F477376

General Info

Members Datasets Scaffolds Average Seq Length
721 486 433 200

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0171773|Ga0373935_0171773_521_1129
Length 202
Sequence MSDSASPHTGRRVTFVRFLPLIILLLLLGGFGLALQQQYSGKDTSVLPSALIGKNAPDLALQPLNGAVAGGKQVPALTTAAIKGKLTLVNVFASWCIPCRQEHPVIMGLSQDDRLTVVGINYKDKTDAALAFLGELGNPFKAIGVDPAGAFAIDWGVYGIPETFLVSPDGVIVYKHVGPFDDNAVKNELYPAIEKALVGAKG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
16 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
25 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
26 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
27 2519899620 Rhizobium sp. Pop5 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
31 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
32 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
33 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
39 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
40 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
41 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
44 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
45 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
46 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
47 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
48 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
49 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
50 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
51 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
52 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
53 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
54 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
55 2643221557 Ensifer sp. Root558 Isolate Unclassified
56 2643221558 Rhizobium sp. Root149 Isolate Unclassified
57 2643221582 Rhizobium sp. Root651 Isolate Unclassified
58 2643221599 Rhizobium sp. Root708 Isolate Unclassified
59 2643221618 Ensifer sp. Root231 Isolate Unclassified
60 2643221626 Ensifer sp. Root31 Isolate Unclassified
61 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
62 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
63 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
64 2643221655 Ensifer sp. Root1252 Isolate Unclassified
65 2643221659 Ensifer sp. Root127 Isolate Unclassified
66 2643221668 Ensifer sp. Root423 Isolate Unclassified
67 2643221693 Rhizobium sp. Root491 Isolate Unclassified
68 2643221698 Ensifer sp. Root142 Isolate Unclassified
69 2643221712 Ensifer sp. Root258 Isolate Unclassified
70 2643221719 Rhizobium sp. Root274 Isolate Unclassified
71 2643221723 Ensifer sp. Root278 Isolate Unclassified
72 2718217882 Rhizobium sp. N741 Isolate Nodule
73 2718217927 Rhizobium sp. N324 Isolate Nodule
74 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
75 2718218009 Rhizobium sp. N561 Isolate Nodule
76 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
77 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
78 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
79 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
80 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
81 2718218363 Rhizobium sp. N113 Isolate Nodule
82 2718218365 Rhizobium sp. N731 Isolate Nodule
83 2718218366 Rhizobium sp. N621 Isolate Nodule
84 2718218423 Rhizobium sp. N941 Isolate Nodule
85 2721755514 Rhizobium sp. N6212 Isolate Nodule
86 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
87 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
88 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
89 2721755809 Rhizobium sp. N541 Isolate Nodule
90 2721755810 Rhizobium sp. N871 Isolate Nodule
91 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
92 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
93 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
94 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
95 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
96 2728369365 Rhizobium sp. N1341 Isolate Nodule
97 2728369397 Rhizobium sp. N1314 Isolate Nodule
98 2738541293 Rhizobium sp. GV031 Isolate Unclassified
99 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
100 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
101 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
102 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
103 2791355256 Rhizobium sp. M10 Isolate Nodule
104 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
105 2791355260 Rhizobium sp. L9 Isolate Nodule
106 2791355261 Rhizobium sp. J15 Isolate Nodule
107 2791355262 Rhizobium sp. M1 Isolate Nodule
108 2791355263 Rhizobium chutanense C5 Isolate Nodule
109 2791355264 Rhizobium sp. S9 Isolate Nodule
110 2791355265 Rhizobium sp. H4 Isolate Nodule
111 2791355266 Rhizobium sp. L43 Isolate Nodule
112 2791355267 Rhizobium sp. L18 Isolate Nodule
113 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
114 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
115 2802429633 Rhizobium anhuiense J3 Isolate Nodule
116 2802429634 Rhizobium anhuiense S10 Isolate Nodule
117 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
118 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
119 2802429637 Rhizobium anhuiense C15 Isolate Nodule
120 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
121 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
122 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
123 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
124 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
125 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
126 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
127 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
128 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
129 2838048938 Rhizobium pisi 27/80 Isolate Nodule
130 2838061910 Rhizobium phaseoli L15 Isolate Nodule
131 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
132 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
133 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
134 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
135 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
136 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
137 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
138 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
139 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
140 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
141 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
142 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
143 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
144 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
145 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
146 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
147 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
148 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
149 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
150 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
151 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
152 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
153 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
154 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
155 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
156 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
157 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
158 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
159 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
160 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
161 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
162 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
163 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
164 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
165 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
166 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
167 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
168 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
169 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
170 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
171 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
172 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
173 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
174 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
175 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
176 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
177 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
178 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
179 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
180 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
181 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
182 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
183 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
184 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
185 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
186 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
187 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
188 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
189 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
190 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
191 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
192 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
193 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
194 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
195 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
196 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
197 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
198 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
199 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
200 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
201 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
202 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
203 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
204 2844163670 Ensifer sp. 1H6 Isolate Unclassified
205 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
206 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
207 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
208 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
209 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
210 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
211 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
212 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
213 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
214 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
215 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
216 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
217 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
218 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
219 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
220 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
221 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
222 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
223 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
224 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
225 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
226 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
227 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
228 2933599457 Rhizobium phaseoli M3 Isolate Nodule
229 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
230 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
231 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
232 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
233 2936381700 Rhizobium chutanense C16 Isolate Unclassified
234 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
235 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
236 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
237 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
238 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
239 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
240 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
241 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
242 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
243 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
244 2996887358 Rhizobium sp. R711 Isolate Nodule
245 2996893221 Rhizobium sp. R635 Isolate Nodule
246 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
247 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
248 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
249 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
250 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
251 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
252 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
253 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
254 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
255 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
256 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
257 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
258 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
259 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
260 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
261 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
262 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
263 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
264 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
265 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
266 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
267 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
268 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
269 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
270 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
271 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
272 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
273 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
274 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
275 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
276 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
277 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
278 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
279 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
282 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
283 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
284 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
