F477335

General Info

Members Datasets Scaffolds Average Seq Length
720 273 1440 284

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0184288|Ga0501077_0184288_23_943
Length 298
Sequence VAEAARGLSAPAGRAHAGGLIHRHRWLTPYLLLAPGLAFLALFFLVPLGFLGHQSLETQNPIDFTNSFTWAWHNYSDALTTYDAQLIRSFEYAAIATAIALLLSYPLAYWIAFRGGRWKNLLLLMIIAPFFVTYLIRTLAWETILSDQGPVVHVLRYLHLINVIGDNDRLLATPTAVVAGITYNFLPFMALPLYVALEQIDPRLIEAGQDLYASKVRTFLHVTLPLSMPGVMAGTLLTFIPAAGDFINAQLLGTPRQYMIGNVIQSKFLALTDYPSAAALSLILMVYVRLLGTEKLTG

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
181 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
185 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
201 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
270 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 10.83
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0184288 3300049593 Bacteria 1326
2 ARSoilOldRDRAFT_c000959 3300000044 Bacteria 2799
3 JGI24743J22301_10005721 3300001991 Bacteria 2087
4 JGI25406J46586_10043356 3300003203 Bacteria 1567
5 JGI25407J50210_10031620 3300003373 Bacteria 1369
6 Ga0070658_10178794 3300005327 Bacteria 1785
7 Ga0070658_10507818 3300005327 Bacteria 1042
8 Ga0070676_10073342 3300005328 Bacteria 2059
9 Ga0070683_100001493 3300005329 Bacteria 18056
10 Ga0070683_100028334 3300005329 Bacteria 5061
11 Ga0070683_100029460 3300005329 Bacteria 4970
12 Ga0070683_100246842 3300005329 Bacteria 1698
13 Ga0070690_100031767 3300005330 Bacteria 3292
14 Ga0070670_100062090 3300005331 Bacteria 3208
15 Ga0070670_100277428 3300005331 Bacteria 1463
16 Ga0070677_10029819 3300005333 Bacteria 2072
17 Ga0070677_10148257 3300005333 Bacteria 1089
18 Ga0068869_100178694 3300005334 Bacteria 1663
19 Ga0070680_100115857 3300005336 Bacteria 2233
20 Ga0070680_100118448 3300005336 Bacteria 2209
21 Ga0070680_100122907 3300005336 Bacteria 2168
22 Ga0070680_100293600 3300005336 Bacteria 1378
23 Ga0070680_100302031 3300005336 Bacteria 1358
24 Ga0070682_100018714 3300005337 Bacteria 4054
25 Ga0070682_100106864 3300005337 Bacteria 1858
26 Ga0070682_100123772 3300005337 Bacteria 1740
27 Ga0070682_100351656 3300005337 Bacteria 1099
28 Ga0068868_100038323 3300005338 Bacteria 3720
29 Ga0068868_100038909 3300005338 Bacteria 3692
30 Ga0068868_100054625 3300005338 Bacteria 3149
31 Ga0068868_100111275 3300005338 Bacteria 2226
32 Ga0070660_100045058 3300005339 Bacteria 3375
33 Ga0070689_100107245 3300005340 Bacteria 2217
34 Ga0070689_100150877 3300005340 Bacteria 1874
35 Ga0070687_100127861 3300005343 Bacteria 1463
36 Ga0070687_100168722 3300005343 Bacteria 1301
37 Ga0070692_10127085 3300005345 Bacteria 1428
38 Ga0070668_100082126 3300005347 Bacteria 2527
39 Ga0070668_100091164 3300005347 Bacteria 2402
40 Ga0070668_100120517 3300005347 Bacteria 2096
41 Ga0070669_100280944 3300005353 Bacteria 1334
42 Ga0070675_100117232 3300005354 Bacteria 2259
43 Ga0070675_100335190 3300005354 Bacteria 1339
44 Ga0070675_100514663 3300005354 Bacteria 1079
45 Ga0070671_100052773 3300005355 Bacteria 3381
46 Ga0070674_100033145 3300005356 Bacteria 3436
47 Ga0070674_100074124 3300005356 Bacteria 2414
48 Ga0070673_100006162 3300005364 Bacteria 7771
49 Ga0070673_100224726 3300005364 Bacteria 1626
50 Ga0070688_100011519 3300005365 Bacteria 4915
51 Ga0070688_100159872 3300005365 Bacteria 1547
52 Ga0070659_100052551 3300005366 Bacteria 3205
53 Ga0070659_100069559 3300005366 Bacteria 2794
54 Ga0070659_100155658 3300005366 Bacteria 1866
55 Ga0070714_100012074 3300005435 Bacteria 6877
56 Ga0070714_100092822 3300005435 Bacteria 2646
57 Ga0070713_100165635 3300005436 Bacteria 1976
58 Ga0070701_10017912 3300005438 Bacteria 3320
59 Ga0070701_10348961 3300005438 Bacteria 924
60 Ga0070700_100010938 3300005441 Bacteria 5019
61 Ga0070700_100042424 3300005441 Bacteria 2793
62 Ga0070700_100137088 3300005441 Bacteria 1659
63 Ga0070708_100372239 3300005445 Bacteria 1347
64 Ga0070663_100018107 3300005455 Bacteria 4611
65 Ga0070663_100095024 3300005455 Bacteria 2215
66 Ga0070678_100010432 3300005456 Bacteria 5676
67 Ga0070678_100033777 3300005456 Bacteria 3555
68 Ga0070678_100190422 3300005456 Bacteria 1686
69 Ga0070678_100447780 3300005456 Bacteria 1130
70 Ga0070662_100022130 3300005457 Bacteria 4347
71 Ga0070662_100167353 3300005457 Bacteria 1724
72 Ga0070681_10006222 3300005458 Bacteria 11601
73 Ga0068867_100109385 3300005459 Bacteria 2121
74 Ga0068867_100168857 3300005459 Bacteria 1731
75 Ga0070685_10088929 3300005466 Bacteria 1866
76 Ga0070685_10107281 3300005466 Bacteria 1715
77 Ga0070685_10222812 3300005466 Bacteria 1236
78 Ga0070698_100008294 3300005471 Bacteria 11233
79 Ga0070699_100056831 3300005518 Bacteria 3389
80 Ga0070679_100017052 3300005530 Bacteria 7020
81 Ga0070679_100363798 3300005530 Bacteria 1394
82 Ga0070684_100001828 3300005535 Bacteria 15587
83 Ga0070684_100002599 3300005535 Bacteria 13327
84 Ga0070684_100005993 3300005535 Bacteria 9364
85 Ga0070684_100074231 3300005535 Bacteria 2998
86 Ga0070672_100202233 3300005543 Bacteria 1661
87 Ga0070672_100224211 3300005543 Bacteria 1577
88 Ga0070686_100021001 3300005544 Bacteria 3875
89 Ga0070686_100058321 3300005544 Bacteria 2484
90 Ga0070695_100147344 3300005545 Bacteria 1639
91 Ga0070696_100064512 3300005546 Bacteria 2566
92 Ga0070665_100042390 3300005548 Bacteria 4574
93 Ga0070665_100122012 3300005548 Bacteria 2608
94 Ga0070665_100370921 3300005548 Bacteria 1438
95 Ga0070665_100650692 3300005548 Bacteria 1067
96 Ga0070704_100061700 3300005549 Bacteria 2684
97 Ga0068855_100023620 3300005563 Bacteria 7364
98 Ga0068855_100201461 3300005563 Bacteria 2240
99 Ga0070664_100085565 3300005564 Bacteria 2723
100 Ga0070664_100196166 3300005564 Bacteria 1800
101 Ga0068854_100360833 3300005578 Bacteria 1192
102 Ga0068856_100025670 3300005614 Bacteria 5745
103 Ga0068856_100036986 3300005614 Bacteria 4788
104 Ga0068856_100047024 3300005614 Bacteria 4251
105 Ga0068856_100457806 3300005614 Bacteria 1297
106 Ga0068852_100056511 3300005616 Bacteria 3392
107 Ga0068852_100332503 3300005616 Bacteria 1479
108 Ga0068859_100078851 3300005617 Bacteria 3333
109 Ga0068864_100055928 3300005618 Bacteria 3409
110 Ga0068861_100183253 3300005719 Bacteria 1745
111 Ga0068870_10008714 3300005840 Bacteria 4574
112 Ga0068863_100024916 3300005841 Bacteria 5706
113 Ga0068860_100095885 3300005843 Bacteria 2828
114 Ga0068862_100070674 3300005844 Bacteria 3013
115 Ga0081455_10012398 3300005937 Bacteria 8506
116 Ga0081455_10018034 3300005937 Bacteria 6741
117 Ga0081455_10067112 3300005937 Bacteria 2991
118 Ga0081538_10006328 3300005981 Bacteria 10452
119 Ga0081538_10010294 3300005981 Bacteria 7677
120 Ga0081538_10039057 3300005981 Bacteria 3050
121 Ga0081540_1026013 3300005983 Bacteria 3351
122 Ga0081539_10009582 3300005985 Bacteria 8053
