_10025972
1044 Ga0207680_10053746
1045 Ga0207699_10012234
1046 Ga0207699_10027475
1047 Ga0207699_10038204
1048 Ga0207645_10000153
1049 Ga0207643_10004278
1050 Ga0207643_10004496
1051 Ga0207705_10019925
1052 Ga0207705_10036612
1053 Ga0207705_10062483
1054 Ga0207705_10133029
1055 Ga0207684_10060442
1056 Ga0207654_10000514
1057 Ga0207707_10000782
1058 Ga0207707_10001939
1059 Ga0207707_10003206
1060 Ga0207707_10005437
1061 Ga0207707_10013095
1062 Ga0207707_10020354
1063 Ga0207707_10023642
1064 Ga0207707_10023667
1065 Ga0207707_10031739
1066 Ga0207707_10040113
1067 Ga0207707_10111448
1068 Ga0207707_10134433
1069 Ga0207695_10002156
1070 Ga0207695_10003956
1071 Ga0207695_10014103
1072 Ga0207695_10023946
1073 Ga0207695_10029961
1074 Ga0207695_10040495
1075 Ga0207695_10058182
1076 Ga0207695_10061244
1077 Ga0207695_10122104
1078 Ga0207695_10295615
1079 Ga0207671_10116363
1080 Ga0207671_10127052
1081 Ga0207693_10014675
1082 Ga0207693_10033775
1083 Ga0207663_10186653
1084 Ga0207660_10001287
1085 Ga0207660_10001807
1086 Ga0207660_10003312
1087 Ga0207660_10051039
1088 Ga0207660_10130053
1089 Ga0207660_10153178
1090 Ga0207660_10243624
1091 Ga0207662_10000185
1092 Ga0207662_10001799
1093 Ga0207657_10000713
1094 Ga0207657_10011742
1095 Ga0207657_10018659
1096 Ga0207657_10030381
1097 Ga0207657_10052529
1098 Ga0207657_10053474
1099 Ga0207657_10240789
1100 Ga0207657_10306183
1101 Ga0207649_10003130
1102 Ga0207649_10004512
1103 Ga0207649_10012999
1104 Ga0207649_10046875
1105 Ga0207649_10108100
1106 Ga0207649_10144061
1107 Ga0207652_10002270
1108 Ga0207652_10004093
1109 Ga0207652_10004744
1110 Ga0207652_10018115
1111 Ga0207652_10026718
1112 Ga0207652_10026844
1113 Ga0207652_10055128
1114 Ga0207652_10114915
1115 Ga0207652_10181242
1116 Ga0207681_10001909
1117 Ga0207681_10011942
1118 Ga0207681_10024634
1119 Ga0207681_10101658
1120 Ga0207650_10009271
1121 Ga0207650_10010411
1122 Ga0207650_10140240
1123 Ga0207650_10160745
1124 Ga0207650_10190795
1125 Ga0207650_10218544
1126 Ga0207659_10010030
1127 Ga0207659_10236050
1128 Ga0207687_10072092
1129 Ga0207700_10016132
1130 Ga0207700_10073114
1131 Ga0207700_10299243
1132 Ga0207664_10016792
1133 Ga0207664_10027454
1134 Ga0207664_10296320
1135 Ga0207690_10001509
1136 Ga0207690_10010481
1137 Ga0207690_10042127
1138 Ga0207690_10050334
1139 Ga0207706_10000879
1140 Ga0207706_10002763
1141 Ga0207706_10134899
1142 Ga0207686_10009522
1143 Ga0207686_10047931
1144 Ga0207686_10074752
1145 Ga0207670_10025219
1146 Ga0207670_10070917
1147 Ga0207704_10037336
1148 Ga0207691_10000397
1149 Ga0207691_10000749
1150 Ga0207691_10003860
1151 Ga0207691_10010879
1152 Ga0207691_10047039
1153 Ga0207691_10227204
1154 Ga0207711_10075508
1155 Ga0207711_10092216
1156 Ga0207689_10000090
1157 Ga0207689_10011150
1158 Ga0207661_10001833
1159 Ga0207661_10001922
1160 Ga0207661_10004305
1161 Ga0207661_10006980
1162 Ga0207661_10015159
1163 Ga0207661_10027982
1164 Ga0207661_10068504
1165 Ga0207661_10079683
1166 Ga0207661_10106798
1167 Ga0207661_10118191
1168 Ga0207679_10000718
1169 Ga0207679_10001374
1170 Ga0207679_10002015
1171 Ga0207679_10147336
1172 Ga0207679_10327117
1173 Ga0207667_10014828
1174 Ga0207667_10064734
1175 Ga0207667_10154296
1176 Ga0207667_10514592
1177 Ga0207712_10001045