285 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
286 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
287 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
288 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
289 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
290 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
291 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
292 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
293 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
294 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
295 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
296 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
297 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
298 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
299 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
300 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
301 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
302 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
304 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
311 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
313 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
317 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
319 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
320 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
322 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
323 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
324 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
325 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
326 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
327 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
328 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
329 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
330 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
331 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
332 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
333 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
334 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
335 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
336 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
337 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
338 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
339 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
340 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
341 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
342 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
343 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
344 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
345 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
346 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
347 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
348 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
351 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
352 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
353 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
354 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
357 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
358 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
359 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
360 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
361 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
362 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
363 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
369 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
370 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
371 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
372 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
373 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
374 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
375 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
376 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
377 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
381 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
382 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
383 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
384 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
385 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
390 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
391 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
392 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
393 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
398 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
399 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
400 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
418 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
419 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
422 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
423 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
424 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
425 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
426 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
427 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
428 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
431 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
432 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
435 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
436 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
437 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
438 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
439 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
440 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
441 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
444 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
445 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
446 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
447 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
448 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
449 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
450 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
451 8005258706 Rhizobium sp. R693 Isolate Nodule
452 8005275841 Rhizobium sp. N4311 Isolate Nodule
453 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
454 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
455 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
456 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
457 8005321885 Rhizobium sp. R72 Isolate Nodule
458 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
459 8005382845 Rhizobium sp. R634 Isolate Nodule
460 8005395548 Rhizobium sp. R339 Isolate Nodule
461 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
462 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
463 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
464 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
465 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
466 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
467 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
468 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
469 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
470 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
471 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
472 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
473 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
474 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
475 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
476 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
477 8018176218 Rhizobium sp. N122 Isolate Nodule
478 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
479 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
480 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
481 8024501048 Rhizobium sp. H4 Isolate Nodule
482 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
483 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
484 8056382006 Rhizobium croatiense 13T Isolate Nodule
485 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
486 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.5
Metatranscriptomes 0.69
Isolates 39.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 27.18
Nodule 27.32
Rhizoplane 1.66
Rhizosphere 24.83
Stem 0
Stem Tuber 0
Unclassified 18.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C10344 2010549000 Bacteria 2414
2 JGI25158J39367_1000116 3300002739 Bacteria 18332
3 JGI25152J39213_1002679 3300002773 Bacteria 6558
4 JGI25152J39213_1007127 3300002773 Bacteria 2934
5 JGI25152J39213_1008840 3300002773 Bacteria 2457
6 JGI25152J39213_1012669 3300002773 Bacteria 1794
7 JGI25152J39213_1029515 3300002773 Bacteria 862
8 JGI25150J39212_1000037 3300002774 Bacteria 88885
9 JGI25150J39212_1002674 3300002774 Bacteria 4348
10 JGI25159J45721_1000017 3300002987 Bacteria 136127
11 JGI25159J45721_1002450 3300002987 Bacteria 7046
12 JGI25151J46595_10000220 3300003187 Bacteria 67327
13 JGI25151J46595_10002753 3300003187 Bacteria 10214
14 JGI25151J46595_10013759 3300003187 Bacteria 3630
15 JGI25151J46595_10055471 3300003187 Bacteria 1306
16 JGI25153J46596_10007468 3300003215 Bacteria 5371
17 JGI25153J46596_10008966 3300003215 Bacteria 4713
18 JGI25153J46596_10020908 3300003215 Bacteria 2457
19 JGI25153J46596_10029782 3300003215 Bacteria 1868
20 JGI25153J46596_10031300 3300003215 Bacteria 1794
21 JGI25153J46596_10071411 3300003215 Bacteria 897
22 rootH2_10072600 3300003320 Bacteria 1488
23 rootH1_10245785 3300003323 Bacteria 1197
24 JGI25160J50197_1000027 3300003354 Bacteria 182809
25 JGI25160J50197_1004236 3300003354 Bacteria 6235
26 JGI25160J50197_1021914 3300003354 Bacteria 1885
27 JGI25161J50226_1000327 3300003374 Bacteria 25949
28 JGI25161J50226_1000501 3300003374 Bacteria 17353
29 Ga0055526_1001473 3300003771 Bacteria 16693
30 Ga0055526_1004020 3300003771 Bacteria 9039
31 Ga0055526_1007862 3300003771 Bacteria 5447
32 Ga0055526_1008010 3300003771 Bacteria 5352
33 Ga0055526_1010107 3300003771 Bacteria 4430
34 Ga0055524_1002650 3300003775 Bacteria 9086
35 Ga0055524_1003843 3300003775 Bacteria 7130
36 Ga0055524_1004200 3300003775 Bacteria 6711
37 Ga0055524_1004836 3300003775 Bacteria 6135
38 Ga0055524_1026436 3300003775 Bacteria 1793
39 Ga0055524_1042784 3300003775 Bacteria 1122
40 Ga0055536_1001323 3300003781 Bacteria 15170
41 Ga0055528_1000099 3300003790 Bacteria 68463
42 Ga0055528_1002777 3300003790 Bacteria 9169
43 Ga0055528_1002884 3300003790 Bacteria 8946
44 Ga0055528_1003479 3300003790 Bacteria 7866
45 Ga0055528_1003641 3300003790 Bacteria 7651
46 Ga0055528_1015747 3300003790 Bacteria 2713
47 Ga0055528_1018827 3300003790 Bacteria 2321
48 Ga0055540_1004301 3300003792 Bacteria 6497
49 Ga0055540_1007209 3300003792 Bacteria 4249
50 Ga0055540_1009091 3300003792 Bacteria 3483
51 Ga0055540_1011960 3300003792 Bacteria 2756
52 Ga0055531_10004054 3300003794 Bacteria 9079
53 Ga0055531_10021365 3300003794 Bacteria 2513
54 Ga0058692_1004143 3300003856 Bacteria 4342
55 Ga0058692_1006819 3300003856 Bacteria 3085
56 Ga0055543_1000030 3300004625 Bacteria 130849
57 Ga0055543_1000062 3300004625 Bacteria 98034
58 Ga0055543_1004762 3300004625 Bacteria 3614
59 Ga0065165_1000122 3300005262 Bacteria 132524
60 Ga0065165_1009930 3300005262 Bacteria 4192
61 Ga0070670_100000116 3300005331 Bacteria 74586
62 Ga0070670_100627456 3300005331 Bacteria 963
63 Ga0070668_100163932 3300005347 Bacteria 1805
64 Ga0070671_100057902 3300005355 Bacteria 3225
65 Ga0070663_100835594 3300005455 Bacteria 792
66 Ga0070665_100004011 3300005548 Bacteria 15524
67 Ga0070665_100064560 3300005548 Bacteria 3672
68 Ga0070665_100214209 3300005548 Bacteria 1927
69 Ga0070665_100220976 3300005548 Bacteria 1895
70 Ga0070665_100843237 3300005548 Bacteria 929
71 Ga0068861_100961186 3300005719 Bacteria 813
72 Ga0075365_10000498 3300006038 Bacteria 14945
73 Ga0075365_10034493 3300006038 Bacteria 3268
74 Ga0075365_10054293 3300006038 Bacteria 2656
75 Ga0075365_10132303 3300006038 Bacteria 1727
76 Ga0075368_10003863 3300006042 Bacteria 5041
77 Ga0075368_10027222 3300006042 Bacteria 2204
78 Ga0075368_10044952 3300006042 Bacteria 1744
79 Ga0075363_100116730 3300006048 Bacteria 1487
80 Ga0075364_10000026 3300006051 Bacteria 51217
81 Ga0075364_10121436 3300006051 Bacteria 1749
82 Ga0075362_10002019 3300006177 Bacteria 6686
83 Ga0075362_10012138 3300006177 Bacteria 3414
84 Ga0075367_10004009 3300006178 Bacteria 7117
85 Ga0075367_10004494 3300006178 Bacteria 6818
86 Ga0075369_10002071 3300006186 Bacteria 7079
87 Ga0075369_10007620 3300006186 Bacteria 4136
88 Ga0075369_10036124 3300006186 Bacteria 2102
89 Ga0075369_10158987 3300006186 Bacteria 1035
90 Ga0075366_10081626 3300006195 Bacteria 1931
91 Ga0075366_10194627 3300006195 Bacteria 1232
92 Ga0075370_10169851 3300006353 Bacteria 1282
93 Ga0075370_10202411 3300006353 Bacteria 1171
94 Ga0079104_1000195 3300006946 Bacteria 85244
95 Ga0099826_10000958 3300006948 Bacteria 16050
96 Ga0099826_10019601 3300006948 Bacteria 5082
97 Ga0105251_10017043 3300009011 Bacteria 3903
98 Ga0105244_10088997 3300009036 Bacteria 1520
99 Ga0105250_10029222 3300009092 Bacteria 2218
100 Ga0105250_10250695 3300009092 Bacteria 756
101 Ga0105243_10005164 3300009148 Bacteria 10226
102 Ga0105248_10119214 3300009177 Bacteria 2976
103 Ga0105249_10600761 3300009553 Bacteria 1155
104 Ga0123341_1000009 3300009765 Bacteria 122597
105 Ga0123342_1009724 3300009766 Bacteria 11342
106 Ga0105246_10046692 3300011119 Bacteria 2955
107 Ga0105246_10729693 3300011119 Bacteria 871
108 Ga0157322_1003437 3300012490 Bacteria 970
109 Ga0157373_10135423 3300013100 Bacteria 1732
110 Ga0157373_10505532 3300013100 Bacteria 873
111 Ga0157371_10000108 3300013102 Bacteria 126288
112 Ga0157370_10004961 3300013104 Bacteria 15062
113 Ga0157370_10555371 3300013104 Bacteria 1052
114 Ga0157370_10830905 3300013104 Bacteria 840
115 Ga0163161_10076548 3300017792 Bacteria 2456
116 Ga0209436_100018 3300025208 Bacteria 113499
117 Ga0209436_100664 3300025208 Bacteria 14651
118 Ga0207425_1000034 3300025245 Bacteria 227886
119 Ga0207425_1002143 3300025245 Bacteria 7234
120 Ga0207425_1009172 3300025245 Bacteria 2477
121 Ga0207425_1020102 3300025245 Bacteria 1431
122 Ga0209129_1000118 3300025258 Bacteria 139972
123 Ga0209129_1000253 3300025258 Bacteria 55709
124 Ga0209129_1000971 3300025258 Bacteria 17232
125 Ga0209129_1003196 3300025258 Bacteria 7326
126 Ga0209129_1003252 3300025258 Bacteria 7210