123 Ga0075365_10067474 3300006038 Bacteria 2402
124 Ga0075363_100116716 3300006048 Bacteria 1487
125 Ga0070712_100008925 3300006175 Bacteria 6314
126 Ga0097621_100021719 3300006237 Bacteria 4971
127 Ga0097621_100626766 3300006237 Bacteria 985
128 Ga0075428_100002185 3300006844 Bacteria 21168
129 Ga0075428_100192667 3300006844 Bacteria 2204
130 Ga0075428_100489665 3300006844 Bacteria 1316
131 Ga0075430_100009439 3300006846 Bacteria 8240
132 Ga0075430_100105500 3300006846 Bacteria 2351
133 Ga0075431_100001646 3300006847 Bacteria 20928
134 Ga0075431_100002443 3300006847 Bacteria 17883
135 Ga0075434_100103161 3300006871 Bacteria 2860
136 Ga0075434_100630544 3300006871 Unclassified 1091
137 Ga0075429_100002100 3300006880 Bacteria 16628
138 Ga0075429_100023063 3300006880 Bacteria 5395
139 Ga0075429_100348411 3300006880 Bacteria 1297
140 Ga0068865_100013327 3300006881 Bacteria 5194
141 Ga0068865_100045852 3300006881 Bacteria 2997
142 Ga0075436_100011932 3300006914 Bacteria 5960
143 Ga0075436_100410560 3300006914 Bacteria 982
144 Ga0097620_100078850 3300006931 Bacteria 3333
145 Ga0075435_100107900 3300007076 Unclassified 2313
146 Ga0075435_100117282 3300007076 Bacteria 2218
147 Ga0105244_10069256 3300009036 Bacteria 1762
148 Ga0105240_10017276 3300009093 Bacteria 9731
149 Ga0111539_10017709 3300009094 Bacteria 8820
150 Ga0111539_10092216 3300009094 Bacteria 3560
151 Ga0111539_10111591 3300009094 Bacteria 3208
152 Ga0111539_10156589 3300009094 Bacteria 2666
153 Ga0111539_10324243 3300009094 Bacteria 1793
154 Ga0111539_10561002 3300009094 Bacteria 1330
155 Ga0105245_10117227 3300009098 Bacteria 2483
156 Ga0105245_10117882 3300009098 Bacteria 2477
157 Ga0105245_10201442 3300009098 Bacteria 1912
158 Ga0105245_10248468 3300009098 Bacteria 1727
159 Ga0105245_10251750 3300009098 Bacteria 1716
160 Ga0105245_10277258 3300009098 Bacteria 1637
161 Ga0105247_10014387 3300009101 Bacteria 4747
162 Ga0114129_10001686 3300009147 Bacteria 30132
163 Ga0114129_10237468 3300009147 Bacteria 2452
164 Ga0114129_10258478 3300009147 Bacteria 2335
165 Ga0114129_10294990 3300009147 Bacteria 2163
166 Ga0114129_10344010 3300009147 Bacteria 1977
167 Ga0114129_10390913 3300009147 Bacteria 1834
168 Ga0105243_10042888 3300009148 Bacteria 3544
169 Ga0105243_10070264 3300009148 Bacteria 2827
170 Ga0105243_10188985 3300009148 Bacteria 1797
171 Ga0105243_10243349 3300009148 Bacteria 1602
172 Ga0105243_10356111 3300009148 Bacteria 1346
173 Ga0105241_10131389 3300009174 Bacteria 2028
174 Ga0105242_10033991 3300009176 Bacteria 4086
175 Ga0105242_10122255 3300009176 Bacteria 2236
176 Ga0105242_10296543 3300009176 Bacteria 1474
177 Ga0105248_10146312 3300009177 Bacteria 2666
178 Ga0105248_10156943 3300009177 Bacteria 2567
179 Ga0105237_10120910 3300009545 Bacteria 2613
180 Ga0105238_10381826 3300009551 Bacteria 1400
181 Ga0105239_10065955 3300010375 Bacteria 3977
182 Ga0105239_10131197 3300010375 Bacteria 2787
183 Ga0105239_10305547 3300010375 Bacteria 1792
184 Ga0105239_10515329 3300010375 Bacteria 1360
185 Ga0105246_10187214 3300011119 Bacteria 1599
186 Ga0157371_10218141 3300013102 Bacteria 1370
187 Ga0157370_10020071 3300013104 Bacteria 6684
188 Ga0157370_10055576 3300013104 Bacteria 3770
189 Ga0157369_10006152 3300013105 Bacteria 13927
190 Ga0157369_10312077 3300013105 Bacteria 1635
191 Ga0157374_10148423 3300013296 Bacteria 2279
192 Ga0157374_10378573 3300013296 Bacteria 1410
193 Ga0157378_10035810 3300013297 Bacteria 4392
194 Ga0157378_10119693 3300013297 Bacteria 2425
195 Ga0157378_10170167 3300013297 Bacteria 2043
196 Ga0163162_10047253 3300013306 Bacteria 4314
197 Ga0163162_10168818 3300013306 Bacteria 2312
198 Ga0163162_10171636 3300013306 Bacteria 2293
199 Ga0163162_10240628 3300013306 Bacteria 1941
200 Ga0157372_10108683 3300013307 Bacteria 3175
201 Ga0157372_10148241 3300013307 Bacteria 2706
202 Ga0157375_10073543 3300013308 Bacteria 3437
203 Ga0157375_10081920 3300013308 Bacteria 3268
204 Ga0157375_10390649 3300013308 Bacteria 1558
205 Ga0163163_10101967 3300014325 Bacteria 2893
206 Ga0163163_10380062 3300014325 Bacteria 1470
207 Ga0157380_10030261 3300014326 Bacteria 4145
208 Ga0157380_10040748 3300014326 Bacteria 3620
209 Ga0157380_10057221 3300014326 Bacteria 3104
210 Ga0157380_10315489 3300014326 Bacteria 1447
211 Ga0182008_10022405 3300014497 Bacteria 3236
212 Ga0182008_10151247 3300014497 Bacteria 1164
213 Ga0157377_10019041 3300014745 Bacteria 3580
214 Ga0157377_10052068 3300014745 Bacteria 2311
215 Ga0157377_10100653 3300014745 Bacteria 1721
216 Ga0157379_10133028 3300014968 Bacteria 2239
217 Ga0157379_10165838 3300014968 Bacteria 1993
218 Ga0157376_10049604 3300014969 Bacteria 3478
219 Ga0157376_10194948 3300014969 Bacteria 1860
220 Ga0157376_10267892 3300014969 Bacteria 1603
221 Ga0182006_1011323 3300015261 Bacteria 3928
222 Ga0163161_10040732 3300017792 Bacteria 3337
223 Ga0163161_10082710 3300017792 Bacteria 2366
224 Ga0206353_12049292 3300020082 Bacteria 6969
225 Ga0207682_10144777 3300025893 Bacteria 1068
226 Ga0207688_10007669 3300025901 Bacteria 5877
227 Ga0207688_10020357 3300025901 Bacteria 3622
228 Ga0207688_10051578 3300025901 Bacteria 2304
229 Ga0207688_10133378 3300025901 Bacteria 1457
230 Ga0207699_10021874 3300025906 Bacteria 3456
231 Ga0207645_10027749 3300025907 Bacteria 3655
232 Ga0207645_10054545 3300025907 Bacteria 2552
233 Ga0207643_10005820 3300025908 Bacteria 6588
234 Ga0207643_10013690 3300025908 Bacteria 4397
235 Ga0207643_10024615 3300025908 Bacteria 3322
236 Ga0207705_10015808 3300025909 Bacteria 5419
237 Ga0207705_10053995 3300025909 Bacteria 2896
238 Ga0207654_10103501 3300025911 Bacteria 1758
239 Ga0207707_10109391 3300025912 Bacteria 2416
240 Ga0207707_10173280 3300025912 Bacteria 1885
241 Ga0207707_10506583 3300025912 Bacteria 1029
242 Ga0207695_10094400 3300025913 Bacteria 2998
243 Ga0207695_10229580 3300025913 Bacteria 1761
244 Ga0207671_10059293 3300025914 Bacteria 2838
245 Ga0207693_10020136 3300025915 Bacteria 5307
246 Ga0207693_10057599 3300025915 Bacteria 3045
247 Ga0207660_10081155 3300025917 Bacteria 2383
248 Ga0207660_10283580 3300025917 Bacteria 1315
249 Ga0207662_10072367 3300025918 Bacteria 2089
250 Ga0207662_10117854 3300025918 Bacteria 1662
251 Ga0207662_10273471 3300025918 Bacteria 1116
252 Ga0207657_10011358 3300025919 Bacteria 8846
253 Ga0207657_10071447 3300025919 Bacteria 2939
254 Ga0207657_10074904 3300025919 Bacteria 2857
255 Ga0207649_10078557 3300025920 Bacteria 2130
256 Ga0207649_10422516 3300025920 Bacteria 1001
257 Ga0207681_10092747 3300025923 Bacteria 2160
258 Ga0207681_10168080 3300025923 Bacteria 1660
259 Ga0207694_10099640 3300025924 Bacteria 2301
260 Ga0207694_10242313 3300025924 Bacteria 1474
261 Ga0207650_10031411 3300025925 Bacteria 3835
