F477296

General Info

Members Datasets Scaffolds Average Seq Length
720 527 527 144

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10344932|Ga0105240_103449322
Length 164
Sequence LNNDTRTQRTQAEGPEADLVKAADMLIARRADTRARADFATWKMMAKLNGSSALPPEAQEFLASYKNLLARMSEGEATEATIGAIYRAYYAEMGGAGAPPDVRPRPAEPAADNVTAFRRPAPKPKTTSFFRAGTAAGAQKRPLPVALIFACLVVVYVGIRLYWR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
16 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
22 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
23 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
24 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
25 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
26 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
27 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
28 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
29 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
30 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
31 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
32 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
33 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
34 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
35 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
36 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
37 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
38 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
39 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
40 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
41 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
42 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
43 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
44 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
45 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
46 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
47 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
48 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
49 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
50 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
51 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
52 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
53 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
54 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
58 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
61 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
62 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
63 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
64 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
67 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
68 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
69 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
70 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
71 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
72 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
73 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
74 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
75 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
76 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
77 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
78 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
79 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
80 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
81 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
82 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
83 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
84 2904699407
85 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
86 2906610324
87 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
88 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
89 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
90 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
91 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
92 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
93 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
94 2922368715
95 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
96 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
97 2922425934
98 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
99 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
100 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
101 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
102 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
103 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
104 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
105 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
106 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
107 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
108 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
109 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
110 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
111 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
112 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
113 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
114 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
115 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
116 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
117 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
118 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
119 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
120 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
121 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
122 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
123 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
124 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