127 Ga0209129_1004160 3300025258 Bacteria 5843
128 Ga0209129_1004572 3300025258 Bacteria 5327
129 Ga0209673_1000033 3300025273 Bacteria 335369
130 Ga0209673_1000050 3300025273 Bacteria 285287
131 Ga0209673_1000052 3300025273 Bacteria 279795
132 Ga0209673_1004625 3300025273 Bacteria 7285
133 Ga0209673_1005860 3300025273 Bacteria 6081
134 Ga0209673_1010491 3300025273 Bacteria 3902
135 Ga0209673_1011538 3300025273 Bacteria 3636
136 Ga0209130_1000009 3300025284 Bacteria 498952
137 Ga0209130_1000027 3300025284 Bacteria 327700
138 Ga0209676_1000406 3300025292 Bacteria 77603
139 Ga0209676_1014960 3300025292 Bacteria 2883
140 Ga0209025_1000241 3300025294 Bacteria 128329
141 Ga0209025_1000335 3300025294 Bacteria 103615
142 Ga0209025_1000487 3300025294 Bacteria 76541
143 Ga0209025_1000533 3300025294 Bacteria 72404
144 Ga0209025_1002217 3300025294 Bacteria 21448
145 Ga0209025_1005633 3300025294 Bacteria 10106
146 Ga0209025_1013935 3300025294 Bacteria 5003
147 Ga0209025_1015409 3300025294 Bacteria 4609
148 Ga0209025_1027717 3300025294 Bacteria 2800
149 Ga0209025_1064942 3300025294 Bacteria 1336
150 Ga0209564_1000111 3300025295 Bacteria 212210
151 Ga0209564_1000782 3300025295 Bacteria 44138
152 Ga0209564_1003320 3300025295 Bacteria 11178
153 Ga0209564_1003367 3300025295 Bacteria 11059
154 Ga0209564_1016817 3300025295 Bacteria 2888
155 Ga0209564_1024253 3300025295 Bacteria 2077
156 Ga0209758_1000415 3300025297 Bacteria 72404
157 Ga0209758_1000570 3300025297 Bacteria 57866
158 Ga0209758_1001085 3300025297 Bacteria 35309
159 Ga0209758_1001086 3300025297 Bacteria 35300
160 Ga0209758_1002520 3300025297 Bacteria 18534
161 Ga0209758_1002827 3300025297 Bacteria 16891
162 Ga0209758_1004611 3300025297 Bacteria 11315
163 Ga0209758_1015745 3300025297 Bacteria 3893
164 Ga0209758_1040429 3300025297 Bacteria 1758
165 Ga0209050_1000572 3300025298 Bacteria 59716
166 Ga0209050_1004422 3300025298 Bacteria 9506
167 Ga0209050_1004558 3300025298 Bacteria 9300
168 Ga0209256_1001743 3300025299 Bacteria 20757
169 Ga0209256_1002370 3300025299 Bacteria 15544
170 Ga0209256_1003544 3300025299 Bacteria 10827
171 Ga0209256_1003766 3300025299 Bacteria 10227
172 Ga0209256_1007283 3300025299 Bacteria 5513
173 Ga0209256_1007659 3300025299 Bacteria 5251
174 Ga0209256_1012473 3300025299 Bacteria 3250
175 Ga0209256_1064228 3300025299 Bacteria 845
176 Ga0207426_1000041 3300025302 Bacteria 433536
177 Ga0207426_1000072 3300025302 Bacteria 327700
178 Ga0207426_1000348 3300025302 Bacteria 85294
179 Ga0207426_1001232 3300025302 Bacteria 22539
180 Ga0209051_1000276 3300025303 Bacteria 84192
181 Ga0209051_1001068 3300025303 Bacteria 25445
182 Ga0209051_1003342 3300025303 Bacteria 10589
183 Ga0209051_1005359 3300025303 Bacteria 7531
184 Ga0209051_1006368 3300025303 Bacteria 6674
185 Ga0209051_1009487 3300025303 Bacteria 5011
186 Ga0209051_1025776 3300025303 Bacteria 2384
187 Ga0209051_1084775 3300025303 Bacteria 901
188 Ga0209257_1002707 3300025304 Bacteria 16894
189 Ga0209257_1003532 3300025304 Bacteria 13296
190 Ga0209257_1007840 3300025304 Bacteria 6305
191 Ga0207650_10000691 3300025925 Bacteria 26420
192 Ga0207650_10456487 3300025925 Bacteria 1064
193 Ga0207668_10211867 3300025972 Bacteria 1550
194 Ga0207678_10157915 3300026067 Bacteria 1937
195 Ga0209281_1000028 3300027111 Bacteria 440027
196 Ga0209371_1000037 3300027312 Bacteria 367074
197 Ga0209282_1061069 3300027666 Bacteria 2099
198 Ga0209813_10008558 3300027866 Bacteria 2590
199 Ga0209813_10018240 3300027866 Bacteria 1936
200 Ga0268266_10006277 3300028379 Bacteria 10907
201 Ga0268266_10046940 3300028379 Bacteria 3698
202 Ga0268266_10274370 3300028379 Bacteria 1566
203 Ga0268266_10559781 3300028379 Bacteria 1096
204 Ga0307515_10091403 3300028794 Bacteria 3803
205 Ga0307515_10341559 3300028794 Bacteria 1149
206 Ga0268256_1000039 3300030500 Bacteria 354969
207 Ga0268256_1006192 3300030500 Bacteria 4501
208 Ga0316181_1219928 3300030744 Bacteria 3350
209 Ga0316182_1125124 3300030745 Bacteria 1540
210 Ga0307405_10014073 3300031731 Bacteria 4290
211 Ga0307412_10005736 3300031911 Bacteria 6978
212 Ga0307414_10092769 3300032004 Bacteria 2249
213 Ga0307414_10275341 3300032004 Bacteria 1412
214 Ga0373943_0279673 3300035170 Bacteria 943
215 Ga0373935_0171773 3300035692 Bacteria 1483
216 Ga0373927_0000311 3300035695 Bacteria 38278
217 Ga0373925_0004023 3300037068 Bacteria 11180
218 Ga0395905_0008738 3300037471 Bacteria 9964
219 Ga0395905_0016140 3300037471 Bacteria 7099
220 Ga0395901_0737547 3300038443 Bacteria 979
221 Ga0439465_0003192 3300041413 Bacteria 5345
222 Ga0451791_1345467 3300041451 Bacteria 1290
223 Ga0451802_0488296 3300041460 Bacteria 826
224 Ga0451804_0031999 3300041463 Bacteria 1371
225 Ga0451839_1011021 3300041496 Bacteria 2984
226 Ga0451846_16282 3300041502 Bacteria 1956
227 Ga0451847_0484987 3300041503 Bacteria 2034
228 Ga0451849_1333317 3300041505 Bacteria 1233
229 Ga0451843_0168405 3300041509 Bacteria 1790
230 Ga0451854_27717 3300041510 Bacteria 1071
231 Ga0451855_0487823 3300041511 Bacteria 1485
232 Ga0451855_1356374 3300041511 Bacteria 902
233 Ga0452271_84286 3300041916 Bacteria 628
234 Ga0439432_055974 3300042006 Bacteria 1223
235 Ga0439449_0011037 3300042007 Bacteria 3407
236 Ga0439449_0054074 3300042007 Bacteria 1484
237 Ga0466965_0083615 3300044683 Bacteria 1616
238 Ga0495617_045425 3300046452 Bacteria 1464
239 Ga0495592_0027176 3300046454 Bacteria 4338
240 Ga0495590_0157878 3300046457 Bacteria 824
241 Ga0495629_0012949 3300046459 Bacteria 6032
242 Ga0495638_0003269 3300046460 Bacteria 12786
243 Ga0495650_0049192 3300046471 Bacteria 1752
244 Ga0495650_0064425 3300046471 Bacteria 1458
245 Ga0495605_0002525 3300046474 Bacteria 11283
246 Ga0495605_0055743 3300046474 Bacteria 1908
247 Ga0495639_0203543 3300046475 Bacteria 970
248 Ga0495662_0002948 3300046476 Bacteria 8590
249 Ga0495585_0075254 3300046492 Bacteria 1836
250 Ga0495607_0039229 3300046501 Bacteria 2830
251 Ga0495607_0043296 3300046501 Bacteria 2663
252 Ga0495583_0020888 3300046506 Bacteria 3378
253 Ga0495583_0030217 3300046506 Bacteria 2641
254 Ga0495583_0078164 3300046506 Bacteria 1442
255 Ga0495606_0002721 3300046507 Bacteria 19935
256 Ga0495606_0065112 3300046507 Bacteria 2317
257 Ga0495606_0069944 3300046507 Bacteria 2215
258 Ga0495606_0199747 3300046507 Bacteria 1140
259 Ga0495610_0018390 3300046512 Bacteria 3950
260 Ga0495610_0049789 3300046512 Bacteria 2049
261 Ga0495610_0099707 3300046512 Bacteria 1303
262 Ga0495616_0020903 3300046513 Bacteria 3554
263 Ga0495616_0079629 3300046513 Bacteria 1570
264 Ga0495618_0354244 3300046514 Bacteria 904
265 Ga0495620_0042756 3300046515 Bacteria 1977
266 Ga0495620_0051274 3300046515 Bacteria 1757
267 Ga0495620_0092762 3300046515 Bacteria 1210
268 Ga0495631_0002242 3300046518 Bacteria 11099
269 Ga0495631_0069816 3300046518 Bacteria 1519
270 Ga0495631_0145392 3300046518 Bacteria 1017
271 Ga0495632_0009845 3300046519 Bacteria 5718
272 Ga0495632_0018201 3300046519 Bacteria 3860
273 Ga0495632_0028409 3300046519 Bacteria 2919
274 Ga0495643_0031476 3300046522 Bacteria 2951
275 Ga0495643_0075118 3300046522 Bacteria 1769
276 Ga0495643_0082130 3300046522 Bacteria 1675
277 Ga0495644_0124905 3300046523 Bacteria 980
278 Ga0495648_0170951 3300046524 Bacteria 1114
279 Ga0495663_0032664 3300046525 Bacteria 1551
280 Ga0495652_0673457 3300046529 Bacteria 698
281 Ga0495654_0036910 3300046530 Bacteria 2454
282 Ga0495654_0203180 3300046530 Bacteria 847
283 Ga0495587_0043343 3300046536 Bacteria 2680
284 Ga0495597_0211758 3300046542 Bacteria 772
285 Ga0495622_0056449 3300046557 Bacteria 1821
286 Ga0495633_0017477 3300046558 Bacteria 3666
287 Ga0495633_0043486 3300046558 Bacteria 2131
288 Ga0495656_0017308 3300046615 Bacteria 2749
289 Ga0495656_0084332 3300046615 Bacteria 1441
290 Ga0495668_0006323 3300046616 Bacteria 7788
291 Ga0495668_0033189 3300046616 Bacteria 2901
292 Ga0495611_0010753 3300046648 Bacteria 3876
293 Ga0495611_0245018 3300046648 Bacteria 831
294 Ga0495625_0004490 3300046660 Bacteria 13166
295 Ga0495625_0234310 3300046660 Bacteria 1198
296 Ga0495635_0274900 3300046663 Bacteria 1132
297 Ga0495588_0003857 3300046674 Bacteria 6571
298 Ga0495588_0199378 3300046674 Bacteria 1057
299 Ga0495657_0040807 3300046675 Bacteria 3180
300 Ga0495658_0143846 3300046683 Bacteria 1460
301 Ga0495670_0077090 3300046691 Bacteria 1694
302 Ga0495649_0172590 3300046694 Bacteria 1131
303 Ga0495600_0205169 3300046809 Bacteria 1264
304 Ga0495604_0030094 3300047317 Bacteria 4315
305 Ga0495636_0075163 3300047318 Bacteria 1448
306 Ga0495672_0050339 3300047320 Bacteria 2460
307 Ga0495683_0189236 3300047323 Bacteria 935
308 Ga0495687_109531 3300047443 Bacteria 1018
309 Ga0495673_0159922 3300047469 Bacteria 865
310 Ga0495681_0004907 3300047470 Bacteria 9040
311 Ga0495686_0015554 3300047472 Bacteria 5189
312 Ga0495686_0022064 3300047472 Bacteria 4216
313 Ga0495686_0038018 3300047472 Bacteria 3081
314 Ga0495686_0072884 3300047472 Bacteria 2110
315 Ga0495686_0400493 3300047472 Bacteria 737
316 Ga0495615_0037031 3300048090 Bacteria 1200
317 Ga0495626_0085234 3300048091 Bacteria 1397
318 Ga0496111_0025110 3300048914 Bacteria 4202
319 Ga0496113_0322481 3300048916 Bacteria 1238
320 Ga0496116_0005573 3300048919 Bacteria 11611
321 Ga0496116_0025349 3300048919 Bacteria 4361
322 Ga0496116_0028421 3300048919 Bacteria 4052
323 Ga0496116_0065649 3300048919 Bacteria 2326
324 Ga0496117_0000031 3300048920 Bacteria 381048
325 Ga0496117_0032840 3300048920 Bacteria 3935
326 Ga0496117_0042184 3300048920 Bacteria 3332
327 Ga0496117_0074990 3300048920 Bacteria 2249
328 Ga0496118_0000899 3300048921 Bacteria 46663
329 Ga0496118_0076791 3300048921 Bacteria 2373
330 Ga0496118_0080335 3300048921 Bacteria 2295
331 Ga0496118_0097285 3300048921 Bacteria 2003
332 Ga0496118_0157308 3300048921 Bacteria 1411
333 Ga0496119_0182203 3300048922 Bacteria 1100
334 Ga0496120_0000337 3300048923 Bacteria 78140
335 Ga0496120_0105201 3300048923 Bacteria 1484
336 Ga0496120_0281825 3300048923 Bacteria 768
337 Ga0496121_0005857 3300048924 Bacteria 15571
338 Ga0496121_0017796 3300048924 Bacteria 7221
339 Ga0496121_0026755 3300048924 Bacteria 5420
340 Ga0496121_0027371 3300048924 Bacteria 5336
341 Ga0496121_0032092 3300048924 Bacteria 4781
342 Ga0496121_0038490 3300048924 Bacteria 4233
343 Ga0496121_0067368 3300048924 Bacteria 2902
344 Ga0496121_0103185 3300048924 Bacteria 2194
345 Ga0496121_0178040 3300048924 Bacteria 1538
346 Ga0496121_0250461 3300048924 Bacteria 1228
347 Ga0496121_0263865 3300048924 Bacteria 1187
348 Ga0496121_0524669 3300048924 Bacteria 746
349 Ga0496122_0000023 3300048925 Bacteria 381035
350 Ga0496122_0000074 3300048925 Bacteria 219900
351 Ga0496122_0000286 3300048925 Bacteria 112940
352 Ga0496122_0017308 3300048925 Bacteria 6750
353 Ga0496122_0021693 3300048925 Bacteria 5738
354 Ga0496122_0025165 3300048925 Bacteria 5180
355 Ga0496122_0150487 3300048925 Bacteria 1437
356 Ga0496123_0000027 3300048926 Bacteria 306773
357 Ga0496123_0000062 3300048926 Bacteria 219882
358 Ga0496123_0006549 3300048926 Bacteria 11249
359 Ga0496123_0007630 3300048926 Bacteria 10125
360 Ga0496123_0017095 3300048926 Bacteria 5854
361 Ga0496123_0036008 3300048926 Bacteria 3517
362 Ga0496123_0038065 3300048926 Bacteria 3386
363 Ga0496123_0068460 3300048926 Bacteria 2235
364 Ga0496123_0164731 3300048926 Bacteria 1177
365 Ga0496124_0002248 3300048927 Bacteria 25664
366 Ga0496124_0021541 3300048927 Bacteria 5937
367 Ga0496124_0024118 3300048927 Bacteria 5537
368 Ga0496124_0027332 3300048927 Bacteria 5123
369 Ga0496124_0037520 3300048927 Bacteria 4214
370 Ga0496124_0103547 3300048927 Bacteria 2302
371 Ga0496124_0154210 3300048927 Bacteria 1798
372 Ga0496124_0282908 3300048927 Bacteria 1208
373 Ga0496124_0284143 3300048927 Bacteria 1204
374 Ga0496124_0764549 3300048927 Bacteria 603
375 Ga0496125_0008659 3300048928 Bacteria 10606
376 Ga0496125_0027541 3300048928 Bacteria 5150
377 Ga0496125_0042092 3300048928 Bacteria 3896
378 Ga0496125_0223410 3300048928 Bacteria 1211
379 Ga0496126_0000892 3300048929 Bacteria 52105
380 Ga0496126_0165125 3300048929 Bacteria 1890
381 Ga0496126_0322983 3300048929 Bacteria 1268
382 Ga0495678_006181 3300049459 Bacteria 6412
383 Ga0501032_0215700 3300049569 Bacteria 1250
384 Ga0501038_0238399 3300049574 Bacteria 1445
385 Ga0501043_0025472 3300049579 Bacteria 4641
386 Ga0501080_0520876 3300049742 Bacteria 1061
387 Ga0501280_002832 3300049776 Bacteria 2792
388 Ga0501282_002248 3300049778 Bacteria 2120
389 Ga0501044_0179878 3300049823 Bacteria 2082
390 nmdc:mga03683_23864_c1 3300050489 Bacteria 2387
391 nmdc:mga03683_40021_c1 3300050489 Bacteria 1921
392 nmdc:mga00v17_1285_c1 3300050491 Bacteria 13183
393 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
394 nmdc:mga00v17_41963_c1 3300050491 Bacteria 2749
395 nmdc:mga0yw44_137544_c1 3300050492 Bacteria 1586
396 nmdc:mga0yw44_29465_c1 3300050492 Bacteria 3169
397 nmdc:mga0k408_155997_c1 3300050493 Bacteria 1360
398 nmdc:mga0k408_55701_c1 3300050493 Bacteria 2293
399 nmdc:mga06z11_6588_c1 3300050494 Bacteria 4741
400 nmdc:mga04h51_7309_c1 3300050495 Bacteria 2909
401 nmdc:mga04h51_9426_c1 3300050495 Bacteria 2647
402 nmdc:mga07m45_115924_c1 3300050496 Bacteria 1545
403 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
404 nmdc:mga0sz30_1545_c1 3300050516 Bacteria 8206
405 nmdc:mga0sz30_32333_c1 3300050516 Bacteria 2170
406 nmdc:mga0sz30_98810_c1 3300050516 Bacteria 1274
407 Ga0500610_0012502 3300053079 Bacteria 3914
408 Ga0495619_0085068 3300053085 Bacteria 2135
409 Ga0500578_0067685 3300053086 Bacteria 2277
410 Ga0500560_002140 3300053107 Bacteria 3691
411 Ga0500569_144190 3300053109 Bacteria 801
412 Ga0500594_0007425 3300053118 Bacteria 2479
413 Ga0500614_076585 3300053123 Bacteria 928
414 Ga0500618_001412 3300053125 Bacteria 10762
415 Ga0500618_002740 3300053125 Bacteria 6410
416 Ga0500618_011654 3300053125 Bacteria 2325
417 Ga0500618_018603 3300053125 Bacteria 1717
418 Ga0500618_023849 3300053125 Bacteria 1478
419 Ga0500658_0000309 3300053134 Bacteria 21891
420 Ga0500658_0018303 3300053134 Bacteria 2625
421 Ga0500559_0003675 3300053136 Bacteria 7485
422 Ga0500568_0008863 3300053139 Bacteria 4817
423 Ga0500568_0018858 3300053139 Bacteria 3009
424 Ga0500604_0009869 3300053151 Bacteria 2546
425 Ga0500616_0005597 3300053153 Bacteria 8483
426 Ga0500616_0007819 3300053153 Bacteria 6733
427 Ga0500616_0020147 3300053153 Bacteria 3750
428 Ga0500622_0118528 3300053156 Bacteria 1286
429 Ga0500627_0156409 3300053158 Bacteria 1029
430 Ga0500633_0012605 3300053160 Bacteria 2341
431 Ga0500645_037445 3300053730 Bacteria 1441
432 Ga0587077_047895 3300059493 Bacteria 884
433 Ga0587072_049824 3300059643 Bacteria 836