262 Ga0207650_10295638 3300025925 Bacteria 1321
263 Ga0207659_10063179 3300025926 Bacteria 2675
264 Ga0207659_10238512 3300025926 Bacteria 1470
265 Ga0207659_10336291 3300025926 Bacteria 1249
266 Ga0207659_10384186 3300025926 Bacteria 1171
267 Ga0207659_10420459 3300025926 Bacteria 1121
268 Ga0207700_10000004 3300025928 Bacteria 443409
269 Ga0207700_10234491 3300025928 Bacteria 1562
270 Ga0207664_10076086 3300025929 Bacteria 2716
271 Ga0207644_10055917 3300025931 Bacteria 2846
272 Ga0207644_10073209 3300025931 Bacteria 2512
273 Ga0207644_10083236 3300025931 Bacteria 2369
274 Ga0207690_10017868 3300025932 Bacteria 4340
275 Ga0207690_10161712 3300025932 Bacteria 1670
276 Ga0207706_10028577 3300025933 Bacteria 4980
277 Ga0207706_10053866 3300025933 Bacteria 3551
278 Ga0207706_10059449 3300025933 Bacteria 3365
279 Ga0207686_10043680 3300025934 Bacteria 2747
280 Ga0207686_10072036 3300025934 Bacteria 2226
281 Ga0207709_10016182 3300025935 Bacteria 4145
282 Ga0207709_10093202 3300025935 Bacteria 1974
283 Ga0207709_10235114 3300025935 Bacteria 1330
284 Ga0207669_10054312 3300025937 Bacteria 2419
285 Ga0207669_10181980 3300025937 Bacteria 1508
286 Ga0207704_10122895 3300025938 Bacteria 1781
287 Ga0207704_10144247 3300025938 Bacteria 1670
288 Ga0207704_10338260 3300025938 Bacteria 1167
289 Ga0207665_10001415 3300025939 Bacteria 16136
290 Ga0207691_10031904 3300025940 Bacteria 4916
291 Ga0207711_10017513 3300025941 Bacteria 5951
292 Ga0207689_10030459 3300025942 Bacteria 4496
293 Ga0207689_10186943 3300025942 Bacteria 1709
294 Ga0207661_10000830 3300025944 Bacteria 20256
295 Ga0207661_10015200 3300025944 Bacteria 5660
296 Ga0207661_10058132 3300025944 Bacteria 3112
297 Ga0207661_10099993 3300025944 Bacteria 2433
298 Ga0207661_10102571 3300025944 Bacteria 2406
299 Ga0207661_10127962 3300025944 Bacteria 2171
300 Ga0207661_10405389 3300025944 Bacteria 1237
301 Ga0207679_10057854 3300025945 Bacteria 2870
302 Ga0207679_10512585 3300025945 Bacteria 1072
303 Ga0207667_10047740 3300025949 Bacteria 4530
304 Ga0207651_10046909 3300025960 Bacteria 2909
305 Ga0207651_10098403 3300025960 Bacteria 2163
306 Ga0207712_10362895 3300025961 Bacteria 1207
307 Ga0207668_10127039 3300025972 Bacteria 1941
308 Ga0207640_10319203 3300025981 Bacteria 1236
309 Ga0207677_10074193 3300026023 Bacteria 2413
310 Ga0207677_10112220 3300026023 Bacteria 2032
311 Ga0207677_10123056 3300026023 Bacteria 1955
312 Ga0207677_10335922 3300026023 Bacteria 1261
313 Ga0207678_10037045 3300026067 Bacteria 4245
314 Ga0207678_10182727 3300026067 Bacteria 1791
315 Ga0207678_10423276 3300026067 Bacteria 1155
316 Ga0207708_10008710 3300026075 Bacteria 7511
317 Ga0207708_10021745 3300026075 Bacteria 4840
318 Ga0207708_10026560 3300026075 Bacteria 4384
319 Ga0207708_10049966 3300026075 Bacteria 3184
320 Ga0207708_10102716 3300026075 Bacteria 2213
321 Ga0207702_10410671 3300026078 Bacteria 1307
322 Ga0207641_10682006 3300026088 Bacteria 1011
323 Ga0207648_10016664 3300026089 Bacteria 6706
324 Ga0207648_10018398 3300026089 Bacteria 6328
325 Ga0207648_10259731 3300026089 Bacteria 1550
326 Ga0207648_10269287 3300026089 Bacteria 1521
327 Ga0207648_10448731 3300026089 Bacteria 1174
328 Ga0207676_10177446 3300026095 Bacteria 1862
329 Ga0207674_10081884 3300026116 Bacteria 3230
330 Ga0207674_10223781 3300026116 Bacteria 1830
331 Ga0207674_10255988 3300026116 Bacteria 1697
332 Ga0207675_100327944 3300026118 Bacteria 1496
333 Ga0207675_100410243 3300026118 Bacteria 1336
334 Ga0207683_10049796 3300026121 Bacteria 3668
335 Ga0207683_10081371 3300026121 Bacteria 2874
336 Ga0207683_10084208 3300026121 Bacteria 2826
337 Ga0207698_10036431 3300026142 Bacteria 3611
338 Ga0207428_10001958 3300027907 Bacteria 20908
339 Ga0207428_10007998 3300027907 Bacteria 9600
340 Ga0207428_10012951 3300027907 Bacteria 7309
341 Ga0207428_10072742 3300027907 Bacteria 2698
342 Ga0207428_10104287 3300027907 Bacteria 2188
343 Ga0207428_10123147 3300027907 Bacteria 1987
344 Ga0207428_10242050 3300027907 Bacteria 1348
345 Ga0268266_10179222 3300028379 Bacteria 1928
346 Ga0268266_10292488 3300028379 Bacteria 1517
347 Ga0268266_10551775 3300028379 Bacteria 1104
348 Ga0268265_10286320 3300028380 Bacteria 1477
349 Ga0268264_10072359 3300028381 Bacteria 2923
350 Ga0268264_10498545 3300028381 Bacteria 1187
351 Ga0307406_10142203 3300031901 Bacteria 1700
352 Ga0307409_100180160 3300031995 Bacteria 1870
353 Ga0307409_100212065 3300031995 Bacteria 1741
354 Ga0307416_100287564 3300032002 Bacteria 1625
355 Ga0307411_10052984 3300032005 Bacteria 2656
356 Ga0307411_10201747 3300032005 Bacteria 1528
357 Ga0307415_100114497 3300032126 Bacteria 2008
358 Ga0373930_0013583 3300034816 Bacteria 1504
359 Ga0373959_0002542 3300034820 Bacteria 2893
360 Ga0373951_0025234 3300035091 Bacteria 1379
361 Ga0373939_0055276 3300035114 Bacteria 1246
362 Ga0373942_0051956 3300035207 Bacteria 1152
363 Ga0373931_0016146 3300035691 Bacteria 3671
364 Ga0373937_0033124 3300036401 Bacteria 4690
365 Ga0395899_0006283 3300037312 Bacteria 9198
366 Ga0395899_0008666 3300037312 Bacteria 7826
367 Ga0395899_0024063 3300037312 Bacteria 4607
368 Ga0395899_0025192 3300037312 Bacteria 4492
369 Ga0395899_0031452 3300037312 Bacteria 3988
370 Ga0395899_0104977 3300037312 Bacteria 2036
371 Ga0395899_0270167 3300037312 Bacteria 1160
372 Ga0395900_0003989 3300037418 Bacteria 15763
373 Ga0395900_0016655 3300037418 Bacteria 7497
374 Ga0395900_0034018 3300037418 Bacteria 5246
375 Ga0395898_0001313 3300037466 Bacteria 36176
376 Ga0395898_0005422 3300037466 Bacteria 13776
377 Ga0395898_0025399 3300037466 Bacteria 5970
378 Ga0395898_0052708 3300037466 Bacteria 3974
379 Ga0395898_0257669 3300037466 Bacteria 1663
380 Ga0395898_0421363 3300037466 Unclassified 1272
381 Ga0395898_0642029 3300037466 Bacteria 1004
382 Ga0395905_0004251 3300037471 Bacteria 14960
383 Ga0395905_0009184 3300037471 Bacteria 9680
384 Ga0395905_0109105 3300037471 Bacteria 2598
385 Ga0395905_0486643 3300037471 Bacteria 1133
386 Ga0395901_0003431 3300038443 Bacteria 15969
387 Ga0395901_0004078 3300038443 Bacteria 14714
388 Ga0395901_0014847 3300038443 Bacteria 7913
389 Ga0395901_0017794 3300038443 Bacteria 7253
390 Ga0395901_0135424 3300038443 Bacteria 2589
391 Ga0395901_0151415 3300038443 Bacteria 2437
392 Ga0395901_0271413 3300038443 Bacteria 1764
393 Ga0395901_0428789 3300038443 Bacteria 1355
394 Ga0450900_009651 3300042136 Bacteria 1226
395 Ga0450906_002799 3300042145 Bacteria 3803
396 Ga0439464_0086192 3300042439 Bacteria 942
397 Ga0466965_0162744 3300044683 Bacteria 1171
398 Ga0466966_0051691 3300044684 Bacteria 2612
399 Ga0466966_0112573 3300044684 Bacteria 1677
400 Ga0466961_0005553 3300044693 Bacteria 7958
401 Ga0466963_0000389 3300044694 Bacteria 20047