125 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
126 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
127 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
128 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
129 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
130 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
131 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
132 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
135 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
136 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
137 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
138 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
139 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
140 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
141 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
142 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
143 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
144 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
145 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
146 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
147 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
148 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
149 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
150 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
151 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
152 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
153 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
154 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
155 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
156 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
157 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
158 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
159 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
160 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
161 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
162 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
163 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
164 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
165 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
166 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
167 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
168 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
169 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
170 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
171 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
172 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
173 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
174 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
175 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
176 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
177 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
178 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
179 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
184 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
185 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
186 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
187 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
188 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
189 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
190 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
193 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
194 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
195 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
196 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
197 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
198 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
199 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
200 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
201 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
202 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
203 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
204 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
205 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
206 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
207 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
208 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
209 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
210 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
211 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
212 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
213 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
214 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
215 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
216 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
217 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
218 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
219 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
220 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
221 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
222 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
223 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
224 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
225 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
226 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
227 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
228 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
229 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
230 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
231 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
232 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
233 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
234 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
235 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
236 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
237 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
238 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
239 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
240 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
241 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
242 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
243 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
244 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
245 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
246 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
247 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
249 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
251 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
253 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
255 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
298 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
299 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
300 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
301 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
302 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
305 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
306 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
307 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
308 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
309 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
310 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
312 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
313 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
314 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
315 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
316 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
317 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
318 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
319 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
320 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
321 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
323 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
324 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
325 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
326 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
327 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
328 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
329 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
330 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
331 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
334 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
335 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
336 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
337 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
338 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
339 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
340 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
341 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
344 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
345 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
346 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
349 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
350 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
351 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
352 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
353 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
354 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
359 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
360 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
365 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
366 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
370 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
371 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
372 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
375 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
376 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
377 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
378 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
379 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
380 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
381 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
382 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
383 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
384 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
385 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
386 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
387 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
388 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
389 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
390 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
391 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
392 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
393 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
394 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
395 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
396 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
397 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
398 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
399 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
402 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