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0764549 Ga0496124_0764549_55_588 175
2 3300048924 Ga0496121_0524669 Ga0496121_0524669_50_652 176
3 3300049776 Ga0501280_002832 Ga0501280_002832_1181_1774 177
4 3300049778 Ga0501282_002248 Ga0501282_002248_1101_1694 177
5 3300053123 Ga0500614_076585 Ga0500614_076585_195_806 177
6 3300041916 Ga0452271_84286 Ga0452271_84286_60_611 181
7 3300046454 Ga0495592_0027176 Ga0495592_0027176_20_571 181
8 3300046513 Ga0495616_0020903 Ga0495616_0020903_1212_1820 181
9 3300047318 Ga0495636_0075163 Ga0495636_0075163_143_751 181
10 3300053139 Ga0500568_0008863 Ga0500568_0008863_552_1160 181
11 3300005548 Ga0070665_100064560 Ga0070665_1000645604 182
12 3300028379 Ga0268266_10046940 Ga0268266_100469404 182
13 3300037471 Ga0395905_0016140 Ga0395905_0016140_203_799 182
14 3300046452 Ga0495617_045425 Ga0495617_045425_711_1319 182
15 3300046460 Ga0495638_0003269 Ga0495638_0003269_9231_9839 182
16 3300046474 Ga0495605_0002525 Ga0495605_0002525_8981_9589 182
17 3300046475 Ga0495639_0203543 Ga0495639_0203543_176_784 182
18 3300046501 Ga0495607_0043296 Ga0495607_0043296_1680_2288 182
19 3300046506 Ga0495583_0020888 Ga0495583_0020888_2326_2934 182
20 3300046518 Ga0495631_0002242 Ga0495631_0002242_3953_4561 182
21 3300046519 Ga0495632_0009845 Ga0495632_0009845_1855_2463 182
22 3300046616 Ga0495668_0006323 Ga0495668_0006323_3524_4132 182
23 3300046648 Ga0495611_0010753 Ga0495611_0010753_2785_3393 182
24 3300046660 Ga0495625_0004490 Ga0495625_0004490_8718_9326 182
25 3300046691 Ga0495670_0077090 Ga0495670_0077090_934_1542 182
26 3300047320 Ga0495672_0050339 Ga0495672_0050339_1763_2371 182
27 3300049459 Ga0495678_006181 Ga0495678_006181_2833_3441 182
28 3300053079 Ga0500610_0012502 Ga0500610_0012502_2639_3247 182
29 3300053109 Ga0500569_144190 Ga0500569_144190_154_762 182
30 3300053118 Ga0500594_0007425 Ga0500594_0007425_1393_2001 182
31 3300053153 Ga0500616_0007819 Ga0500616_0007819_579_1187 182
32 3300053730 Ga0500645_037445 Ga0500645_037445_399_1007 182
33 3300028794 Ga0307515_10341559 Ga0307515_103415593 183
34 3300037471 Ga0395905_0008738 Ga0395905_0008738_7804_8400 183
35 3300038443 Ga0395901_0737547 Ga0395901_0737547_104_700 183
36 3300048924 Ga0496121_0263865 Ga0496121_0263865_298_900 186
37 3300046459 Ga0495629_0012949 Ga0495629_0012949_3510_4121 189
38 3300046514 Ga0495618_0354244 Ga0495618_0354244_63_674 189
39 3300046524 Ga0495648_0170951 Ga0495648_0170951_22_633 189
40 3300046529 Ga0495652_0673457 Ga0495652_0673457_49_660 189
41 3300046675 Ga0495657_0040807 Ga0495657_0040807_719_1330 189
42 3300047323 Ga0495683_0189236 Ga0495683_0189236_151_762 189
43 3300048923 Ga0496120_0281825 Ga0496120_0281825_25_636 189
44 iso_pu_bacteria 2534681796 2535519008 189
45 iso_pu_bacteria 2842922631 2842926304 189
46 3300046557 Ga0495622_0056449 Ga0495622_0056449_467_1078 190
47 iso_pu_bacteria 2599185352 2600193360 190
48 iso_pu_bacteria 2643221557 2643808058 190
49 iso_pu_bacteria 2643221618 2644110159 190
50 iso_pu_bacteria 2643221626 2644150435 190
51 iso_pu_bacteria 2643221655 2644313039 190
52 iso_pu_bacteria 2643221659 2644336587 190
53 iso_pu_bacteria 2643221668 2644379492 190
54 iso_pu_bacteria 2643221698 2644546234 190
55 iso_pu_bacteria 2643221712 2644618769 190
56 iso_pu_bacteria 2643221723 2644677086 190
57 iso_pu_bacteria 2844163670 2844166247 190
58 iso_pu_bacteria 2920822456 2920825939 190
59 iso_pu_bacteria 2941499720 2941501360 190
60 iso_pu_bacteria 8055431914 8055435570 190
61 3300053136 Ga0500559_0003675 Ga0500559_0003675_2240_2830 191
62 iso_pu_bacteria 2818991272 2819244603 191
63 iso_pu_bacteria 2891373044 2891377929 191
64 iso_pu_bacteria 2989349275 2989354956 191
65 iso_pu_bacteria 2643221653 2644299817 192
66 iso_pu_bacteria 2643221719 2644658044 192
67 iso_pu_bacteria 2919100787 2919105373 192
68 iso_pu_bacteria 2989776772 2989780141 192
69 iso_pu_bacteria 8005246636 8005249282 192
70 3300002987 JGI25159J45721_1000017 JGI25159J45721_100001792 193
71 3300003187 JGI25151J46595_10013759 JGI25151J46595_100137593 193
72 3300003320 rootH2_10072600 rootH2_100726002 193
73 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002792 193
74 3300003374 JGI25161J50226_1000501 JGI25161J50226_10005015 193
75 3300003771 Ga0055526_1001473 Ga0055526_100147312 193
76 3300003775 Ga0055524_1002650 Ga0055524_10026509 193
77 3300003775 Ga0055524_1004200 Ga0055524_10042004 193
78 3300003775 Ga0055524_1026436 Ga0055524_10264363 193
79 3300003781 Ga0055536_1001323 Ga0055536_10013235 193
80 3300003794 Ga0055531_10021365 Ga0055531_100213655 193
81 3300004625 Ga0055543_1000030 Ga0055543_1000030100 193
82 3300005262 Ga0065165_1000122 Ga0065165_100012292 193
83 3300025208 Ga0209436_100664 Ga0209436_1006649 193
84 3300025284 Ga0209130_1000027 Ga0209130_1000027227 193
85 3300025292 Ga0209676_1000406 Ga0209676_100040612 193
86 3300025294 Ga0209025_1000241 Ga0209025_100024110 193
87 3300025295 Ga0209564_1000111 Ga0209564_1000111208 193
88 3300025298 Ga0209050_1000572 Ga0209050_100057218 193
89 3300025299 Ga0209256_1003544 Ga0209256_10035446 193
90 3300025299 Ga0209256_1007283 Ga0209256_10072834 193
91 3300025302 Ga0207426_1000072 Ga0207426_100007289 193
92 3300025303 Ga0209051_1001068 Ga0209051_100106822 193
93 3300025304 Ga0209257_1002707 Ga0209257_100270719 193
94 3300048920 Ga0496117_0032840 Ga0496117_0032840_341_955 193
95 3300048923 Ga0496120_0105201 Ga0496120_0105201_744_1358 193
96 3300048925 Ga0496122_0000286 Ga0496122_0000286_829_1443 193
97 3300048926 Ga0496123_0007630 Ga0496123_0007630_664_1278 193
98 3300048927 Ga0496124_0027332 Ga0496124_0027332_4283_4897 193
99 3300048928 Ga0496125_0008659 Ga0496125_0008659_9206_9820 193
100 3300048928 Ga0496125_0223410 Ga0496125_0223410_368_982 193
101 3300048929 Ga0496126_0000892 Ga0496126_0000892_46774_47388 193
102 3300049569 Ga0501032_0215700 Ga0501032_0215700_531_1139 193
103 3300049574 Ga0501038_0238399 Ga0501038_0238399_606_1214 193
104 3300049579 Ga0501043_0025472 Ga0501043_0025472_2244_2852 193
105 iso_pu_bacteria 2558860983 2561467104 193
106 3300035170 Ga0373943_0279673 Ga0373943_0279673_12_620 194
107 3300035692 Ga0373935_0171773 Ga0373935_0171773_521_1129 194
108 3300035695 Ga0373927_0000311 Ga0373927_0000311_4868_5476 194
109 3300037068 Ga0373925_0004023 Ga0373925_0004023_8811_9419 194
110 3300046512 Ga0495610_0049789 Ga0495610_0049789_336_965 195
111 3300046515 Ga0495620_0042756 Ga0495620_0042756_813_1442 195
112 3300047469 Ga0495673_0159922 Ga0495673_0159922_33_662 195
113 3300047472 Ga0495686_0072884 Ga0495686_0072884_679_1308 195
114 iso_pu_bacteria 2510917028 2511183985 195
115 iso_pu_bacteria 2513237088 2513596816 195
116 iso_pu_bacteria 2513237138 2513867467 195
117 iso_pu_bacteria 2513237144 2513912366 195
118 iso_pu_bacteria 2513237146 2513928449 195
119 iso_pu_bacteria 2537561587 2537873832 195
120 iso_pu_bacteria 2582581294 2585201751 195
121 iso_pu_bacteria 2582581299 2585228754 195
122 iso_pu_bacteria 2582581867 2585399735 195
123 iso_pu_bacteria 2585427590 2585820822 195
124 iso_pu_bacteria 2585427594 2585844878 195
125 iso_pu_bacteria 2599185170 2599420161 195
126 iso_pu_bacteria 2599185210 2599603267 195
127 iso_pu_bacteria 2600255279 2601610829 195
128 iso_pu_bacteria 2600255308 2601747603 195
129 iso_pu_bacteria 2615840624 2616296328 195
130 iso_pu_bacteria 2643221599 2644002457 195
131 iso_pu_bacteria 2643221643 2644240517 195
132 iso_pu_bacteria 2791355261 2793327270 195
133 iso_pu_bacteria 2802429606 2805933928 195
134 iso_pu_bacteria 2838035591 2838040367 195
135 iso_pu_bacteria 2838661181 2838667781 195
136 iso_pu_bacteria 2841859092 2841863210 195
137 iso_pu_bacteria 2842192696 2842194895 195
138 iso_pu_bacteria 2842317721 2842321098 195
139 iso_pu_bacteria 2842495871 2842498488 195
140 iso_pu_bacteria 2842515876 2842520052 195
141 iso_pu_bacteria 2899792073 2899795310 195
142 iso_pu_bacteria 2923556063 2923559504 195
143 iso_pu_bacteria 2933011516 2933015689 195
144 iso_pu_bacteria 2933016740 2933017013 195
145 iso_pu_bacteria 2933594066 2933597570 195
146 iso_pu_bacteria 2996887358 2996890226 195
147 iso_pu_bacteria 3005409236 3005415783 195
148 iso_pu_bacteria 3005452660 3005455928 195
149 iso_pu_bacteria 8005258706 8005262410 195
150 iso_pu_bacteria 8005321885 8005324753 195