402 Ga0466963_0000536 3300044694 Bacteria 17838
403 Ga0466963_0000987 3300044694 Bacteria 14655
404 Ga0466963_0011636 3300044694 Bacteria 5359
405 Ga0466963_0026853 3300044694 Bacteria 3684
406 Ga0466963_0051243 3300044694 Bacteria 2735
407 Ga0466963_0106434 3300044694 Bacteria 1923
408 Ga0466963_0144874 3300044694 Bacteria 1647
409 Ga0466963_0334249 3300044694 Bacteria 1066
410 Ga0466964_0040462 3300044706 Bacteria 1882
411 Ga0466964_0047336 3300044706 Bacteria 1755
412 Ga0466971_0001779 3300044719 Bacteria 9145
413 Ga0466971_0051313 3300044719 Bacteria 1856
414 Ga0466968_0038929 3300044735 Bacteria 1999
415 Ga0466970_0036693 3300044765 Bacteria 2597
416 Ga0466970_0245096 3300044765 Bacteria 1003
417 Ga0466957_0000947 3300044842 Bacteria 14875
418 Ga0466957_0059499 3300044842 Bacteria 2342
419 Ga0466957_0083480 3300044842 Bacteria 1993
420 Ga0466957_0214742 3300044842 Bacteria 1268
421 Ga0466960_0027962 3300044901 Bacteria 2578
422 Ga0466959_0039146 3300045049 Bacteria 3504
423 Ga0466959_0099302 3300045049 Bacteria 2084
424 Ga0466959_0301836 3300045049 Bacteria 1096
425 Ga0466958_0000863 3300045836 Bacteria 13517
426 Ga0466958_0006156 3300045836 Bacteria 6506
427 Ga0466958_0011524 3300045836 Bacteria 4979
428 Ga0466958_0113430 3300045836 Bacteria 1693
429 Ga0466958_0144742 3300045836 Bacteria 1497
430 Ga0466967_0001125 3300045976 Bacteria 14868
431 Ga0466967_0018651 3300045976 Bacteria 5553
432 Ga0466967_0020982 3300045976 Bacteria 5292
433 Ga0466967_0025020 3300045976 Bacteria 4916
434 Ga0466967_0028436 3300045976 Bacteria 4666
435 Ga0466967_0036772 3300045976 Bacteria 4183
436 Ga0466967_0037605 3300045976 Bacteria 4143
437 Ga0466967_0048356 3300045976 Bacteria 3713
438 Ga0466967_0067595 3300045976 Bacteria 3188
439 Ga0466967_0085329 3300045976 Bacteria 2859
440 Ga0466967_0157353 3300045976 Bacteria 2130
441 Ga0466967_0199402 3300045976 Bacteria 1895
442 Ga0466967_0299261 3300045976 Bacteria 1547
443 Ga0466967_0319671 3300045976 Bacteria 1496
444 Ga0495603_0008162 3300046455 Bacteria 6328
445 Ga0495629_0102729 3300046459 Bacteria 1994
446 Ga0495653_0102292 3300046463 Bacteria 2074
447 Ga0495582_0031281 3300046473 Bacteria 2925
448 Ga0495584_0019023 3300046491 Bacteria 3488
449 Ga0495596_0080926 3300046500 Bacteria 1261
450 Ga0495656_0254325 3300046615 Bacteria 888
451 Ga0495635_0291241 3300046663 Bacteria 1095
452 Ga0495599_0052918 3300046678 Bacteria 2544
453 Ga0495624_0135200 3300046690 Bacteria 1511
454 Ga0495581_0130273 3300047315 Bacteria 1466
455 Ga0495674_0082680 3300047319 Bacteria 2753
456 Ga0495676_0177740 3300047321 Bacteria 1494
457 Ga0495680_0002178 3300047322 Bacteria 20273
458 Ga0496100_0003419 3300048903 Bacteria 8272
459 Ga0496100_0044934 3300048903 Bacteria 2832
460 Ga0496102_0000948 3300048905 Bacteria 27354
461 Ga0496102_0022559 3300048905 Bacteria 5578
462 Ga0496102_0103920 3300048905 Bacteria 2642
463 Ga0496102_0157036 3300048905 Bacteria 2138
464 Ga0496102_0299047 3300048905 Bacteria 1517
465 Ga0496102_0380773 3300048905 Bacteria 1328
466 Ga0496102_0511669 3300048905 Bacteria 1123
467 Ga0496103_0008990 3300048906 Bacteria 5919
468 Ga0496104_0000684 3300048907 Bacteria 29139
469 Ga0496104_0005793 3300048907 Bacteria 10816
470 Ga0496104_0009594 3300048907 Bacteria 8617
471 Ga0496104_0048450 3300048907 Bacteria 4006
472 Ga0496104_0049739 3300048907 Bacteria 3953
473 Ga0496104_0075394 3300048907 Bacteria 3212
474 Ga0496104_0424654 3300048907 Bacteria 1241
475 Ga0496105_0000092 3300048908 Bacteria 62726
476 Ga0496105_0018718 3300048908 Bacteria 5575
477 Ga0496105_0023408 3300048908 Bacteria 5009
478 Ga0496105_0064907 3300048908 Bacteria 3013
479 Ga0496105_0156151 3300048908 Bacteria 1874
480 Ga0496106_0002426 3300048909 Bacteria 13892
481 Ga0496106_0019850 3300048909 Bacteria 4983
482 Ga0496106_0053605 3300048909 Bacteria 3046
483 Ga0496107_0015104 3300048910 Bacteria 5410
484 Ga0496107_0273383 3300048910 Bacteria 1257
485 Ga0496108_0033167 3300048911 Bacteria 4289
486 Ga0496108_0035028 3300048911 Bacteria 4171
487 Ga0496108_0036871 3300048911 Bacteria 4070
488 Ga0496108_0055574 3300048911 Bacteria 3324
489 Ga0496108_0076665 3300048911 Bacteria 2826
490 Ga0496108_0198798 3300048911 Bacteria 1739
491 Ga0496109_0003844 3300048912 Bacteria 12543
492 Ga0496109_0006889 3300048912 Bacteria 9583
493 Ga0496109_0015073 3300048912 Bacteria 6728
494 Ga0496109_0020300 3300048912 Bacteria 5868
495 Ga0496109_0068621 3300048912 Bacteria 3249
496 Ga0496109_0103415 3300048912 Bacteria 2643
497 Ga0496109_0107358 3300048912 Bacteria 2593
498 Ga0496109_0181799 3300048912 Bacteria 1975
499 Ga0496109_0258972 3300048912 Bacteria 1638
500 Ga0496110_0000300 3300048913 Bacteria 32505
501 Ga0496110_0007963 3300048913 Bacteria 8488
502 Ga0496110_0017828 3300048913 Bacteria 5943
503 Ga0496110_0025788 3300048913 Bacteria 5025
504 Ga0496110_0030462 3300048913 Bacteria 4652
505 Ga0496110_0037421 3300048913 Bacteria 4217
506 Ga0496110_0106499 3300048913 Bacteria 2516
507 Ga0496110_0194619 3300048913 Bacteria 1841
508 Ga0496110_0480570 3300048913 Bacteria 1132
509 Ga0496111_0002965 3300048914 Bacteria 10397
510 Ga0496111_0006170 3300048914 Bacteria 7759
511 Ga0496111_0015097 3300048914 Bacteria 5293
512 Ga0496111_0029553 3300048914 Bacteria 3893
513 Ga0496111_0077280 3300048914 Bacteria 2427
514 Ga0496111_0097267 3300048914 Bacteria 2161
515 Ga0496111_0160576 3300048914 Bacteria 1668
516 Ga0496111_0249752 3300048914 Bacteria 1317
517 Ga0496112_0001247 3300048915 Bacteria 19238
518 Ga0496112_0005207 3300048915 Bacteria 11189
519 Ga0496112_0007968 3300048915 Bacteria 9447
520 Ga0496112_0075054 3300048915 Bacteria 3344
521 Ga0496112_0077087 3300048915 Bacteria 3296
522 Ga0496112_0092615 3300048915 Bacteria 2992
523 Ga0496112_0197003 3300048915 Bacteria 1975
524 Ga0496112_0220886 3300048915 Bacteria 1851
525 Ga0496113_0022429 3300048916 Bacteria 4466
526 Ga0496113_0051381 3300048916 Bacteria 3076
527 Ga0496113_0081142 3300048916 Bacteria 2485
528 Ga0496113_0109036 3300048916 Bacteria 2152
529 Ga0496113_0169274 3300048916 Bacteria 1730
530 Ga0496113_0209892 3300048916 Bacteria 1550
531 Ga0496113_0226129 3300048916 Bacteria 1492
532 Ga0496114_0002909 3300048917 Bacteria 13123
533 Ga0496114_0192299 3300048917 Bacteria 1786
534 Ga0496115_0001851 3300048918 Bacteria 15135
535 Ga0496115_0034641 3300048918 Bacteria 3990
536 Ga0501031_0068404 3300049568 Bacteria 2313
537 Ga0501031_0122531 3300049568 Bacteria 1698
538 Ga0501032_0036294 3300049569 Bacteria 3365
539 Ga0501032_0151405 3300049569 Bacteria 1525
540 Ga0501033_0073232 3300049570 Bacteria 2515
541 Ga0501033_0113980 3300049570 Bacteria 1965
542 Ga0501033_0141274 3300049570 Bacteria 1740
543 Ga0501034_0055837 3300049571 Bacteria 3974