1178 Ga0207712_10002151
1179 Ga0207712_10050233
1180 Ga0207668_10008090
1181 Ga0207668_10343607
1182 Ga0207640_10006098
1183 Ga0207640_10020969
1184 Ga0207640_10186518
1185 Ga0207658_10010012
1186 Ga0207658_10162584
1187 Ga0207658_10250589
1188 Ga0207658_10338339
1189 Ga0207677_10108359
1190 Ga0207703_10065814
1191 Ga0207703_10224238
1192 Ga0207639_10099866
1193 Ga0207639_10300106
1194 Ga0207639_10347886
1195 Ga0207678_10002110
1196 Ga0207678_10003898
1197 Ga0207708_10019029
1198 Ga0207702_10196355
1199 Ga0207641_10004963
1200 Ga0207641_10207157
1201 Ga0207648_10027682
1202 Ga0207648_10035275
1203 Ga0207648_10037271
1204 Ga0207648_10145057
1205 Ga0207676_10002465
1206 Ga0207674_10001731
1207 Ga0207674_10008305
1208 Ga0207674_10009777
1209 Ga0207674_10117210
1210 Ga0207674_10382911
1211 Ga0207674_10416682
1212 Ga0207675_100000559
1213 Ga0207675_100037958
1214 Ga0207675_100076336
1215 Ga0207683_10352570
1216 Ga0207698_10010970
1217 Ga0207698_10024269
1218 Ga0207698_10126446
1219 Ga0207698_10201943
1220 Ga0209981_1001396
1221 Ga0209995_1001481
1222 Ga0209995_1001669
1223 Ga0209968_1001761
1224 Ga0209966_1000441
1225 Ga0209998_10000136
1226 Ga0209974_10007960
1227 Ga0207428_10046895
1228 Ga0268266_10186117
1229 Ga0268265_10003111
1230 Ga0268265_10148319
1231 Ga0268264_10004414
1232 Ga0268264_10030393
1233 Ga0268264_10046560
1234 Ga0307408_100004895
1235 Ga0307408_100026289
1236 Ga0307408_100061048
1237 Ga0307405_10016894
1238 Ga0307405_10088740
1239 Ga0307405_10089210
1240 Ga0307413_10000105
1241 Ga0307413_10011344
1242 Ga0307413_10023525
1243 Ga0307413_10024315
1244 Ga0307410_10004694
1245 Ga0307410_10014058
1246 Ga0307410_10029091
1247 Ga0307410_10097567
1248 Ga0307410_10102393
1249 Ga0307410_10114261
1250 Ga0307406_10000140
1251 Ga0307406_10011549
1252 Ga0307406_10101542
1253 Ga0307406_10198837
1254 Ga0307407_10002546
1255 Ga0307407_10006759
1256 Ga0307407_10012266
1257 Ga0307407_10016921
1258 Ga0307407_10025315
1259 Ga0307412_10008549
1260 Ga0307412_10009191
1261 Ga0307412_10019840
1262 Ga0307412_10062268
1263 Ga0307412_10100169
1264 Ga0307409_100004295
1265 Ga0307409_100009245
1266 Ga0307409_100015150
1267 Ga0307409_100016050
1268 Ga0307416_100009468
1269 Ga0307416_100023155
1270 Ga0307416_100074002
1271 Ga0307416_100112319
1272 Ga0307416_100123534
1273 Ga0307416_100465960
1274 Ga0307414_10011602
1275 Ga0307414_10045036
1276 Ga0307414_10086723
1277 Ga0307414_10124539
1278 Ga0307414_10152219
1279 Ga0307411_10000690
1280 Ga0307411_10002482
1281 Ga0307411_10089393
1282 Ga0307411_10114337
1283 Ga0307411_10230012
1284 Ga0307415_100002193
1285 Ga0307415_100005856
1286 Ga0307415_100015307
1287 Ga0307415_100093785
1288 Ga0307415_100304106
1289 Ga0373926_0005875
1290 Ga0373923_0003585
1291 Ga0373954_0025661
1292 Ga0373956_0000730
1293 Ga0373955_0000236
1294 Ga0373931_0016894
1295 Ga0373935_0006258
1296 Ga0373935_0144508
1297 Ga0373927_0006264
1298 Ga0373927_0006820
1299 Ga0373933_0002013
1300 Ga0373933_0050154
1301 Ga0373947_0001080
1302 Ga0373937_0000392
1303 Ga0373937_0398683
1304 Ga0373925_0002415
1305 Ga0373925_0008987
1306 Ga0395905_0312902
1307 Ga0466966_0013154
1308 Ga0466959_0089740
1309 Ga0466959_0152607
1310 Ga0451576_0020396
1311 Ga0451576_0025923
1312 Ga0466967_0026687