151 iso_pu_bacteria 8005382845 8005387786 195
152 iso_pu_bacteria 8005542996 8005546657 195
153 iso_pu_bacteria 8005658619 8005660794 195
154 iso_pu_bacteria 8018127388 8018128896 195
155 iso_pu_bacteria 8018150411 8018153351 195
156 iso_pu_bacteria 8024501048 8024502339 195
157 iso_pu_bacteria 8056875544 8056878236 195
158 3300046476 Ga0495662_0002948 Ga0495662_0002948_3400_4011 196
159 3300046536 Ga0495587_0043343 Ga0495587_0043343_1299_1910 196
160 3300046663 Ga0495635_0274900 Ga0495635_0274900_92_727 196
161 3300046683 Ga0495658_0143846 Ga0495658_0143846_58_669 196
162 3300046809 Ga0495600_0205169 Ga0495600_0205169_342_953 196
163 3300047317 Ga0495604_0030094 Ga0495604_0030094_2241_2852 196
164 3300048921 Ga0496118_0080335 Ga0496118_0080335_873_1469 196
165 3300048924 Ga0496121_0027371 Ga0496121_0027371_2569_3165 196
166 3300048925 Ga0496122_0021693 Ga0496122_0021693_3192_3788 196
167 3300048926 Ga0496123_0036008 Ga0496123_0036008_2738_3334 196
168 3300048928 Ga0496125_0027541 Ga0496125_0027541_1748_2344 196
169 3300050516 nmdc:mga0sz30_32333_c1 nmdc:mga0sz30_32333_c1_681_1277 196
170 3300053085 Ga0495619_0085068 Ga0495619_0085068_940_1551 196
171 iso_pu_bacteria 2509276021 2509389424 196
172 iso_pu_bacteria 2509276033 2509446179 196
173 iso_pu_bacteria 2510065019 2510135233 196
174 iso_pu_bacteria 2510461076 2510896688 196
175 iso_pu_bacteria 2510917026 2511169790 196
176 iso_pu_bacteria 2510917030 2511194589 196
177 iso_pu_bacteria 2513237084 2513571617 196
178 iso_pu_bacteria 2513237085 2513578651 196
179 iso_pu_bacteria 2513237093 2513630164 196
180 iso_pu_bacteria 2513237103 2513711337 196
181 iso_pu_bacteria 2513237162 2514019388 196
182 iso_pu_bacteria 2515075009 2515114391 196
183 iso_pu_bacteria 2515154113 2515635394 196
184 iso_pu_bacteria 2515154114 2515643198 196
185 iso_pu_bacteria 2515154116 2515657662 196
186 iso_pu_bacteria 2515154134 2515741575 196
187 iso_pu_bacteria 2516653077 2517038041 196
188 iso_pu_bacteria 2516653085 2517078305 196
189 iso_pu_bacteria 2517093000 2517097064 196
190 iso_pu_bacteria 2517287029 2517408552 196
191 iso_pu_bacteria 2519899620 2520377452 196
192 iso_pu_bacteria 2529292951 2530647364 196
193 iso_pu_bacteria 2554235003 2554248854 196
194 iso_pu_bacteria 2558860242 2559295942 196
195 iso_pu_bacteria 2582581298 2585223910 196
196 iso_pu_bacteria 2582581304 2585257361 196
197 iso_pu_bacteria 2585427526 2585526058 196
198 iso_pu_bacteria 2585427528 2585540765 196
199 iso_pu_bacteria 2585427529 2585549133 196
200 iso_pu_bacteria 2585427593 2585839035 196
201 iso_pu_bacteria 2585427633 2585997766 196
202 iso_pu_bacteria 2585427634 2586002351 196
203 iso_pu_bacteria 2643221634 2644194837 196
204 iso_pu_bacteria 2643221693 2644521520 196
205 iso_pu_bacteria 2718217882 2719182950 196
206 iso_pu_bacteria 2718217927 2719387663 196
207 iso_pu_bacteria 2718217997 2719667295 196
208 iso_pu_bacteria 2718218009 2719733667 196
209 iso_pu_bacteria 2718218199 2720493715 196
210 iso_pu_bacteria 2718218232 2720615168 196
211 iso_pu_bacteria 2718218233 2720621963 196
212 iso_pu_bacteria 2718218235 2720633313 196
213 iso_pu_bacteria 2718218269 2720777011 196
214 iso_pu_bacteria 2718218363 2721149062 196
215 iso_pu_bacteria 2718218365 2721160460 196
216 iso_pu_bacteria 2718218366 2721165875 196
217 iso_pu_bacteria 2718218423 2721401297 196
218 iso_pu_bacteria 2721755514 2722842045 196
219 iso_pu_bacteria 2721755556 2723028609 196
220 iso_pu_bacteria 2721755684 2723562213 196
221 iso_pu_bacteria 2721755685 2723568916 196
222 iso_pu_bacteria 2721755809 2724040111 196
223 iso_pu_bacteria 2721755810 2724046423 196
224 iso_pu_bacteria 2721755819 2724091618 196
225 iso_pu_bacteria 2721755822 2724106181 196
226 iso_pu_bacteria 2721755823 2724111987 196
227 iso_pu_bacteria 2724679232 2725947524 196
228 iso_pu_bacteria 2728369352 2730109545 196
229 iso_pu_bacteria 2728369365 2730166185 196
230 iso_pu_bacteria 2728369397 2730300092 196
231 iso_pu_bacteria 2738541293 2738805586 196
232 iso_pu_bacteria 2738541333 2739037262 196
233 iso_pu_bacteria 2765235942 2766064281 196
234 iso_pu_bacteria 2775507049 2776915610 196
235 iso_pu_bacteria 2791355256 2793295641 196
236 iso_pu_bacteria 2791355259 2793313392 196
237 iso_pu_bacteria 2791355260 2793320698 196
238 iso_pu_bacteria 2791355262 2793332224 196
239 iso_pu_bacteria 2791355263 2793338799 196
240 iso_pu_bacteria 2791355264 2793346587 196
241 iso_pu_bacteria 2791355265 2793353874 196
242 iso_pu_bacteria 2791355266 2793359409 196
243 iso_pu_bacteria 2791355267 2793365891 196
244 iso_pu_bacteria 2802429605 2805926202 196
245 iso_pu_bacteria 2802429633 2806047353 196
246 iso_pu_bacteria 2802429634 2806054208 196
247 iso_pu_bacteria 2802429635 2806060208 196
248 iso_pu_bacteria 2802429636 2806068819 196
249 iso_pu_bacteria 2802429637 2806076425 196
250 iso_pu_bacteria 2808606387 2808988234 196
251 iso_pu_bacteria 2818991439 2819560952 196
252 iso_pu_bacteria 2838016132 2838018345 196
253 iso_pu_bacteria 2838022645 2838024028 196
254 iso_pu_bacteria 2838042994 2838047826 196
255 iso_pu_bacteria 2838048938 2838050793 196
256 iso_pu_bacteria 2838061910 2838062559 196
257 iso_pu_bacteria 2838068647 2838072110 196
258 iso_pu_bacteria 2838668709 2838672151 196
259 iso_pu_bacteria 2838675328 2838678685 196
260 iso_pu_bacteria 2838680041 2838683892 196
261 iso_pu_bacteria 2838686498 2838690268 196
262 iso_pu_bacteria 2838694306 2838698420 196
263 iso_pu_bacteria 2838701080 2838704979 196
264 iso_pu_bacteria 2838707686 2838711535 196
265 iso_pu_bacteria 2838714209 2838718227 196
266 iso_pu_bacteria 2838719591 2838722981 196
267 iso_pu_bacteria 2838724970 2838728293 196
268 iso_pu_bacteria 2838729681 2838732043 196
269 iso_pu_bacteria 2838742623 2838744939 196
270 iso_pu_bacteria 2841846520 2841850537 196
271 iso_pu_bacteria 2841851746 2841855997 196
272 iso_pu_bacteria 2841864319 2841867773 196
273 iso_pu_bacteria 2842077413 2842081336 196
274 iso_pu_bacteria 2842110456 2842116868 196
275 iso_pu_bacteria 2842118031 2842121887 196
276 iso_pu_bacteria 2842124991 2842128953 196
277 iso_pu_bacteria 2842130223 2842133577 196
278 iso_pu_bacteria 2842146304 2842148785 196
279 iso_pu_bacteria 2842152218 2842155511 196
280 iso_pu_bacteria 2842156927 2842161167 196
281 iso_pu_bacteria 2842163707 2842166679 196
282 iso_pu_bacteria 2842170452 2842174531 196
283 iso_pu_bacteria 2842175837 2842179191 196
284 iso_pu_bacteria 2842180545 2842184783 196
285 iso_pu_bacteria 2842187318 2842190651 196
286 iso_pu_bacteria 2842198810 2842201621 196
287 iso_pu_bacteria 2842205361 2842207406 196
288 iso_pu_bacteria 2842211629 2842215025 196
289 iso_pu_bacteria 2842217011 2842221766 196
290 iso_pu_bacteria 2842224351 2842227746 196
291 iso_pu_bacteria 2842229732 2842232365 196
292 iso_pu_bacteria 2842237096 2842240901 196
293 iso_pu_bacteria 2842243621 2842246781 196
294 iso_pu_bacteria 2842250916 2842254660 196
295 iso_pu_bacteria 2842257432 2842261118 196
296 iso_pu_bacteria 2842264693 2842269625 196
297 iso_pu_bacteria 2842271015 2842274288 196
298 iso_pu_bacteria 2842278818 2842280883 196
299 iso_pu_bacteria 2842285085 2842288505 196
300 iso_pu_bacteria 2842291075 2842294993 196
301 iso_pu_bacteria 2842304105 2842305869 196
302 iso_pu_bacteria 2842311132 2842311397 196
303 iso_pu_bacteria 2842341865 2842346597 196
304 iso_pu_bacteria 2842363717 2842366286 196
305 iso_pu_bacteria 2842370503 2842374989 196
306 iso_pu_bacteria 2842377471 2842381392 196
307 iso_pu_bacteria 2842384541 2842388462 196
308 iso_pu_bacteria 2842395702 2842395958 196
309 iso_pu_bacteria 2842402390 2842406149 196
310 iso_pu_bacteria 2842409023 2842412734 196
311 iso_pu_bacteria 2842415677 2842419387 196
312 iso_pu_bacteria 2842422224 2842425742 196
313 iso_pu_bacteria 2842428310 2842433613 196
314 iso_pu_bacteria 2842434925 2842439941 196
315 iso_pu_bacteria 2842441272 2842446570 196
316 iso_pu_bacteria 2842447887 2842448794 196
317 iso_pu_bacteria 2842462802 2842467921 196
318 iso_pu_bacteria 2842469257 2842474550 196
319 iso_pu_bacteria 2842489311 2842491151 196
320 iso_pu_bacteria 2844454524 2844457033 196
321 iso_pu_bacteria 2854896431 2854901736 196
322 iso_pu_bacteria 2854916844 2854919469 196
323 iso_pu_bacteria 2857516855 2857519560 196
324 iso_pu_bacteria 2899845264 2899849290 196