544 Ga0501034_0105197 3300049571 Bacteria 2815
545 Ga0501034_0121249 3300049571 Bacteria 2601
546 Ga0501034_0152501 3300049571 Bacteria 2286
547 Ga0501034_0233010 3300049571 Bacteria 1790
548 Ga0501036_0014963 3300049572 Bacteria 6472
549 Ga0501036_0016970 3300049572 Bacteria 6083
550 Ga0501036_0031175 3300049572 Bacteria 4505
551 Ga0501036_0062296 3300049572 Bacteria 3159
552 Ga0501037_0040603 3300049573 Bacteria 3424
553 Ga0501038_0020677 3300049574 Bacteria 5916
554 Ga0501038_0140233 3300049574 Bacteria 1978
555 Ga0501038_0208454 3300049574 Bacteria 1565
556 Ga0501038_0228384 3300049574 Bacteria 1482
557 Ga0501039_0002782 3300049575 Bacteria 13062
558 Ga0501039_0045169 3300049575 Bacteria 3403
559 Ga0501039_0068684 3300049575 Bacteria 2751
560 Ga0501039_0077188 3300049575 Bacteria 2590
561 Ga0501040_0017994 3300049576 Bacteria 4691
562 Ga0501040_0020373 3300049576 Bacteria 4418
563 Ga0501040_0028689 3300049576 Bacteria 3752
564 Ga0501040_0053124 3300049576 Bacteria 2774
565 Ga0501040_0086972 3300049576 Bacteria 2170
566 Ga0501040_0184627 3300049576 Bacteria 1479
567 Ga0501041_0009626 3300049577 Bacteria 5696
568 Ga0501041_0017029 3300049577 Bacteria 4324
569 Ga0501041_0047525 3300049577 Bacteria 2613
570 Ga0501041_0104324 3300049577 Bacteria 1756
571 Ga0501041_0118213 3300049577 Bacteria 1646
572 Ga0501042_0013544 3300049578 Bacteria 5552
573 Ga0501042_0098599 3300049578 Bacteria 2101
574 Ga0501042_0278876 3300049578 Bacteria 1207
575 Ga0501042_0311785 3300049578 Bacteria 1137
576 Ga0501043_0022314 3300049579 Bacteria 4967
577 Ga0501043_0029767 3300049579 Bacteria 4291
578 Ga0501043_0047206 3300049579 Bacteria 3385
579 Ga0501043_0154063 3300049579 Bacteria 1798
580 Ga0501046_0006613 3300049580 Bacteria 10239
581 Ga0501046_0030273 3300049580 Bacteria 4394
582 Ga0501046_0182625 3300049580 Bacteria 1568
583 Ga0501047_0019136 3300049581 Bacteria 6568
584 Ga0501047_0025355 3300049581 Bacteria 5699
585 Ga0501047_0026769 3300049581 Bacteria 5551
586 Ga0501047_0261050 3300049581 Bacteria 1580
587 Ga0501048_0012745 3300049582 Bacteria 6251
588 Ga0501048_0137057 3300049582 Bacteria 1730
589 Ga0501048_0165374 3300049582 Bacteria 1566
590 Ga0501067_0006698 3300049583 Bacteria 6394
591 Ga0501067_0009065 3300049583 Bacteria 5510
592 Ga0501067_0068956 3300049583 Bacteria 1958
593 Ga0501067_0124118 3300049583 Bacteria 1437
594 Ga0501068_0030365 3300049584 Bacteria 3205
595 Ga0501068_0035264 3300049584 Bacteria 2985
596 Ga0501068_0079824 3300049584 Bacteria 2006
597 Ga0501068_0111538 3300049584 Bacteria 1701
598 Ga0501068_0212152 3300049584 Bacteria 1230
599 Ga0501069_0009805 3300049585 Bacteria 5063
600 Ga0501069_0011266 3300049585 Bacteria 4742
601 Ga0501069_0144430 3300049585 Bacteria 1366
602 Ga0501070_0016043 3300049586 Bacteria 6294
603 Ga0501070_0019594 3300049586 Bacteria 5672
604 Ga0501070_0036754 3300049586 Bacteria 4090
605 Ga0501070_0040154 3300049586 Bacteria 3902
606 Ga0501070_0488193 3300049586 Bacteria 990
607 Ga0501071_0000662 3300049587 Bacteria 17990
608 Ga0501071_0002358 3300049587 Bacteria 11428
609 Ga0501071_0023631 3300049587 Bacteria 4293
610 Ga0501071_0023999 3300049587 Bacteria 4263
611 Ga0501071_0043095 3300049587 Bacteria 3234
612 Ga0501072_0003648 3300049588 Bacteria 11591
613 Ga0501072_0023619 3300049588 Bacteria 4775
614 Ga0501072_0030418 3300049588 Bacteria 4223
615 Ga0501072_0037015 3300049588 Bacteria 3828
616 Ga0501072_0214614 3300049588 Bacteria 1533
617 Ga0501073_0074606 3300049589 Bacteria 2361
618 Ga0501073_0086723 3300049589 Bacteria 2177
619 Ga0501073_0104464 3300049589 Bacteria 1966
620 Ga0501074_0017623 3300049590 Bacteria 5186
621 Ga0501074_0027486 3300049590 Bacteria 4125
622 Ga0501074_0053759 3300049590 Bacteria 2904
623 Ga0501074_0065353 3300049590 Bacteria 2618
624 Ga0501074_0122327 3300049590 Bacteria 1861
625 Ga0501074_0170288 3300049590 Bacteria 1554
626 Ga0501074_0223636 3300049590 Bacteria 1340
627 Ga0501074_0234717 3300049590 Bacteria 1305
628 Ga0501075_0007274 3300049591 Bacteria 7675
629 Ga0501075_0019225 3300049591 Bacteria 4953
630 Ga0501075_0087980 3300049591 Bacteria 2354
631 Ga0501075_0129059 3300049591 Bacteria 1925
632 Ga0501075_0154079 3300049591 Bacteria 1752
633 Ga0501075_0237782 3300049591 Bacteria 1388
634 Ga0501076_0002743 3300049592 Bacteria 12198
635 Ga0501076_0013178 3300049592 Bacteria 6192
636 Ga0501076_0023692 3300049592 Bacteria 4735
637 Ga0501076_0032312 3300049592 Bacteria 4084
638 Ga0501076_0107456 3300049592 Bacteria 2253
639 Ga0501076_0237392 3300049592 Bacteria 1491
640 Ga0501076_0312719 3300049592 Bacteria 1288
641 Ga0501077_0006632 3300049593 Bacteria 7109
642 Ga0501077_0006780 3300049593 Bacteria 7043
643 Ga0501077_0009132 3300049593 Bacteria 6155
644 Ga0501079_0017002 3300049741 Bacteria 5555
645 Ga0501079_0037005 3300049741 Bacteria 3759
646 Ga0501079_0273766 3300049741 Bacteria 1320
647 Ga0501080_0001585 3300049742 Bacteria 19287
648 Ga0501080_0003647 3300049742 Bacteria 13590
649 Ga0501080_0195624 3300049742 Bacteria 1857
650 Ga0501080_0357705 3300049742 Bacteria 1317
651 Ga0501081_0018445 3300049743 Bacteria 4634
652 Ga0501081_0020389 3300049743 Bacteria 4418
653 Ga0501081_0119415 3300049743 Bacteria 1876
654 Ga0501081_0171850 3300049743 Bacteria 1565
655 Ga0501083_0019300 3300049744 Bacteria 4749
656 Ga0501083_0102483 3300049744 Bacteria 1887
657 Ga0501083_0138698 3300049744 Bacteria 1593
658 Ga0501035_0023132 3300049822 Bacteria 5702
659 Ga0501035_0035861 3300049822 Bacteria 4499
660 Ga0501035_0325841 3300049822 Bacteria 1290
661 Ga0501035_0418944 3300049822 Bacteria 1112
662 Ga0501044_0015863 3300049823 Bacteria 8107
663 Ga0501044_0100323 3300049823 Bacteria 2913
664 Ga0501044_0259369 3300049823 Bacteria 1677
665 Ga0501045_0000826 3300049824 Bacteria 20049
666 Ga0501045_0007410 3300049824 Bacteria 7626
667 Ga0501045_0040108 3300049824 Bacteria 3407
668 Ga0501045_0049873 3300049824 Bacteria 3053
669 Ga0501045_0070696 3300049824 Bacteria 2568
670 Ga0501045_0226385 3300049824 Bacteria 1392
671 Ga0501045_0293741 3300049824 Bacteria 1209
672 nmdc:mga03n38_53692_c1 3300050490 Bacteria 1808
673 nmdc:mga00v17_28900_c1 3300050491 Bacteria 3250
674 nmdc:mga05p37_102581_c1 3300050507 Bacteria 3523
675 nmdc:mga05p37_216157_c1 3300050507 Bacteria 2315
676 nmdc:mga05p37_2307_c1 3300050507 Bacteria 22250
677 nmdc:mga05p37_35336_c1 3300050507 Bacteria 6127
678 nmdc:mga09592_327809_c1 3300050508 Bacteria 1326
679 nmdc:mga09592_36687_c1 3300050508 Bacteria 4107
680 nmdc:mga09592_394765_c1 3300050508 Bacteria 1196
681 nmdc:mga0qj67_11928_c1 3300050509 Bacteria 6529
682 nmdc:mga06r32_245917_c1 3300050510 Bacteria 1776
683 nmdc:mga06r32_43354_c1 3300050510 Bacteria 4281
684 nmdc:mga06r32_722681_c1 3300050510 Bacteria 960