1313 Ga0495592_0001996
1314 Ga0495603_0007103
1315 Ga0495603_0021436
1316 Ga0495629_0017485
1317 Ga0495629_0055103
1318 Ga0495651_0000063
1319 Ga0495651_0060200
1320 Ga0495653_0000886
1321 Ga0495580_0012727
1322 Ga0495582_0003745
1323 Ga0495639_0000043
1324 Ga0495662_0003464
1325 Ga0495664_0092613
1326 Ga0495594_0001133
1327 Ga0495594_0015500
1328 Ga0495594_0017749
1329 Ga0495608_0000059
1330 Ga0495608_0149875
1331 Ga0495618_0071128
1332 Ga0495628_0000161
1333 Ga0495628_0083287
1334 Ga0495630_0000005
1335 Ga0495630_0002193
1336 Ga0495666_0019437
1337 Ga0495652_0061828
1338 Ga0495665_0000754
1339 Ga0495586_0009628
1340 Ga0495586_0033101
1341 Ga0495587_0001372
1342 Ga0495587_0001838
1343 Ga0495621_0021977
1344 Ga0495645_0003100
1345 Ga0495667_0001650
1346 Ga0495667_0007235
1347 Ga0495667_0008370
1348 Ga0495667_0016089
1349 Ga0495667_0114889
1350 Ga0495635_0015368
1351 Ga0495635_0070035
1352 Ga0495635_0165684
1353 Ga0495588_0000269
1354 Ga0495588_0120602
1355 Ga0495657_0002269
1356 Ga0495599_0000332
1357 Ga0495599_0025958
1358 Ga0495599_0091873
1359 Ga0495623_0000172
1360 Ga0495623_0007254
1361 Ga0495623_0084612
1362 Ga0495646_0002358
1363 Ga0495658_0000414
1364 Ga0495658_0015700
1365 Ga0495613_0045477
1366 Ga0495613_0116168
1367 Ga0495670_0123870
1368 Ga0495600_0000234
1369 Ga0495600_0018194
1370 Ga0495600_0059345
1371 Ga0495600_0173949
1372 Ga0495581_0003022
1373 Ga0495581_0022616
1374 Ga0495604_0002817
1375 Ga0495674_0000619
1376 Ga0495674_0123363
1377 Ga0495680_0004453
1378 Ga0495680_0025358
1379 Ga0495680_0053277
1380 Ga0495675_0000755
1381 Ga0495675_0043976
1382 Ga0495684_0038885
1383 Ga0495684_0059308
1384 Ga0495684_0087679
1385 Ga0495593_0000046
1386 Ga0495602_0002738
1387 Ga0495614_0000746
1388 Ga0496108_0339537
1389 Ga0496109_0098699
1390 Ga0496109_0216884
1391 Ga0496112_0001063
1392 Ga0496112_0013636
1393 Ga0496112_0052870
1394 Ga0496113_0001553
1395 Ga0496113_0025024
1396 Ga0501291_003369
1397 Ga0501292_002391
1398 Ga0501032_0035943
1399 Ga0501034_0240803
1400 Ga0501038_0155116
1401 Ga0501042_0009168
1402 Ga0501043_0075362
1403 Ga0501047_0016066
1404 Ga0501047_0138805
1405 Ga0501070_0023688
1406 Ga0501070_0102494
1407 Ga0501070_0242284
1408 Ga0501073_0010595
1409 Ga0501217_003480
1410 Ga0501223_004129
1411 Ga0501227_006812
1412 Ga0501235_003835
1413 Ga0501257_004766
1414 Ga0501221_002088
1415 Ga0501225_0007839
1416 Ga0501234_002606
1417 Ga0501079_0009087
1418 Ga0501270_004827
1419 Ga0501272_001445
1420 Ga0501044_0250413
1421 nmdc:mga05p37_31629_c1
1422 nmdc:mga09592_139782_c1
1423 nmdc:mga09592_73954_c1
1424 nmdc:mga09592_97248_c1
1425 nmdc:mga0qj67_10462_c1
1426 nmdc:mga0qj67_138220_c1
1427 nmdc:mga0qj67_9155_c1
1428 nmdc:mga06r32_14564_c1
1429 nmdc:mga06r32_33191_c1
1430 nmdc:mga06r32_4770_c1
1431 nmdc:mga08y16_231023_c1
1432 nmdc:mga08y16_44546_c1
1433 nmdc:mga0n895_195306_c1
1434 nmdc:mga0n895_32219_c1
1435 nmdc:mga0rr50_354496_c1
1436 nmdc:mga0rr50_96670_c1
1437 nmdc:mga08x19_61088_c1
1438 nmdc:mga0a205_10900_c1
1439 nmdc:mga0a205_29408_c1
1440 nmdc:mga0a205_36312_c1
1441 Ga0495601_0014503
1442 Ga0495612_0000730
1443 Ga0495595_0008696
1444 Ga0495619_0194452
1445 Ga0500583_0078960
1446 Ga0590077_010516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03435