325 iso_pu_bacteria 2919114240 2919118515 196
326 iso_pu_bacteria 2919171160 2919175800 196
327 iso_pu_bacteria 2926754445 2926755045 196
328 iso_pu_bacteria 2926760298 2926762205 196
329 iso_pu_bacteria 2933006813 2933010639 196
330 iso_pu_bacteria 2933570622 2933572374 196
331 iso_pu_bacteria 2933586486 2933593127 196
332 iso_pu_bacteria 2933599457 2933603037 196
333 iso_pu_bacteria 2935894831 2935897929 196
334 iso_pu_bacteria 2935901341 2935903649 196
335 iso_pu_bacteria 2936367885 2936369875 196
336 iso_pu_bacteria 2936375103 2936379060 196
337 iso_pu_bacteria 2936381700 2936381965 196
338 iso_pu_bacteria 2979089926 2979092525 196
339 iso_pu_bacteria 2979095461 2979100084 196
340 iso_pu_bacteria 2979100975 2979104496 196
341 iso_pu_bacteria 2984509177 2984513709 196
342 iso_pu_bacteria 2984518228 2984522713 196
343 iso_pu_bacteria 2984537506 2984542019 196
344 iso_pu_bacteria 2984601300 2984601449 196
345 iso_pu_bacteria 2996893221 2996895266 196
346 iso_pu_bacteria 3005445848 3005449645 196
347 iso_pu_bacteria 639633055 639650417 196
348 iso_pu_bacteria 650716007 650741155 196
349 iso_pu_bacteria 8003570095 8003573785 196
350 iso_pu_bacteria 8005275841 8005282418 196
351 iso_pu_bacteria 8005282627 8005286763 196
352 iso_pu_bacteria 8005289223 8005295069 196
353 iso_pu_bacteria 8005301065 8005305948 196
354 iso_pu_bacteria 8005307578 8005313684 196
355 iso_pu_bacteria 8005376324 8005381582 196
356 iso_pu_bacteria 8005395548 8005400822 196
357 iso_pu_bacteria 8005430974 8005431091 196
358 iso_pu_bacteria 8005460587 8005465082 196
359 iso_pu_bacteria 8005497431 8005497659 196
360 iso_pu_bacteria 8005556819 8005561157 196
361 iso_pu_bacteria 8005563573 8005565782 196
362 iso_pu_bacteria 8005570704 8005571829 196
363 iso_pu_bacteria 8005619151 8005623393 196
364 iso_pu_bacteria 8005626139 8005631027 196
365 iso_pu_bacteria 8005668836 8005669064 196
366 iso_pu_bacteria 8005688590 8005694353 196
367 iso_pu_bacteria 8005695170 8005695719 196
368 iso_pu_bacteria 8018163183 8018165104 196
369 iso_pu_bacteria 8018176218 8018177136 196
370 iso_pu_bacteria 8023680758 8023686523 196
371 iso_pu_bacteria 8024479707 8024484356 196
372 iso_pu_bacteria 8056375014 8056380400 196
373 iso_pu_bacteria 8056382006 8056385231 196
374 iso_pu_bacteria 8057874678 8057879273 196
375 3300046501 Ga0495607_0039229 Ga0495607_0039229_1642_2238 197
376 3300046522 Ga0495643_0082130 Ga0495643_0082130_85_681 197
377 3300053125 Ga0500618_011654 Ga0500618_011654_1235_1831 197
378 3300053125 Ga0500618_018603 Ga0500618_018603_983_1579 197
379 3300053125 Ga0500618_023849 Ga0500618_023849_174_881 197
380 iso_pu_bacteria 2599185236 2599720321 197
381 iso_pu_bacteria 2600254933 2600373249 197
382 iso_pu_bacteria 2643221558 2643813750 197
383 iso_pu_bacteria 2643221582 2643921467 197
384 iso_pu_bacteria 2738541317 2738947069 197
385 iso_pu_bacteria 2818991461 2819687021 197
386 iso_pu_bacteria 2821123053 2821128714 197
387 iso_pu_bacteria 2838736955 2838741730 197
388 iso_pu_bacteria 2841840854 2841845436 197
389 iso_pu_bacteria 2842140634 2842145139 197
390 iso_pu_bacteria 2857531043 2857534133 197
391 iso_pu_bacteria 2899803654 2899808053 197
392 iso_pu_bacteria 2913308742 2913312102 197
393 iso_pu_bacteria 8024486573 8024490836 197
394 3300002773 JGI25152J39213_1002679 JGI25152J39213_10026795 199
395 3300003187 JGI25151J46595_10055471 JGI25151J46595_100554711 199
396 3300003215 JGI25153J46596_10071411 JGI25153J46596_100714112 199
397 3300003354 JGI25160J50197_1021914 JGI25160J50197_10219143 199
398 3300003771 Ga0055526_1008010 Ga0055526_10080105 199
399 3300003775 Ga0055524_1003843 Ga0055524_10038437 199
400 3300003790 Ga0055528_1000099 Ga0055528_100009961 199
401 3300003790 Ga0055528_1003479 Ga0055528_10034797 199
402 3300003856 Ga0058692_1004143 Ga0058692_10041435 199
403 3300003856 Ga0058692_1006819 Ga0058692_10068193 199
404 3300005331 Ga0070670_100627456 Ga0070670_1006274562 199
405 3300005347 Ga0070668_100163932 Ga0070668_1001639322 199
406 3300005355 Ga0070671_100057902 Ga0070671_1000579022 199
407 3300005455 Ga0070663_100835594 Ga0070663_1008355942 199
408 3300005548 Ga0070665_100004011 Ga0070665_10000401112 199
409 3300005548 Ga0070665_100843237 Ga0070665_1008432372 199
410 3300005719 Ga0068861_100961186 Ga0068861_1009611862 199
411 3300006038 Ga0075365_10000498 Ga0075365_100004984 199
412 3300006038 Ga0075365_10132303 Ga0075365_101323032 199
413 3300006042 Ga0075368_10003863 Ga0075368_100038635 199
414 3300006042 Ga0075368_10027222 Ga0075368_100272223 199
415 3300006177 Ga0075362_10012138 Ga0075362_100121385 199
416 3300006178 Ga0075367_10004009 Ga0075367_100040096 199
417 3300006178 Ga0075367_10004494 Ga0075367_100044945 199
418 3300006186 Ga0075369_10002071 Ga0075369_100020714 199
419 3300006186 Ga0075369_10036124 Ga0075369_100361242 199
420 3300006195 Ga0075366_10194627 Ga0075366_101946272 199
421 3300006353 Ga0075370_10202411 Ga0075370_102024112 199
422 3300006948 Ga0099826_10000958 Ga0099826_1000095811 199
423 3300006948 Ga0099826_10019601 Ga0099826_100196013 199
424 3300009011 Ga0105251_10017043 Ga0105251_100170433 199
425 3300009036 Ga0105244_10088997 Ga0105244_100889972 199
426 3300009092 Ga0105250_10029222 Ga0105250_100292222 199
427 3300009148 Ga0105243_10005164 Ga0105243_100051645 199
428 3300009177 Ga0105248_10119214 Ga0105248_101192144 199
429 3300009553 Ga0105249_10600761 Ga0105249_106007612 199
430 3300009766 Ga0123342_1009724 Ga0123342_10097242 199
431 3300011119 Ga0105246_10046692 Ga0105246_100466922 199
432 3300011119 Ga0105246_10729693 Ga0105246_107296931 199
433 3300013100 Ga0157373_10135423 Ga0157373_101354233 199
434 3300013102 Ga0157371_10000108 Ga0157371_1000010868 199
435 3300013104 Ga0157370_10004961 Ga0157370_100049618 199
436 3300013104 Ga0157370_10830905 Ga0157370_108309052 199
437 3300017792 Ga0163161_10076548 Ga0163161_100765484 199
438 3300025258 Ga0209129_1000118 Ga0209129_100011832 199
439 3300025258 Ga0209129_1003196 Ga0209129_10031964 199
440 3300025273 Ga0209673_1000033 Ga0209673_1000033248 199
441 3300025273 Ga0209673_1005860 Ga0209673_10058604 199
442 3300025294 Ga0209025_1000487 Ga0209025_100048744 199
443 3300025294 Ga0209025_1002217 Ga0209025_10022176 199
444 3300025294 Ga0209025_1005633 Ga0209025_10056339 199
445 3300025294 Ga0209025_1027717 Ga0209025_10277173 199
446 3300025294 Ga0209025_1064942 Ga0209025_10649421 199
447 3300025295 Ga0209564_1016817 Ga0209564_10168174 199
448 3300025295 Ga0209564_1024253 Ga0209564_10242532 199
449 3300025297 Ga0209758_1015745 Ga0209758_10157455 199
450 3300025297 Ga0209758_1040429 Ga0209758_10404292 199
451 3300025299 Ga0209256_1001743 Ga0209256_10017433 199
452 3300025299 Ga0209256_1012473 Ga0209256_10124733 199
453 3300025302 Ga0207426_1001232 Ga0207426_10012326 199
454 3300025303 Ga0209051_1009487 Ga0209051_10094874 199
455 3300025925 Ga0207650_10456487 Ga0207650_104564872 199
456 3300025972 Ga0207668_10211867 Ga0207668_102118671 199
457 3300026067 Ga0207678_10157915 Ga0207678_101579153 199
458 3300027312 Ga0209371_1000037 Ga0209371_1000037135 199
459 3300027666 Ga0209282_1061069 Ga0209282_10610692 199
460 3300027866 Ga0209813_10008558 Ga0209813_100085581 199
461 3300028379 Ga0268266_10006277 Ga0268266_100062775 199
462 3300030500 Ga0268256_1000039 Ga0268256_1000039174 199
463 3300030500 Ga0268256_1006192 Ga0268256_10061922 199
464 3300030744 Ga0316181_1219928 Ga0316181_12199282 199
465 3300030745 Ga0316182_1125124 Ga0316182_11251242 199
466 3300031911 Ga0307412_10005736 Ga0307412_100057364 199
467 3300032004 Ga0307414_10275341 Ga0307414_102753413 199
468 3300041413 Ga0439465_0003192 Ga0439465_0003192_4639_5244 199
469 3300042007 Ga0439449_0054074 Ga0439449_0054074_627_1232 199
470 3300046506 Ga0495583_0030217 Ga0495583_0030217_1254_1859 199
471 3300046507 Ga0495606_0199747 Ga0495606_0199747_86_691 199
472 3300046522 Ga0495643_0075118 Ga0495643_0075118_1044_1649 199
473 3300046674 Ga0495588_0003857 Ga0495588_0003857_4400_5005 199
474 3300047470 Ga0495681_0004907 Ga0495681_0004907_1690_2295 199
475 3300048919 Ga0496116_0028421 Ga0496116_0028421_2967_3572 199
476 3300048920 Ga0496117_0000031 Ga0496117_0000031_155202_155807 199
477 3300048921 Ga0496118_0000899 Ga0496118_0000899_4737_5342 199
478 3300048922 Ga0496119_0182203 Ga0496119_0182203_482_1087 199