685 nmdc:mga08y16_111500_c1 3300050511 Bacteria 2848
686 nmdc:mga08y16_122638_c1 3300050511 Bacteria 2704
687 nmdc:mga08y16_12645_c1 3300050511 Bacteria 8879
688 nmdc:mga08y16_28661_c1 3300050511 Bacteria 5869
689 nmdc:mga08y16_394718_c1 3300050511 Bacteria 1417
690 nmdc:mga0n895_294090_c1 3300050512 Bacteria 1647
691 nmdc:mga0n895_301596_c1 3300050512 Bacteria 1624
692 nmdc:mga0n895_79172_c1 3300050512 Bacteria 3272
693 nmdc:mga0rr50_199460_c1 3300050513 Unclassified 1644
694 nmdc:mga08x19_1666_c1 3300050514 Bacteria 13702
695 nmdc:mga0a205_164395_c1 3300050515 Bacteria 2115
696 nmdc:mga0a205_183242_c1 3300050515 Bacteria 1987
697 nmdc:mga0a205_344467_c1 3300050515 Bacteria 1358
698 Ga0500616_0016268 3300053153 Bacteria 4238
699 Ga0501084_0004616 3300054114 Bacteria 11251
700 Ga0501084_0060064 3300054114 Bacteria 3183
701 Ga0501084_0069075 3300054114 Bacteria 2957
702 Ga0501084_0116900 3300054114 Bacteria 2242
703 Ga0501084_0213633 3300054114 Bacteria 1627
704 Ga0501084_0276081 3300054114 Bacteria 1419
705 Ga0501084_0411286 3300054114 Bacteria 1143
706 Ga0501084_0468837 3300054114 Bacteria 1064
707 Ga0587067_025044 3300059640 Bacteria 1059
708 Ga0501082_0006181 3300060353 Bacteria 10395
709 Ga0501082_0054752 3300060353 Bacteria 3438
710 Ga0501082_0076538 3300060353 Bacteria 2884
711 Ga0501082_0144555 3300060353 Bacteria 2064
712 Ga0501082_0461356 3300060353 Bacteria 1110
713 Ga0466962_0000137 3300061719 Bacteria 29795
714 Ga0530510_0004028 3300061734 Bacteria 10142
715 Ga0530510_0011723 3300061734 Bacteria 6152
716 Ga0530510_0031353 3300061734 Bacteria 3822
717 Ga0530510_0057919 3300061734 Bacteria 2800
718 Ga0530510_0092510 3300061734 Bacteria 2207
719 Ga0530510_0172527 3300061734 Bacteria 1602
720 Ga0530510_0407743 3300061734 Bacteria 1025
721 Ga0501077_0184288
722 ARSoilOldRDRAFT_c000959
723 JGI24743J22301_10005721
724 JGI25406J46586_10043356
725 JGI25407J50210_10031620
726 Ga0070658_10178794
727 Ga0070658_10507818
728 Ga0070676_10073342
729 Ga0070683_100001493
730 Ga0070683_100028334
731 Ga0070683_100029460
732 Ga0070683_100246842
733 Ga0070690_100031767
734 Ga0070670_100062090
735 Ga0070670_100277428
736 Ga0070677_10029819
737 Ga0070677_10148257
738 Ga0068869_100178694
739 Ga0070680_100115857
740 Ga0070680_100118448
741 Ga0070680_100122907
742 Ga0070680_100293600
743 Ga0070680_100302031
744 Ga0070682_100018714
745 Ga0070682_100106864
746 Ga0070682_100123772
747 Ga0070682_100351656
748 Ga0068868_100038323
749 Ga0068868_100038909
750 Ga0068868_100054625
751 Ga0068868_100111275
752 Ga0070660_100045058
753 Ga0070689_100107245
754 Ga0070689_100150877
755 Ga0070687_100127861
756 Ga0070687_100168722
757 Ga0070692_10127085
758 Ga0070668_100082126
759 Ga0070668_100091164
760 Ga0070668_100120517
761 Ga0070669_100280944
762 Ga0070675_100117232
763 Ga0070675_100335190
764 Ga0070675_100514663
765 Ga0070671_100052773
766 Ga0070674_100033145
767 Ga0070674_100074124
768 Ga0070673_100006162
769 Ga0070673_100224726
770 Ga0070688_100011519
771 Ga0070688_100159872
772 Ga0070659_100052551
773 Ga0070659_100069559
774 Ga0070659_100155658
775 Ga0070714_100012074
776 Ga0070714_100092822
777 Ga0070713_100165635
778 Ga0070701_10017912
779 Ga0070701_10348961
780 Ga0070700_100010938
781 Ga0070700_100042424
782 Ga0070700_100137088
783 Ga0070708_100372239
784 Ga0070663_100018107
785 Ga0070663_100095024
786 Ga0070678_100010432
787 Ga0070678_100033777
788 Ga0070678_100190422
789 Ga0070678_100447780
790 Ga0070662_100022130
791 Ga0070662_100167353
792 Ga0070681_10006222
793 Ga0068867_100109385
794 Ga0068867_100168857
795 Ga0070685_10088929
796 Ga0070685_10107281
797 Ga0070685_10222812
798 Ga0070698_100008294
799 Ga0070699_100056831
800 Ga0070679_100017052
801 Ga0070679_100363798
802 Ga0070684_100001828
803 Ga0070684_100002599
804 Ga0070684_100005993
805 Ga0070684_100074231
806 Ga0070672_100202233
807 Ga0070672_100224211
808 Ga0070686_100021001
809 Ga0070686_100058321
810 Ga0070695_100147344
811 Ga0070696_100064512
812 Ga0070665_100042390
813 Ga0070665_100122012
814 Ga0070665_100370921
815 Ga0070665_100650692
816 Ga0070704_100061700
817 Ga0068855_100023620
818 Ga0068855_100201461
819 Ga0070664_100085565
820 Ga0070664_100196166
821 Ga0068854_100360833
822 Ga0068856_100025670
823 Ga0068856_100036986
824 Ga0068856_100047024
825 Ga0068856_100457806
826 Ga0068852_100056511
827 Ga0068852_100332503
828 Ga0068859_100078851
829 Ga0068864_100055928
830 Ga0068861_100183253
831 Ga0068870_10008714
832 Ga0068863_100024916
833 Ga0068860_100095885
834 Ga0068862_100070674
835 Ga0081455_10012398
836 Ga0081455_10018034
837 Ga0081455_10067112
838 Ga0081538_10006328
839 Ga0081538_10010294
840 Ga0081538_10039057
841 Ga0081540_1026013
842 Ga0081539_10009582
843 Ga0075365_10067474
844 Ga0075363_100116716
845 Ga0070712_100008925
846 Ga0097621_100021719
847 Ga0097621_100626766
848 Ga0075428_100002185
849 Ga0075428_100192667
850 Ga0075428_100489665
851 Ga0075430_100009439
852 Ga0075430_100105500
853 Ga0075431_100001646
854 Ga0075431_100002443
855 Ga0075434_100103161
856 Ga0075434_100630544
857 Ga0075429_100002100
858 Ga0075429_100023063
859 Ga0075429_100348411
860 Ga0068865_100013327
861 Ga0068865_100045852
862 Ga0075436_100011932
863 Ga0075436_100410560
864 Ga0097620_100078850
865 Ga0075435_100107900
866 Ga0075435_100117282
867 Ga0105244_10069256
868 Ga0105240_10017276
869 Ga0111539_10017709
870 Ga0111539_10092216
871 Ga0111539_10111591
872 Ga0111539_10156589
873 Ga0111539_10324243
874 Ga0111539_10561002
875 Ga0105245_10117227
876 Ga0105245_10117882
877 Ga0105245_10201442
878 Ga0105245_10248468
879 Ga0105245_10251750
880 Ga0105245_10277258
881 Ga0105247_10014387
882 Ga0114129_10001686
883 Ga0114129_10237468
884 Ga0114129_10258478
885 Ga0114129_10294990
886 Ga0114129_10344010
887 Ga0114129_10390913
888 Ga0105243_10042888
889 Ga0105243_10070264
890 Ga0105243_10188985
891 Ga0105243_10243349
892 Ga0105243_10356111
893 Ga0105241_10131389
894 Ga0105242_10033991
895 Ga0105242_10122255
896 Ga0105242_10296543
897 Ga0105248_10146312
898 Ga0105248_10156943
899 Ga0105237_10120910
900 Ga0105238_10381826
901 Ga0105239_10065955
902 Ga0105239_10131197
903 Ga0105239_10305547
904 Ga0105239_10515329
905 Ga0105246_10187214
906 Ga0157371_10218141
907 Ga0157370_10020071
908 Ga0157370_10055576
909 Ga0157369_10006152
910 Ga0157369_10312077
911 Ga0157374_10148423
912 Ga0157374_10378573
913 Ga0157378_10035810
914 Ga0157378_10119693
915 Ga0157378_10170167
916 Ga0163162_10047253
917 Ga0163162_10168818
918 Ga0163162_10171636
919 Ga0163162_10240628
920 Ga0157372_10108683
921 Ga0157372_10148241
922 Ga0157375_10073543
923 Ga0157375_10081920
924 Ga0157375_10390649
925 Ga0163163_10101967
926 Ga0163163_10380062
927 Ga0157380_10030261
928 Ga0157380_10040748