Sacchrp_dh_NADP

Saccharopine dehydrogenase NADP binding domain

3

124

0.95

PF16653

Sacchrp_dh_C

Saccharopine dehydrogenase C-terminal domain

128

373

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abi-assembly1.cif.gz_B crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.9067 1 377
3abi-assembly1.cif.gz_A crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.9055 1 377
3abi-assembly1.cif.gz_B crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.8994 1 377
3abi-assembly1.cif.gz_A crystal structure of l-lysine dehydrogenase from hyperthermophilic archaeon pyrococcus horikoshii 0.8984 1 377
3jsk-assembly2.cif.gz_M thiazole synthase from neurospora crassa 0.869 2 33
ID Description Score Start End Superfamily
3a63B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9276 130 327 3.30.360.10
3a63B02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9173 130 327 3.30.360.10
af_Q54NG9_2_127_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8927 1 126 3.40.50.720
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8776 1 128 3.40.50.720
af_A0A1D8PKJ4_3_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8709 1 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A257SBX0-F1-model_v4 Saccharopine dehydrogenase-like C-terminal domain-containing protein 0.9893 133 381 GO:0016491
AF-A0A2V7R2I9-F1-model_v4 Saccharopine dehydrogenase 0.9822 1 379 GO:0016491
AF-A0A257SBX0-F1-model_v4 Saccharopine dehydrogenase-like C-terminal domain-containing protein 0.9815 133 381 GO:0016491
AF-A0A2V7P6J6-F1-model_v4 Saccharopine dehydrogenase 0.9802 133 247
AF-A0A7C2R5M4-F1-model_v4 Saccharopine dehydrogenase 0.9796 1 380 GO:0016491

Map