479 3300048923 Ga0496120_0000337 Ga0496120_0000337_4415_5020 199
480 3300048924 Ga0496121_0032092 Ga0496121_0032092_1238_1873 199
481 3300048924 Ga0496121_0038490 Ga0496121_0038490_2544_3149 199
482 3300048924 Ga0496121_0103185 Ga0496121_0103185_254_859 199
483 3300048924 Ga0496121_0250461 Ga0496121_0250461_254_859 199
484 3300048925 Ga0496122_0000023 Ga0496122_0000023_155202_155807 199
485 3300048926 Ga0496123_0000027 Ga0496123_0000027_225229_225834 199
486 3300048926 Ga0496123_0068460 Ga0496123_0068460_388_1023 199
487 3300048926 Ga0496123_0164731 Ga0496123_0164731_449_1054 199
488 3300048927 Ga0496124_0002248 Ga0496124_0002248_609_1214 199
489 3300048927 Ga0496124_0154210 Ga0496124_0154210_940_1545 199
490 3300048927 Ga0496124_0284143 Ga0496124_0284143_355_960 199
491 3300048929 Ga0496126_0165125 Ga0496126_0165125_762_1367 199
492 3300048929 Ga0496126_0322983 Ga0496126_0322983_77_682 199
493 3300049742 Ga0501080_0520876 Ga0501080_0520876_45_650 199
494 3300049823 Ga0501044_0179878 Ga0501044_0179878_479_1084 199
495 3300050489 nmdc:mga03683_40021_c1 nmdc:mga03683_40021_c1_528_1133 199
496 3300050491 nmdc:mga00v17_151_c1 nmdc:mga00v17_151_c1_25692_26297 199
497 3300050492 nmdc:mga0yw44_137544_c1 nmdc:mga0yw44_137544_c1_324_929 199
498 3300050493 nmdc:mga0k408_55701_c1 nmdc:mga0k408_55701_c1_52_657 199
499 3300050494 nmdc:mga06z11_6588_c1 nmdc:mga06z11_6588_c1_1550_2155 199
500 3300050495 nmdc:mga04h51_7309_c1 nmdc:mga04h51_7309_c1_455_1060 199
501 3300050516 nmdc:mga0sz30_107_c1 nmdc:mga0sz30_107_c1_16881_17486 199
502 3300050516 nmdc:mga0sz30_1545_c1 nmdc:mga0sz30_1545_c1_7031_7633 199
503 3300050516 nmdc:mga0sz30_98810_c1 nmdc:mga0sz30_98810_c1_463_1062 199
504 3300053107 Ga0500560_002140 Ga0500560_002140_1802_2407 199
505 3300059643 Ga0587072_049824 Ga0587072_049824_89_688 199
506 3300002739 JGI25158J39367_1000116 JGI25158J39367_100011617 200
507 3300002773 JGI25152J39213_1007127 JGI25152J39213_10071272 200
508 3300002773 JGI25152J39213_1008840 JGI25152J39213_10088403 200
509 3300002773 JGI25152J39213_1012669 JGI25152J39213_10126693 200
510 3300002773 JGI25152J39213_1029515 JGI25152J39213_10295151 200
511 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003715 200
512 3300002774 JGI25150J39212_1002674 JGI25150J39212_10026743 200
513 3300002987 JGI25159J45721_1002450 JGI25159J45721_10024506 200
514 3300003187 JGI25151J46595_10000220 JGI25151J46595_1000022060 200
515 3300003187 JGI25151J46595_10002753 JGI25151J46595_100027535 200
516 3300003215 JGI25153J46596_10007468 JGI25153J46596_100074684 200
517 3300003215 JGI25153J46596_10008966 JGI25153J46596_100089663 200
518 3300003215 JGI25153J46596_10020908 JGI25153J46596_100209083 200
519 3300003215 JGI25153J46596_10029782 JGI25153J46596_100297823 200
520 3300003215 JGI25153J46596_10031300 JGI25153J46596_100313003 200
521 3300003323 rootH1_10245785 rootH1_102457852 200
522 3300003354 JGI25160J50197_1004236 JGI25160J50197_10042366 200
523 3300003374 JGI25161J50226_1000327 JGI25161J50226_10003276 200
524 3300003771 Ga0055526_1004020 Ga0055526_10040208 200
525 3300003771 Ga0055526_1007862 Ga0055526_10078622 200
526 3300003771 Ga0055526_1010107 Ga0055526_10101074 200
527 3300003775 Ga0055524_1004836 Ga0055524_10048364 200
528 3300003775 Ga0055524_1042784 Ga0055524_10427841 200
529 3300003790 Ga0055528_1002777 Ga0055528_10027775 200
530 3300003790 Ga0055528_1002884 Ga0055528_10028848 200
531 3300003790 Ga0055528_1003641 Ga0055528_10036416 200
532 3300003790 Ga0055528_1015747 Ga0055528_10157474 200
533 3300003790 Ga0055528_1018827 Ga0055528_10188274 200
534 3300003792 Ga0055540_1004301 Ga0055540_10043015 200
535 3300003792 Ga0055540_1007209 Ga0055540_10072092 200
536 3300003792 Ga0055540_1009091 Ga0055540_10090912 200
537 3300003792 Ga0055540_1011960 Ga0055540_10119602 200
538 3300003794 Ga0055531_10004054 Ga0055531_100040544 200
539 3300004625 Ga0055543_1000062 Ga0055543_100006288 200
540 3300004625 Ga0055543_1004762 Ga0055543_10047624 200
541 3300005262 Ga0065165_1009930 Ga0065165_10099304 200
542 3300005331 Ga0070670_100000116 Ga0070670_10000011623 200
543 3300005548 Ga0070665_100214209 Ga0070665_1002142092 200
544 3300005548 Ga0070665_100220976 Ga0070665_1002209762 200
545 3300006038 Ga0075365_10034493 Ga0075365_100344932 200
546 3300006038 Ga0075365_10054293 Ga0075365_100542932 200
547 3300006042 Ga0075368_10044952 Ga0075368_100449522 200
548 3300006048 Ga0075363_100116730 Ga0075363_1001167302 200
549 3300006051 Ga0075364_10000026 Ga0075364_1000002620 200
550 3300006051 Ga0075364_10121436 Ga0075364_101214363 200
551 3300006177 Ga0075362_10002019 Ga0075362_100020195 200
552 3300006186 Ga0075369_10007620 Ga0075369_100076204 200
553 3300006186 Ga0075369_10158987 Ga0075369_101589872 200
554 3300006195 Ga0075366_10081626 Ga0075366_100816262 200
555 3300006353 Ga0075370_10169851 Ga0075370_101698513 200
556 3300006946 Ga0079104_1000195 Ga0079104_100019541 200
557 3300009092 Ga0105250_10250695 Ga0105250_102506951 200
558 3300009765 Ga0123341_1000009 Ga0123341_100000986 200
559 3300012490 Ga0157322_1003437 Ga0157322_10034371 200
560 3300013100 Ga0157373_10505532 Ga0157373_105055322 200
561 3300013104 Ga0157370_10555371 Ga0157370_105553713 200
562 3300025208 Ga0209436_100018 Ga0209436_10001813 200
563 3300025245 Ga0207425_1000034 Ga0207425_100003416 200
564 3300025245 Ga0207425_1002143 Ga0207425_10021435 200
565 3300025245 Ga0207425_1009172 Ga0207425_10091723 200
566 3300025245 Ga0207425_1020102 Ga0207425_10201023 200
567 3300025258 Ga0209129_1000253 Ga0209129_100025316 200
568 3300025258 Ga0209129_1000971 Ga0209129_100097114 200
569 3300025258 Ga0209129_1003252 Ga0209129_10032525 200
570 3300025258 Ga0209129_1004160 Ga0209129_10041605 200
571 3300025258 Ga0209129_1004572 Ga0209129_10045725 200
572 3300025273 Ga0209673_1000050 Ga0209673_10000505 200
573 3300025273 Ga0209673_1000052 Ga0209673_1000052140 200
574 3300025273 Ga0209673_1004625 Ga0209673_10046254 200
575 3300025273 Ga0209673_1010491 Ga0209673_10104914 200
576 3300025273 Ga0209673_1011538 Ga0209673_10115383 200
577 3300025284 Ga0209130_1000009 Ga0209130_1000009279 200
578 3300025292 Ga0209676_1014960 Ga0209676_10149603 200
579 3300025294 Ga0209025_1000335 Ga0209025_10003355 200
580 3300025294 Ga0209025_1000533 Ga0209025_100053361 200
581 3300025294 Ga0209025_1013935 Ga0209025_10139353 200
582 3300025294 Ga0209025_1015409 Ga0209025_10154095 200
583 3300025295 Ga0209564_1000782 Ga0209564_100078239 200
584 3300025295 Ga0209564_1003320 Ga0209564_100332010 200
585 3300025295 Ga0209564_1003367 Ga0209564_10033675 200
586 3300025297 Ga0209758_1000415 Ga0209758_100041561 200
587 3300025297 Ga0209758_1000570 Ga0209758_100057057 200
588 3300025297 Ga0209758_1001085 Ga0209758_100108527 200
589 3300025297 Ga0209758_1001086 Ga0209758_100108626 200
590 3300025297 Ga0209758_1002520 Ga0209758_100252012 200
591 3300025297 Ga0209758_1002827 Ga0209758_100282712 200
592 3300025297 Ga0209758_1004611 Ga0209758_10046116 200
593 3300025298 Ga0209050_1004422 Ga0209050_10044224 200
594 3300025298 Ga0209050_1004558 Ga0209050_10045583 200
595 3300025299 Ga0209256_1002370 Ga0209256_10023706 200
596 3300025299 Ga0209256_1003766 Ga0209256_100376610 200
597 3300025299 Ga0209256_1007659 Ga0209256_10076594 200
598 3300025299 Ga0209256_1064228 Ga0209256_10642281 200
599 3300025302 Ga0207426_1000041 Ga0207426_1000041217 200
600 3300025302 Ga0207426_1000348 Ga0207426_100034844 200
601 3300025303 Ga0209051_1000276 Ga0209051_10002765 200
602 3300025303 Ga0209051_1003342 Ga0209051_10033425 200
603 3300025303 Ga0209051_1005359 Ga0209051_10053596 200
604 3300025303 Ga0209051_1006368 Ga0209051_10063685 200
605 3300025303 Ga0209051_1025776 Ga0209051_10257762 200
606 3300025303 Ga0209051_1084775 Ga0209051_10847751 200
607 3300025304 Ga0209257_1003532 Ga0209257_100353213 200
608 3300025304 Ga0209257_1007840 Ga0209257_10078404 200
609 3300025925 Ga0207650_10000691 Ga0207650_1000069114 200
610 3300027111 Ga0209281_1000028 Ga0209281_100002838 200
611 3300027111 Ga0209281_1000028 Ga0209281_1000028404 200
612 3300027866 Ga0209813_10018240 Ga0209813_100182402 200
613 3300028379 Ga0268266_10274370 Ga0268266_102743702 200
614 3300028379 Ga0268266_10559781 Ga0268266_105597812 200
615 3300028794 Ga0307515_10091403 Ga0307515_100914036 200