403 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
404 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
405 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
406 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
407 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
408 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
409 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
410 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
424 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
425 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
426 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
427 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
428 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
429 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
436 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
437 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
438 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
439 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
440 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
441 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
442 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
443 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
444 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
445 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
446 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
447 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
448 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
452 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
456 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
457 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
458 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
459 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
460 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
461 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
462 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
463 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
464 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
465 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
466 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
467 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
468 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
469 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
470 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
471 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
472 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
473 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
474 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
475 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
476 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
477 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
478 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
479 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
480 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
481 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
482 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
483 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
484 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
485 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
486 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
487 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
488 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
489 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
492 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
493 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
494 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
495 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
496 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
497 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
498 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
499 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
500 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
501 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
502 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
503 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
504 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
505 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
506 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
507 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
508 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
509 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
510 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
511 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
512 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
513 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
514 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
515 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
516 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
517 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
518 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
519 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
520 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
521 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
522 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
523 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
524 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
525 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
526 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
527 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.6
Metatranscriptomes 0
Isolates 26.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.44
Nodule 21.67
Rhizoplane 5.83
Rhizosphere 48.06
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10033689 3300002075 Bacteria 1044
2 JGI25406J46586_10027537 3300003203 Bacteria 2178
3 JGI25153J46596_10006767 3300003215 Bacteria 5748
4 JGI25153J46596_10007604 3300003215 Bacteria 5298
5 JGI25153J46596_10017021 3300003215 Bacteria 2883
6 rootH1_10156318 3300003323 Bacteria 4443
7 JGI25160J50197_1000838 3300003354 Bacteria 16394
8 JGI25160J50197_1008227 3300003354 Bacteria 3992
9 JGI25404J52841_10000065 3300003659 Bacteria 9238
10 JGI25404J52841_10035617 3300003659 Bacteria 1060
11 JGI25404J52841_10070111 3300003659 Bacteria 732
12 Ga0055526_1026655 3300003771 Bacteria 1813
13 Ga0055531_10003336 3300003794 Bacteria 10275
14 Ga0055543_1004059 3300004625 Bacteria 4101
15 Ga0065165_1000433 3300005262 Bacteria 65855
16 Ga0065165_1001403 3300005262 Bacteria 26300
17 Ga0065165_1012388 3300005262 Bacteria 3476
18 Ga0065165_1014587 3300005262 Bacteria 3042
19 Ga0070658_10027089 3300005327 Bacteria 4601
20 Ga0070658_10069245 3300005327 Bacteria 2886
21 Ga0070683_100073360 3300005329 Bacteria 3196
22 Ga0070680_100053675 3300005336 Bacteria 3290
23 Ga0070682_100077523 3300005337 Bacteria 2142
24 Ga0068868_100097012 3300005338 Bacteria 2381
25 Ga0070660_100031993 3300005339 Bacteria 3955
26 Ga0070660_100041483 3300005339 Bacteria 3508
27 Ga0070660_100134022 3300005339 Bacteria 1984
28 Ga0070661_100097630 3300005344 Bacteria 2181
29 Ga0070661_100641667 3300005344 Bacteria 861
30 Ga0070668_100107890 3300005347 Bacteria 2213
31 Ga0070671_100074258 3300005355 Bacteria 2841
32 Ga0070688_100298749 3300005365 Bacteria 1163
33 Ga0070659_100093925 3300005366 Bacteria 2408
34 Ga0070659_100408761 3300005366 Bacteria 1147
35 Ga0070667_100471664 3300005367 Bacteria 1148
36 Ga0070713_100007867 3300005436 Bacteria 7521
37 Ga0070711_100129585 3300005439 Bacteria 1877
38 Ga0070711_100837580 3300005439 Bacteria 782
39 Ga0070663_100039008 3300005455 Bacteria 3317
40 Ga0070663_100167997 3300005455 Bacteria 1693
41 Ga0070662_100181854 3300005457 Bacteria 1658
42 Ga0070681_10119178 3300005458 Bacteria 2575
43 Ga0070698_100375669 3300005471 Bacteria 1354
44 Ga0070679_100099935 3300005530 Bacteria 2888
45 Ga0070684_100100507 3300005535 Bacteria 2583
46 Ga0068853_100124457 3300005539 Bacteria 2302
47 Ga0068853_101038498 3300005539 Bacteria 789
48 Ga0070693_100668544 3300005547 Bacteria 757
49 Ga0070693_100818806 3300005547 Bacteria 691
50 Ga0068855_100141606 3300005563 Bacteria 2741
51 Ga0070664_100118025 3300005564 Bacteria 2321
52 Ga0068857_100125500 3300005577 Bacteria 2313
53 Ga0068857_100134918 3300005577 Bacteria 2228
54 Ga0068857_100637998 3300005577 Bacteria 1009
55 Ga0068854_100317239 3300005578 Bacteria 1266
56 Ga0068856_100078138 3300005614 Bacteria 3280
57 Ga0068856_100144594 3300005614 Bacteria 2385
58 Ga0068856_100323756 3300005614 Bacteria 1559
59 Ga0068852_100042366 3300005616 Bacteria 3854
60 Ga0068852_100675539 3300005616 Bacteria 1042
61 Ga0068859_100548327 3300005617 Bacteria 1251
62 Ga0068864_100236840 3300005618 Bacteria 1690
63 Ga0068864_101158453 3300005618 Bacteria 771
64 Ga0068851_10001206 3300005834 Bacteria 11224
65 Ga0068851_10271276 3300005834 Bacteria 967
66 Ga0068863_100760239 3300005841 Bacteria 965
67 Ga0068862_100044071 3300005844 Bacteria 3805
68 Ga0081455_10113250 3300005937 Bacteria 2152
69 Ga0081455_10173033 3300005937 Bacteria 1643
70 Ga0081540_1000933 3300005983 Bacteria 26285
71 Ga0081540_1001807 3300005983 Bacteria 17952
72 Ga0081540_1036527 3300005983 Bacteria 2618
73 Ga0081540_1175932 3300005983 Bacteria 808
74 Ga0081540_1294309 3300005983 Bacteria 558
75 Ga0081539_10070243 3300005985 Bacteria 1881
76 Ga0070717_10009668 3300006028 Bacteria 7259
77 Ga0070717_10324065 3300006028 Bacteria 1373
78 Ga0070717_10662249 3300006028 Bacteria 948
79 Ga0075365_10082796 3300006038 Bacteria 2176
80 Ga0075365_10236724 3300006038 Bacteria 1282
81 Ga0075368_10011258 3300006042 Bacteria 3252
82 Ga0075363_100008538 3300006048 Bacteria 4776
83 Ga0075364_10025855 3300006051 Bacteria 3740
84 Ga0070712_100312124 3300006175 Bacteria 1276
85 Ga0075362_10150872 3300006177 Bacteria 1115
86 Ga0075369_10035187 3300006186 Bacteria 2128
87 Ga0075366_10017707 3300006195 Bacteria 4105
88 Ga0075370_10086135 3300006353 Bacteria 1809
89 Ga0097620_100548300 3300006931 Bacteria 1251
90 Ga0099824_1004403 3300006942 Bacteria 20285
91 Ga0099822_1018335 3300006943 Bacteria 7305
92 Ga0075435_100133489 3300007076 Bacteria 2078
93 Ga0099795_10085811 3300007788 Bacteria 1212
94 Ga0105240_10091680 3300009093 Bacteria 3712
95 Ga0105240_10344932 3300009093 Bacteria 1691
96 Ga0105245_10382301 3300009098 Bacteria 1402
97 Ga0105245_11133332 3300009098 Bacteria 829
98 Ga0105245_11315059 3300009098 Bacteria 772
99 Ga0105247_10015105 3300009101 Bacteria 4632
100 Ga0105247_10026105 3300009101 Bacteria 3526
101 Ga0105247_10321883 3300009101 Bacteria 1079
102 Ga0105243_10092125 3300009148 Bacteria 2498
103 Ga0105241_10114692 3300009174 Bacteria 2162
104 Ga0105241_10461147 3300009174 Bacteria 1126
105 Ga0105242_10814091 3300009176 Bacteria 926
106 Ga0105248_11703461 3300009177 Bacteria 715
107 Ga0105237_10092617 3300009545 Bacteria 3012
108 Ga0105237_10106584 3300009545 Bacteria 2794
109 Ga0105237_10110754 3300009545 Bacteria 2737
110 Ga0105237_10536162 3300009545 Bacteria 1177
111 Ga0105237_10609342 3300009545 Bacteria 1099
112 Ga0105238_10085798 3300009551 Bacteria 3136
113 Ga0105238_10385424 3300009551 Bacteria 1393
114 Ga0105249_10125042 3300009553 Bacteria 2448
115 Ga0105249_10438646 3300009553 Bacteria 1343
116 Ga0105239_10106865 3300010375 Bacteria 3100
117 Ga0105239_10133896 3300010375 Bacteria 2758
118 Ga0105239_10140030 3300010375 Bacteria 2695
119 Ga0105246_10080849 3300011119 Bacteria 2315
120 Ga0157373_10221206 3300013100 Bacteria 1336