929 Ga0157380_10057221
930 Ga0157380_10315489
931 Ga0182008_10022405
932 Ga0182008_10151247
933 Ga0157377_10019041
934 Ga0157377_10052068
935 Ga0157377_10100653
936 Ga0157379_10133028
937 Ga0157379_10165838
938 Ga0157376_10049604
939 Ga0157376_10194948
940 Ga0157376_10267892
941 Ga0182006_1011323
942 Ga0163161_10040732
943 Ga0163161_10082710
944 Ga0206353_12049292
945 Ga0207682_10144777
946 Ga0207688_10007669
947 Ga0207688_10020357
948 Ga0207688_10051578
949 Ga0207688_10133378
950 Ga0207699_10021874
951 Ga0207645_10027749
952 Ga0207645_10054545
953 Ga0207643_10005820
954 Ga0207643_10013690
955 Ga0207643_10024615
956 Ga0207705_10015808
957 Ga0207705_10053995
958 Ga0207654_10103501
959 Ga0207707_10109391
960 Ga0207707_10173280
961 Ga0207707_10506583
962 Ga0207695_10094400
963 Ga0207695_10229580
964 Ga0207671_10059293
965 Ga0207693_10020136
966 Ga0207693_10057599
967 Ga0207660_10081155
968 Ga0207660_10283580
969 Ga0207662_10072367
970 Ga0207662_10117854
971 Ga0207662_10273471
972 Ga0207657_10011358
973 Ga0207657_10071447
974 Ga0207657_10074904
975 Ga0207649_10078557
976 Ga0207649_10422516
977 Ga0207681_10092747
978 Ga0207681_10168080
979 Ga0207694_10099640
980 Ga0207694_10242313
981 Ga0207650_10031411
982 Ga0207650_10295638
983 Ga0207659_10063179
984 Ga0207659_10238512
985 Ga0207659_10336291
986 Ga0207659_10384186
987 Ga0207659_10420459
988 Ga0207700_10000004
989 Ga0207700_10234491
990 Ga0207664_10076086
991 Ga0207644_10055917
992 Ga0207644_10073209
993 Ga0207644_10083236
994 Ga0207690_10017868
995 Ga0207690_10161712
996 Ga0207706_10028577
997 Ga0207706_10053866
998 Ga0207706_10059449
999 Ga0207686_10043680
1000 Ga0207686_10072036
1001 Ga0207709_10016182
1002 Ga0207709_10093202
1003 Ga0207709_10235114
1004 Ga0207669_10054312
1005 Ga0207669_10181980
1006 Ga0207704_10122895
1007 Ga0207704_10144247
1008 Ga0207704_10338260
1009 Ga0207665_10001415
1010 Ga0207691_10031904
1011 Ga0207711_10017513
1012 Ga0207689_10030459
1013 Ga0207689_10186943
1014 Ga0207661_10000830
1015 Ga0207661_10015200
1016 Ga0207661_10058132
1017 Ga0207661_10099993
1018 Ga0207661_10102571
1019 Ga0207661_10127962
1020 Ga0207661_10405389
1021 Ga0207679_10057854
1022 Ga0207679_10512585
1023 Ga0207667_10047740
1024 Ga0207651_10046909
1025 Ga0207651_10098403
1026 Ga0207712_10362895
1027 Ga0207668_10127039
1028 Ga0207640_10319203
1029 Ga0207677_10074193
1030 Ga0207677_10112220
1031 Ga0207677_10123056
1032 Ga0207677_10335922
1033 Ga0207678_10037045
1034 Ga0207678_10182727
1035 Ga0207678_10423276
1036 Ga0207708_10008710
1037 Ga0207708_10021745
1038 Ga0207708_10026560
1039 Ga0207708_10049966
1040 Ga0207708_10102716
1041 Ga0207702_10410671
1042 Ga0207641_10682006
1043 Ga0207648_10016664
1044 Ga0207648_10018398
1045 Ga0207648_10259731
1046 Ga0207648_10269287
1047 Ga0207648_10448731
1048 Ga0207676_10177446
1049 Ga0207674_10081884
1050 Ga0207674_10223781
1051 Ga0207674_10255988
1052 Ga0207675_100327944
1053 Ga0207675_100410243
1054 Ga0207683_10049796
1055 Ga0207683_10081371
1056 Ga0207683_10084208
1057 Ga0207698_10036431
1058 Ga0207428_10001958
1059 Ga0207428_10007998
1060 Ga0207428_10012951
1061 Ga0207428_10072742
1062 Ga0207428_10104287
1063 Ga0207428_10123147
1064 Ga0207428_10242050
1065 Ga0268266_10179222
1066 Ga0268266_10292488
1067 Ga0268266_10551775
1068 Ga0268265_10286320
1069 Ga0268264_10072359
1070 Ga0268264_10498545
1071 Ga0307406_10142203
1072 Ga0307409_100180160
1073 Ga0307409_100212065
1074 Ga0307416_100287564
1075 Ga0307411_10052984
1076 Ga0307411_10201747
1077 Ga0307415_100114497
1078 Ga0373930_0013583
1079 Ga0373959_0002542
1080 Ga0373951_0025234
1081 Ga0373939_0055276
1082 Ga0373942_0051956
1083 Ga0373931_0016146
1084 Ga0373937_0033124
1085 Ga0395899_0006283
1086 Ga0395899_0008666
1087 Ga0395899_0024063
1088 Ga0395899_0025192
1089 Ga0395899_0031452
1090 Ga0395899_0104977
1091 Ga0395899_0270167
1092 Ga0395900_0003989
1093 Ga0395900_0016655
1094 Ga0395900_0034018
1095 Ga0395898_0001313
1096 Ga0395898_0005422
1097 Ga0395898_0025399
1098 Ga0395898_0052708
1099 Ga0395898_0257669
1100 Ga0395898_0421363
1101 Ga0395898_0642029
1102 Ga0395905_0004251
1103 Ga0395905_0009184
1104 Ga0395905_0109105
1105 Ga0395905_0486643
1106 Ga0395901_0003431
1107 Ga0395901_0004078
1108 Ga0395901_0014847
1109 Ga0395901_0017794
1110 Ga0395901_0135424
1111 Ga0395901_0151415
1112 Ga0395901_0271413
1113 Ga0395901_0428789
1114 Ga0450900_009651
1115 Ga0450906_002799
1116 Ga0439464_0086192
1117 Ga0466965_0162744
1118 Ga0466966_0051691
1119 Ga0466966_0112573
1120 Ga0466961_0005553
1121 Ga0466963_0000389
1122 Ga0466963_0000536
1123 Ga0466963_0000987
1124 Ga0466963_0011636
1125 Ga0466963_0026853
1126 Ga0466963_0051243
1127 Ga0466963_0106434
1128 Ga0466963_0144874
1129 Ga0466963_0334249
1130 Ga0466964_0040462
1131 Ga0466964_0047336
1132 Ga0466971_0001779
1133 Ga0466971_0051313
1134 Ga0466968_0038929
1135 Ga0466970_0036693
1136 Ga0466970_0245096
1137 Ga0466957_0000947
1138 Ga0466957_0059499
1139 Ga0466957_0083480
1140 Ga0466957_0214742
1141 Ga0466960_0027962
1142 Ga0466959_0039146
1143 Ga0466959_0099302
1144 Ga0466959_0301836
1145 Ga0466958_0000863
1146 Ga0466958_0006156
1147 Ga0466958_0011524
1148 Ga0466958_0113430
1149 Ga0466958_0144742
1150 Ga0466967_0001125
1151 Ga0466967_0018651
1152 Ga0466967_0020982
1153 Ga0466967_0025020
1154 Ga0466967_0028436
1155 Ga0466967_0036772
1156 Ga0466967_0037605
1157 Ga0466967_0048356
1158 Ga0466967_0067595
1159 Ga0466967_0085329
1160 Ga0466967_0157353
1161 Ga0466967_0199402
1162 Ga0466967_0299261
1163 Ga0466967_0319671
1164 Ga0495603_0008162
1165 Ga0495629_0102729
1166 Ga0495653_0102292
1167 Ga0495582_0031281
1168 Ga0495584_0019023
1169 Ga0495596_0080926
1170 Ga0495656_0254325
1171 Ga0495635_0291241
1172 Ga0495599_0052918
1173 Ga0495624_0135200
1174 Ga0495581_0130273
1175 Ga0495674_0082680
1176 Ga0495676_0177740
1177 Ga0495680_0002178
1178 Ga0496100_0003419
1179 Ga0496100_0044934
1180 Ga0496102_0000948
1181 Ga0496102_0022559
1182 Ga0496102_0103920
1183 Ga0496102_0157036
1184 Ga0496102_0299047
1185 Ga0496102_0380773
1186 Ga0496102_0511669
1187 Ga0496103_0008990
1188 Ga0496104_0000684
1189 Ga0496104_0005793
1190 Ga0496104_0009594
1191 Ga0496104_0048450
1192 Ga0496104_0049739
1193 Ga0496104_0075394
1194 Ga0496104_0424654
1195 Ga0496105_0000092
1196 Ga0496105_0018718
1197 Ga0496105_0023408
1198 Ga0496105_0064907
1199 Ga0496105_0156151
1200 Ga0496106_0002426
1201 Ga0496106_0019850
1202 Ga0496106_0053605
1203 Ga0496107_0015104
1204 Ga0496107_0273383
1205 Ga0496108_0033167
1206 Ga0496108_0035028
1207 Ga0496108_0036871
1208 Ga0496108_0055574
1209 Ga0496108_0076665
1210 Ga0496108_0198798
1211 Ga0496109_0003844
1212 Ga0496109_0006889
1213 Ga0496109_0015073
1214 Ga0496109_0020300
1215 Ga0496109_0068621