616 3300031731 Ga0307405_10014073 Ga0307405_100140733 200
617 3300032004 Ga0307414_10092769 Ga0307414_100927692 200
618 3300041451 Ga0451791_1345467 Ga0451791_1345467_511_1119 200
619 3300041460 Ga0451802_0488296 Ga0451802_0488296_42_650 200
620 3300041463 Ga0451804_0031999 Ga0451804_0031999_276_884 200
621 3300041496 Ga0451839_1011021 Ga0451839_1011021_1805_2413 200
622 3300041502 Ga0451846_16282 Ga0451846_16282_934_1542 200
623 3300041503 Ga0451847_0484987 Ga0451847_0484987_1326_1934 200
624 3300041505 Ga0451849_1333317 Ga0451849_1333317_239_847 200
625 3300041509 Ga0451843_0168405 Ga0451843_0168405_849_1457 200
626 3300041510 Ga0451854_27717 Ga0451854_27717_252_860 200
627 3300041511 Ga0451855_0487823 Ga0451855_0487823_279_887 200
628 3300041511 Ga0451855_1356374 Ga0451855_1356374_220_828 200
629 3300042006 Ga0439432_055974 Ga0439432_055974_195_803 200
630 3300042007 Ga0439449_0011037 Ga0439449_0011037_1287_1895 200
631 3300044683 Ga0466965_0083615 Ga0466965_0083615_711_1319 200
632 3300046471 Ga0495650_0064425 Ga0495650_0064425_363_971 200
633 3300046474 Ga0495605_0055743 Ga0495605_0055743_516_1124 200
634 3300046492 Ga0495585_0075254 Ga0495585_0075254_625_1233 200
635 3300046506 Ga0495583_0078164 Ga0495583_0078164_340_948 200
636 3300046507 Ga0495606_0002721 Ga0495606_0002721_18894_19502 200
637 3300046507 Ga0495606_0065112 Ga0495606_0065112_783_1391 200
638 3300046507 Ga0495606_0069944 Ga0495606_0069944_542_1150 200
639 3300046512 Ga0495610_0018390 Ga0495610_0018390_3160_3768 200
640 3300046512 Ga0495610_0099707 Ga0495610_0099707_352_960 200
641 3300046513 Ga0495616_0079629 Ga0495616_0079629_362_970 200
642 3300046515 Ga0495620_0051274 Ga0495620_0051274_1064_1672 200
643 3300046515 Ga0495620_0092762 Ga0495620_0092762_320_928 200
644 3300046518 Ga0495631_0069816 Ga0495631_0069816_320_928 200
645 3300046518 Ga0495631_0145392 Ga0495631_0145392_296_904 200
646 3300046519 Ga0495632_0018201 Ga0495632_0018201_1282_1932 200
647 3300046519 Ga0495632_0028409 Ga0495632_0028409_741_1349 200
648 3300046522 Ga0495643_0031476 Ga0495643_0031476_2082_2690 200
649 3300046523 Ga0495644_0124905 Ga0495644_0124905_319_927 200
650 3300046525 Ga0495663_0032664 Ga0495663_0032664_16_624 200
651 3300046530 Ga0495654_0036910 Ga0495654_0036910_1249_1857 200
652 3300046530 Ga0495654_0203180 Ga0495654_0203180_177_785 200
653 3300046542 Ga0495597_0211758 Ga0495597_0211758_79_687 200
654 3300046558 Ga0495633_0017477 Ga0495633_0017477_256_864 200
655 3300046558 Ga0495633_0043486 Ga0495633_0043486_794_1402 200
656 3300046615 Ga0495656_0017308 Ga0495656_0017308_648_1256 200
657 3300046615 Ga0495656_0084332 Ga0495656_0084332_71_679 200
658 3300046616 Ga0495668_0033189 Ga0495668_0033189_1259_1867 200
659 3300046648 Ga0495611_0245018 Ga0495611_0245018_153_761 200
660 3300046660 Ga0495625_0234310 Ga0495625_0234310_273_881 200
661 3300046674 Ga0495588_0199378 Ga0495588_0199378_406_1014 200
662 3300046694 Ga0495649_0172590 Ga0495649_0172590_284_892 200
663 3300047443 Ga0495687_109531 Ga0495687_109531_301_909 200
664 3300047472 Ga0495686_0015554 Ga0495686_0015554_1896_2504 200
665 3300047472 Ga0495686_0022064 Ga0495686_0022064_278_886 200
666 3300047472 Ga0495686_0038018 Ga0495686_0038018_2042_2650 200
667 3300047472 Ga0495686_0400493 Ga0495686_0400493_30_680 200
668 3300048090 Ga0495615_0037031 Ga0495615_0037031_42_650 200
669 3300048091 Ga0495626_0085234 Ga0495626_0085234_177_785 200
670 3300048914 Ga0496111_0025110 Ga0496111_0025110_3054_3665 200
671 3300048916 Ga0496113_0322481 Ga0496113_0322481_452_1096 200
672 3300048919 Ga0496116_0005573 Ga0496116_0005573_5267_5911 200
673 3300048919 Ga0496116_0025349 Ga0496116_0025349_1899_2546 200
674 3300048919 Ga0496116_0065649 Ga0496116_0065649_461_1105 200
675 3300048920 Ga0496117_0042184 Ga0496117_0042184_575_1219 200
676 3300048920 Ga0496117_0074990 Ga0496117_0074990_684_1328 200
677 3300048921 Ga0496118_0076791 Ga0496118_0076791_1304_1948 200
678 3300048921 Ga0496118_0097285 Ga0496118_0097285_539_1147 200
679 3300048921 Ga0496118_0157308 Ga0496118_0157308_204_848 200
680 3300048924 Ga0496121_0005857 Ga0496121_0005857_10052_10669 200
681 3300048924 Ga0496121_0017796 Ga0496121_0017796_4986_5597 200
682 3300048924 Ga0496121_0026755 Ga0496121_0026755_1844_2488 200
683 3300048924 Ga0496121_0067368 Ga0496121_0067368_544_1152 200
684 3300048924 Ga0496121_0178040 Ga0496121_0178040_717_1325 200
685 3300048925 Ga0496122_0000074 Ga0496122_0000074_51746_52369 200
686 3300048925 Ga0496122_0017308 Ga0496122_0017308_3000_3611 200
687 3300048925 Ga0496122_0025165 Ga0496122_0025165_1604_2248 200
688 3300048925 Ga0496122_0150487 Ga0496122_0150487_562_1206 200
689 3300048926 Ga0496123_0000062 Ga0496123_0000062_51728_52351 200
690 3300048926 Ga0496123_0006549 Ga0496123_0006549_9919_10530 200
691 3300048926 Ga0496123_0017095 Ga0496123_0017095_3118_3762 200
692 3300048926 Ga0496123_0038065 Ga0496123_0038065_712_1356 200
693 3300048927 Ga0496124_0021541 Ga0496124_0021541_5053_5697 200
694 3300048927 Ga0496124_0024118 Ga0496124_0024118_3635_4279 200
695 3300048927 Ga0496124_0037520 Ga0496124_0037520_1903_2514 200
696 3300048927 Ga0496124_0103547 Ga0496124_0103547_539_1189 200
697 3300048927 Ga0496124_0282908 Ga0496124_0282908_32_640 200
698 3300048928 Ga0496125_0042092 Ga0496125_0042092_1469_2113 200
699 3300050489 nmdc:mga03683_23864_c1 nmdc:mga03683_23864_c1_360_968 200
700 3300050491 nmdc:mga00v17_1285_c1 nmdc:mga00v17_1285_c1_3640_4257 200
701 3300050491 nmdc:mga00v17_41963_c1 nmdc:mga00v17_41963_c1_355_972 200
702 3300050492 nmdc:mga0yw44_29465_c1 nmdc:mga0yw44_29465_c1_2171_2776 200
703 3300050493 nmdc:mga0k408_155997_c1 nmdc:mga0k408_155997_c1_11_619 200
704 3300050495 nmdc:mga04h51_9426_c1 nmdc:mga04h51_9426_c1_746_1354 200
705 3300050496 nmdc:mga07m45_115924_c1 nmdc:mga07m45_115924_c1_360_968 200
706 3300053086 Ga0500578_0067685 Ga0500578_0067685_172_780 200
707 3300053125 Ga0500618_001412 Ga0500618_001412_4986_5597 200
708 3300053125 Ga0500618_002740 Ga0500618_002740_2779_3393 200
709 3300053134 Ga0500658_0000309 Ga0500658_0000309_10405_11013 200
710 3300053134 Ga0500658_0018303 Ga0500658_0018303_456_1064 200
711 3300053139 Ga0500568_0018858 Ga0500568_0018858_1789_2397 200
712 3300053151 Ga0500604_0009869 Ga0500604_0009869_1661_2269 200
713 3300053153 Ga0500616_0005597 Ga0500616_0005597_4254_4856 200
714 3300053153 Ga0500616_0020147 Ga0500616_0020147_2073_2681 200
715 3300053156 Ga0500622_0118528 Ga0500622_0118528_491_1096 200
716 3300053158 Ga0500627_0156409 Ga0500627_0156409_35_637 200
717 3300053160 Ga0500633_0012605 Ga0500633_0012605_655_1263 200
718 3300059493 Ga0587077_047895 Ga0587077_047895_35_643 200
719 2010549000 RicEn_C10344 RicEn_179950 201
720 3300046457 Ga0495590_0157878 Ga0495590_0157878_184_798 201
721 3300046471 Ga0495650_0049192 Ga0495650_0049192_661_1272 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

84

172

0.94

PF00578

AhpC-TSA

AhpC/TSA family

52

175

0.87

PF08534

Redoxin

Redoxin

52

191

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9659 61 197
3k8n-assembly1.cif.gz_A crystal structure of e. coli ccmg 0.9182 55 201
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.916 52 198
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9151 56 197
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.914 61 197
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 61 197 3.40.30.10
5hfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9338 87 120 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9151 56 197 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.914 61 197 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.864 55 176 3.40.30.10
ID Description Score Start End GO Terms
AF-E6YG17-F1-model_v4 Thiol:disulfide interchange protein 0.9753 90 200 GO:0015036
GO:0017004
GO:0030288
AF-A0A3D5I3M4-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9685 83 199 GO:0016491
GO:0017004
AF-A0A3D4TMJ4-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9656 90 196 GO:0005886
GO:0015036
GO:0017004
GO:0030288
AF-A0A7W3WC79-F1-model_v4 deleted 0.9637 45 201
AF-A0A1Q7WVB3-F1-model_v4 Thiol:disulfide interchange protein 0.9634 73 201 GO:0015036
GO:0017004
GO:0030288

Feature Viewer

pLDDT pTM Quality
86.12 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map