121 Ga0157370_10079915 3300013104 Bacteria 3079
122 Ga0157370_11134274 3300013104 Bacteria 706
123 Ga0157369_10185397 3300013105 Bacteria 2188
124 Ga0157369_10206150 3300013105 Bacteria 2062
125 Ga0157374_10061400 3300013296 Bacteria 3520
126 Ga0163162_10026189 3300013306 Bacteria 5764
127 Ga0163162_10061803 3300013306 Bacteria 3784
128 Ga0163162_10583675 3300013306 Bacteria 1244
129 Ga0157375_10556350 3300013308 Bacteria 1308
130 Ga0163163_10055860 3300014325 Bacteria 3903
131 Ga0163163_10106415 3300014325 Bacteria 2831
132 Ga0163163_12138590 3300014325 Bacteria 619
133 Ga0182005_1108875 3300015265 Bacteria 782
134 Ga0163161_10377745 3300017792 Bacteria 1132
135 Ga0214544_1000002 3300021320 Bacteria 753857
136 Ga0214542_1000001 3300021321 Bacteria 1018696
137 Ga0214545_1000001 3300021324 Bacteria 1092817
138 Ga0214543_1000001 3300021327 Bacteria 776921
139 Ga0209563_103642 3300025230 Bacteria 3132
140 Ga0209233_1008601 3300025261 Bacteria 3146
141 Ga0209233_1017922 3300025261 Bacteria 1918
142 Ga0209564_1018244 3300025295 Bacteria 2685
143 Ga0209564_1019751 3300025295 Bacteria 2504
144 Ga0209758_1000024 3300025297 Bacteria 591966
145 Ga0209758_1001768 3300025297 Bacteria 23963
146 Ga0209758_1004050 3300025297 Bacteria 12628
147 Ga0209758_1007646 3300025297 Bacteria 7287
148 Ga0209758_1114340 3300025297 Bacteria 740
149 Ga0209256_1004722 3300025299 Bacteria 8339
150 Ga0207426_1001107 3300025302 Bacteria 24820
151 Ga0207426_1026026 3300025302 Bacteria 1964
152 Ga0207426_1073848 3300025302 Bacteria 943
153 Ga0209051_1045422 3300025303 Bacteria 1520
154 Ga0209257_1002662 3300025304 Bacteria 17148
155 Ga0209257_1026314 3300025304 Bacteria 1964
156 Ga0207697_10023685 3300025315 Bacteria 2513
157 Ga0207710_10017418 3300025900 Bacteria 3047
158 Ga0207710_10019985 3300025900 Bacteria 2861
159 Ga0207710_10347636 3300025900 Bacteria 755
160 Ga0207688_10155218 3300025901 Bacteria 1354
161 Ga0207647_10134992 3300025904 Bacteria 1448
162 Ga0207654_10024818 3300025911 Bacteria 3227
163 Ga0207707_10003260 3300025912 Bacteria 14418
164 Ga0207707_10003603 3300025912 Bacteria 13734
165 Ga0207695_10297720 3300025913 Bacteria 1505
166 Ga0207671_10057777 3300025914 Bacteria 2876
167 Ga0207671_10139839 3300025914 Bacteria 1865
168 Ga0207671_10540347 3300025914 Bacteria 929
169 Ga0207671_10727029 3300025914 Bacteria 789
170 Ga0207693_10312729 3300025915 Bacteria 1230
171 Ga0207663_11217728 3300025916 Bacteria 606
172 Ga0207660_10342879 3300025917 Bacteria 1196
173 Ga0207657_10012009 3300025919 Bacteria 8567
174 Ga0207657_10028720 3300025919 Bacteria 5070
175 Ga0207657_10440883 3300025919 Bacteria 1022
176 Ga0207649_10122236 3300025920 Bacteria 1757
177 Ga0207649_10489587 3300025920 Bacteria 934
178 Ga0207652_10001857 3300025921 Bacteria 18344
179 Ga0207652_10095685 3300025921 Bacteria 2616
180 Ga0207681_10115332 3300025923 Bacteria 1961
181 Ga0207694_10039124 3300025924 Bacteria 3648
182 Ga0207694_10089000 3300025924 Bacteria 2434
183 Ga0207694_10537791 3300025924 Unclassified 980
184 Ga0207687_10456483 3300025927 Bacteria 1060
185 Ga0207700_10004870 3300025928 Bacteria 7972
186 Ga0207644_10044200 3300025931 Bacteria 3163
187 Ga0207644_10309457 3300025931 Bacteria 1275
188 Ga0207690_11095315 3300025932 Bacteria 664
189 Ga0207706_10382150 3300025933 Bacteria 1222
190 Ga0207709_10204047 3300025935 Bacteria 1414
191 Ga0207670_10110368 3300025936 Bacteria 1981
192 Ga0207665_10509451 3300025939 Bacteria 930
193 Ga0207691_10418103 3300025940 Bacteria 1143
194 Ga0207689_10406078 3300025942 Bacteria 1136
195 Ga0207661_10344465 3300025944 Bacteria 1343
196 Ga0207661_10426213 3300025944 Bacteria 1205
197 Ga0207679_10372264 3300025945 Bacteria 1250
198 Ga0207667_10060027 3300025949 Bacteria 3981
199 Ga0207667_10071162 3300025949 Bacteria 3617
200 Ga0207712_10355910 3300025961 Bacteria 1218
201 Ga0207668_10136632 3300025972 Bacteria 1879
202 Ga0207658_10160833 3300025986 Bacteria 1840
203 Ga0207677_10108081 3300026023 Bacteria 2064
204 Ga0207703_10666056 3300026035 Bacteria 988
205 Ga0207703_10795917 3300026035 Bacteria 902
206 Ga0207639_10083772 3300026041 Bacteria 2531
207 Ga0207639_10218351 3300026041 Bacteria 1645
208 Ga0207639_10230211 3300026041 Bacteria 1606
209 Ga0207678_10060133 3300026067 Bacteria 3268
210 Ga0207678_10177249 3300026067 Bacteria 1820
211 Ga0207678_10358115 3300026067 Bacteria 1259
212 Ga0207702_10083112 3300026078 Bacteria 2785
213 Ga0207702_10462088 3300026078 Bacteria 1233
214 Ga0207641_10509322 3300026088 Bacteria 1170
215 Ga0207676_10967045 3300026095 Bacteria 838
216 Ga0207674_10132679 3300026116 Bacteria 2453
217 Ga0207674_10640442 3300026116 Bacteria 1026
218 Ga0207683_10266888 3300026121 Bacteria 1563
219 Ga0207698_10033713 3300026142 Bacteria 3724
220 Ga0207698_10089235 3300026142 Bacteria 2517
221 Ga0209389_1000040 3300027296 Bacteria 124256
222 Ga0209389_1000123 3300027296 Bacteria 70041
223 Ga0209589_1000001 3300027357 Bacteria 794224
224 Ga0209589_1000036 3300027357 Bacteria 131278
225 Ga0209489_100001 3300027361 Bacteria 794224
226 Ga0209489_100006 3300027361 Bacteria 475698
227 Ga0209700_100001 3300027363 Bacteria 794224
228 Ga0209700_100005 3300027363 Bacteria 573969
229 Ga0209813_10020077 3300027866 Bacteria 1865
230 Ga0209813_10163541 3300027866 Bacteria 804
231 Ga0268266_10325522 3300028379 Bacteria 1439
232 Ga0268266_10727465 3300028379 Bacteria 957
233 Ga0268265_10081543 3300028380 Bacteria 2555
234 Ga0307413_10089201 3300031824 Bacteria 2003
235 Ga0307411_10532155 3300032005 Bacteria 999
236 Ga0307510_10014440 3300033180 Bacteria 9345
237 Ga0315911_1000006 3300033442 Bacteria 414563
238 Ga0373928_0125782 3300035084 Bacteria 691
239 Ga0373944_0005698 3300035089 Bacteria 3286
240 Ga0373923_0025408 3300035111 Bacteria 2347
241 Ga0373923_0116466 3300035111 Bacteria 1190