1216 Ga0496109_0103415
1217 Ga0496109_0107358
1218 Ga0496109_0181799
1219 Ga0496109_0258972
1220 Ga0496110_0000300
1221 Ga0496110_0007963
1222 Ga0496110_0017828
1223 Ga0496110_0025788
1224 Ga0496110_0030462
1225 Ga0496110_0037421
1226 Ga0496110_0106499
1227 Ga0496110_0194619
1228 Ga0496110_0480570
1229 Ga0496111_0002965
1230 Ga0496111_0006170
1231 Ga0496111_0015097
1232 Ga0496111_0029553
1233 Ga0496111_0077280
1234 Ga0496111_0097267
1235 Ga0496111_0160576
1236 Ga0496111_0249752
1237 Ga0496112_0001247
1238 Ga0496112_0005207
1239 Ga0496112_0007968
1240 Ga0496112_0075054
1241 Ga0496112_0077087
1242 Ga0496112_0092615
1243 Ga0496112_0197003
1244 Ga0496112_0220886
1245 Ga0496113_0022429
1246 Ga0496113_0051381
1247 Ga0496113_0081142
1248 Ga0496113_0109036
1249 Ga0496113_0169274
1250 Ga0496113_0209892
1251 Ga0496113_0226129
1252 Ga0496114_0002909
1253 Ga0496114_0192299
1254 Ga0496115_0001851
1255 Ga0496115_0034641
1256 Ga0501031_0068404
1257 Ga0501031_0122531
1258 Ga0501032_0036294
1259 Ga0501032_0151405
1260 Ga0501033_0073232
1261 Ga0501033_0113980
1262 Ga0501033_0141274
1263 Ga0501034_0055837
1264 Ga0501034_0105197
1265 Ga0501034_0121249
1266 Ga0501034_0152501
1267 Ga0501034_0233010
1268 Ga0501036_0014963
1269 Ga0501036_0016970
1270 Ga0501036_0031175
1271 Ga0501036_0062296
1272 Ga0501037_0040603
1273 Ga0501038_0020677
1274 Ga0501038_0140233
1275 Ga0501038_0208454
1276 Ga0501038_0228384
1277 Ga0501039_0002782
1278 Ga0501039_0045169
1279 Ga0501039_0068684
1280 Ga0501039_0077188
1281 Ga0501040_0017994
1282 Ga0501040_0020373
1283 Ga0501040_0028689
1284 Ga0501040_0053124
1285 Ga0501040_0086972
1286 Ga0501040_0184627
1287 Ga0501041_0009626
1288 Ga0501041_0017029
1289 Ga0501041_0047525
1290 Ga0501041_0104324
1291 Ga0501041_0118213
1292 Ga0501042_0013544
1293 Ga0501042_0098599
1294 Ga0501042_0278876
1295 Ga0501042_0311785
1296 Ga0501043_0022314
1297 Ga0501043_0029767
1298 Ga0501043_0047206
1299 Ga0501043_0154063
1300 Ga0501046_0006613
1301 Ga0501046_0030273
1302 Ga0501046_0182625
1303 Ga0501047_0019136
1304 Ga0501047_0025355
1305 Ga0501047_0026769
1306 Ga0501047_0261050
1307 Ga0501048_0012745
1308 Ga0501048_0137057
1309 Ga0501048_0165374
1310 Ga0501067_0006698
1311 Ga0501067_0009065
1312 Ga0501067_0068956
1313 Ga0501067_0124118
1314 Ga0501068_0030365
1315 Ga0501068_0035264
1316 Ga0501068_0079824
1317 Ga0501068_0111538
1318 Ga0501068_0212152
1319 Ga0501069_0009805
1320 Ga0501069_0011266
1321 Ga0501069_0144430
1322 Ga0501070_0016043
1323 Ga0501070_0019594
1324 Ga0501070_0036754
1325 Ga0501070_0040154
1326 Ga0501070_0488193
1327 Ga0501071_0000662
1328 Ga0501071_0002358
1329 Ga0501071_0023631
1330 Ga0501071_0023999
1331 Ga0501071_0043095
1332 Ga0501072_0003648
1333 Ga0501072_0023619
1334 Ga0501072_0030418
1335 Ga0501072_0037015
1336 Ga0501072_0214614
1337 Ga0501073_0074606
1338 Ga0501073_0086723
1339 Ga0501073_0104464
1340 Ga0501074_0017623
1341 Ga0501074_0027486
1342 Ga0501074_0053759
1343 Ga0501074_0065353
1344 Ga0501074_0122327
1345 Ga0501074_0170288
1346 Ga0501074_0223636
1347 Ga0501074_0234717
1348 Ga0501075_0007274
1349 Ga0501075_0019225
1350 Ga0501075_0087980
1351 Ga0501075_0129059
1352 Ga0501075_0154079
1353 Ga0501075_0237782
1354 Ga0501076_0002743
1355 Ga0501076_0013178
1356 Ga0501076_0023692
1357 Ga0501076_0032312
1358 Ga0501076_0107456
1359 Ga0501076_0237392
1360 Ga0501076_0312719
1361 Ga0501077_0006632
1362 Ga0501077_0006780
1363 Ga0501077_0009132
1364 Ga0501079_0017002
1365 Ga0501079_0037005
1366 Ga0501079_0273766
1367 Ga0501080_0001585
1368 Ga0501080_0003647
1369 Ga0501080_0195624
1370 Ga0501080_0357705
1371 Ga0501081_0018445
1372 Ga0501081_0020389
1373 Ga0501081_0119415
1374 Ga0501081_0171850
1375 Ga0501083_0019300
1376 Ga0501083_0102483
1377 Ga0501083_0138698
1378 Ga0501035_0023132
1379 Ga0501035_0035861
1380 Ga0501035_0325841
1381 Ga0501035_0418944
1382 Ga0501044_0015863
1383 Ga0501044_0100323
1384 Ga0501044_0259369
1385 Ga0501045_0000826
1386 Ga0501045_0007410
1387 Ga0501045_0040108
1388 Ga0501045_0049873
1389 Ga0501045_0070696
1390 Ga0501045_0226385
1391 Ga0501045_0293741
1392 nmdc:mga03n38_53692_c1
1393 nmdc:mga00v17_28900_c1
1394 nmdc:mga05p37_102581_c1
1395 nmdc:mga05p37_216157_c1
1396 nmdc:mga05p37_2307_c1
1397 nmdc:mga05p37_35336_c1
1398 nmdc:mga09592_327809_c1
1399 nmdc:mga09592_36687_c1
1400 nmdc:mga09592_394765_c1
1401 nmdc:mga0qj67_11928_c1
1402 nmdc:mga06r32_245917_c1
1403 nmdc:mga06r32_43354_c1
1404 nmdc:mga06r32_722681_c1
1405 nmdc:mga08y16_111500_c1
1406 nmdc:mga08y16_122638_c1
1407 nmdc:mga08y16_12645_c1
1408 nmdc:mga08y16_28661_c1
1409 nmdc:mga08y16_394718_c1
1410 nmdc:mga0n895_294090_c1
1411 nmdc:mga0n895_301596_c1
1412 nmdc:mga0n895_79172_c1
1413 nmdc:mga0rr50_199460_c1
1414 nmdc:mga08x19_1666_c1
1415 nmdc:mga0a205_164395_c1
1416 nmdc:mga0a205_183242_c1
1417 nmdc:mga0a205_344467_c1
1418 Ga0500616_0016268
1419 Ga0501084_0004616
1420 Ga0501084_0060064
1421 Ga0501084_0069075
1422 Ga0501084_0116900
1423 Ga0501084_0213633
1424 Ga0501084_0276081
1425 Ga0501084_0411286
1426 Ga0501084_0468837
1427 Ga0587067_025044
1428 Ga0501082_0006181
1429 Ga0501082_0054752
1430 Ga0501082_0076538
1431 Ga0501082_0144555
1432 Ga0501082_0461356
1433 Ga0466962_0000137
1434 Ga0530510_0004028
1435 Ga0530510_0011723
1436 Ga0530510_0031353
1437 Ga0530510_0057919
1438 Ga0530510_0092510
1439 Ga0530510_0172527
1440 Ga0530510_0407743

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

292

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8765 6 279
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8503 6 279
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.829 6 277
2onk-assembly2.cif.gz_I abc transporter modbc in complex with its binding protein moda 0.8241 8 279
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8228 6 279
ID Description Score Start End Superfamily
af_P0AFK4_1_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8958 20 277 1.10.3720.10
af_Q2G2B0_2_264_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8818 11 272 1.10.3720.10
af_P77156_29_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8783 13 279 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8695 19 283 1.10.3720.10
af_P31135_29_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8654 13 277 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6J4MWX8-F1-model_v4 Putrescine transport system permease protein PotH 0.9646 11 281 GO:0005886
GO:0055085
AF-A0A538GNX0-F1-model_v4 ABC transporter permease 0.9606 21 272 GO:0005886
GO:0055085
AF-A0A4P7GR72-F1-model_v4 ABC transporter permease 0.9587 21 281 GO:0005886
GO:0055085
AF-A0A5C4WPV2-F1-model_v4 ABC transporter permease 0.9546 6 281 GO:0005886
GO:0055085
AF-A0A6J7GI68-F1-model_v4 Unannotated protein 0.9545 5 284 GO:0005886
GO:0055085

Map