242 Ga0373936_0056776 3300035113 Bacteria 1591
243 Ga0373939_0449670 3300035114 Bacteria 542
244 Ga0373945_0005196 3300035116 Bacteria 4160
245 Ga0373953_0036564 3300035117 Bacteria 1934
246 Ga0373953_0341077 3300035117 Bacteria 656
247 Ga0373954_0023809 3300035118 Bacteria 2788
248 Ga0373956_0026692 3300035119 Bacteria 2503
249 Ga0373956_0036543 3300035119 Bacteria 2168
250 Ga0373957_0010704 3300035120 Bacteria 3040
251 Ga0373946_0130335 3300035171 Bacteria 1156
252 Ga0373946_0550163 3300035171 Bacteria 595
253 Ga0373955_0028931 3300035172 Bacteria 2877
254 Ga0373924_0061782 3300035410 Bacteria 1568
255 Ga0373935_0200449 3300035692 Bacteria 1379
256 Ga0373935_0586417 3300035692 Bacteria 814
257 Ga0373933_0179705 3300035724 Bacteria 1349
258 Ga0373947_0207066 3300035725 Bacteria 1285
259 Ga0373937_0128498 3300036401 Bacteria 2365
260 Ga0373937_0187021 3300036401 Bacteria 1945
261 Ga0373925_0126944 3300037068 Bacteria 1985
262 Ga0395899_0302526 3300037312 Bacteria 1082
263 Ga0395900_0071844 3300037418 Bacteria 3558
264 Ga0395900_1364142 3300037418 Bacteria 622
265 Ga0395898_0046725 3300037466 Bacteria 4252
266 Ga0395898_0126168 3300037466 Bacteria 2452
267 Ga0395905_0001756 3300037471 Bacteria 25281
268 Ga0395905_0047688 3300037471 Bacteria 4014
269 Ga0395901_0602443 3300038443 Bacteria 1108
270 Ga0395901_0836117 3300038443 Bacteria 907
271 Ga0451791_1893118 3300041451 Bacteria 827
272 Ga0451807_2629163 3300041486 Bacteria 943
273 Ga0451835_0477346 3300041492 Bacteria 905
274 Ga0451839_1247905 3300041496 Bacteria 603
275 Ga0451849_1494901 3300041505 Bacteria 1113
276 Ga0451853_1471601 3300041512 Bacteria 2693
277 Ga0439431_0094488 3300041997 Bacteria 817
278 Ga0439445_0136920 3300042004 Bacteria 709
279 Ga0466972_0000122 3300044658 Bacteria 65679
280 Ga0466965_0063626 3300044683 Bacteria 1846
281 Ga0466965_0168149 3300044683 Bacteria 1152
282 Ga0466965_0535224 3300044683 Bacteria 660
283 Ga0466964_0217288 3300044706 Bacteria 926
284 Ga0466964_0858726 3300044706 Bacteria 517
285 Ga0466957_0896358 3300044842 Bacteria 634
286 Ga0466967_0656202 3300045976 Bacteria 1038
287 Ga0495592_0088121 3300046454 Bacteria 2231
288 Ga0495592_0270697 3300046454 Bacteria 1115
289 Ga0495603_0113041 3300046455 Bacteria 1583
290 Ga0495603_0524214 3300046455 Bacteria 679
291 Ga0495590_0077096 3300046457 Bacteria 1173
292 Ga0495638_0006220 3300046460 Bacteria 8715
293 Ga0495651_0064755 3300046462 Bacteria 2793
294 Ga0495653_0090036 3300046463 Bacteria 2246
295 Ga0495653_0665908 3300046463 Bacteria 635
296 Ga0495650_0230755 3300046471 Bacteria 635
297 Ga0495605_0083378 3300046474 Bacteria 1492
298 Ga0495639_0230408 3300046475 Bacteria 912
299 Ga0495639_0271372 3300046475 Bacteria 842
300 Ga0495662_0031332 3300046476 Bacteria 2569
301 Ga0495664_0014962 3300046477 Bacteria 4405
302 Ga0495664_0256880 3300046477 Bacteria 1056
303 Ga0495585_0098238 3300046492 Bacteria 1569
304 Ga0495594_0039280 3300046499 Bacteria 2588
305 Ga0495596_0099878 3300046500 Bacteria 1127
306 Ga0495596_0105587 3300046500 Bacteria 1094
307 Ga0495583_0422553 3300046506 Bacteria 523
308 Ga0495606_0115424 3300046507 Bacteria 1614
309 Ga0495606_0174122 3300046507 Bacteria 1246
310 Ga0495606_0196577 3300046507 Bacteria 1152
311 Ga0495608_0055907 3300046511 Bacteria 2607
312 Ga0495610_0056970 3300046512 Bacteria 1877
313 Ga0495610_0101021 3300046512 Bacteria 1292
314 Ga0495618_0033162 3300046514 Bacteria 3237
315 Ga0495618_0062804 3300046514 Bacteria 2357
316 Ga0495628_0050841 3300046516 Bacteria 3278
317 Ga0495628_0066723 3300046516 Bacteria 2812
318 Ga0495628_0499106 3300046516 Bacteria 879
319 Ga0495630_0084762 3300046517 Bacteria 2392
320 Ga0495631_0077768 3300046518 Bacteria 1432
321 Ga0495631_0129012 3300046518 Bacteria 1087
322 Ga0495632_0029344 3300046519 Bacteria 2865
323 Ga0495632_0258233 3300046519 Bacteria 780
324 Ga0495643_0005870 3300046522 Bacteria 8212
325 Ga0495643_0138246 3300046522 Bacteria 1217
326 Ga0495648_0057102 3300046524 Bacteria 2344
327 Ga0495648_0090173 3300046524 Bacteria 1719
328 Ga0495652_0109203 3300046529 Bacteria 2227
329 Ga0495652_0174994 3300046529 Bacteria 1653
330 Ga0495665_0021744 3300046531 Bacteria 3450
331 Ga0495640_0013662 3300046533 Bacteria 6171
332 Ga0495640_0095043 3300046533 Bacteria 1962
333 Ga0495586_0113104 3300046535 Bacteria 1512
334 Ga0495587_0074078 3300046536 Bacteria 1977
335 Ga0495587_0359559 3300046536 Bacteria 811
336 Ga0495609_0141239 3300046538 Bacteria 1028
337 Ga0495645_0021210 3300046543 Bacteria 4695
338 Ga0495622_0086519 3300046557 Bacteria 1441
339 Ga0495667_0007037 3300046559 Bacteria 7634
340 Ga0495656_0121423 3300046615 Bacteria 1234
341 Ga0495668_0030154 3300046616 Bacteria 3064
342 Ga0495668_0115543 3300046616 Bacteria 1468
343 Ga0495668_0144289 3300046616 Bacteria 1303
344 Ga0495634_0267809 3300046642 Bacteria 1040
345 Ga0495611_0040090 3300046648 Bacteria 2087
346 Ga0495611_0086149 3300046648 Bacteria 1449
347 Ga0495625_0035331 3300046660 Bacteria 3685
348 Ga0495635_0048856 3300046663 Bacteria 2916
349 Ga0495661_0110974 3300046665 Bacteria 1529
350 Ga0495661_0179489 3300046665 Bacteria 1123
351 Ga0495588_0160594 3300046674 Bacteria 1189
352 Ga0495657_0714684 3300046675 Bacteria 575
353 Ga0495599_0044339 3300046678 Bacteria 2789
354 Ga0495623_0042610 3300046679 Bacteria 2891
355 Ga0495646_0031778 3300046680 Bacteria 3288
356 Ga0495646_0065546 3300046680 Bacteria 2150
357 Ga0495658_0506004 3300046683 Bacteria 773
358 Ga0495669_0147151 3300046684 Bacteria 1114
359 Ga0495671_0044078 3300046692 Bacteria 2238
360 Ga0495660_0195233 3300046810 Bacteria 970
361 Ga0495581_0024060 3300047315 Bacteria 3529
362 Ga0495581_0103342 3300047315 Bacteria 1656
363 Ga0495604_0017963 3300047317 Bacteria 5659
364 Ga0495604_0253469 3300047317 Bacteria 1199
365 Ga0495674_0017800 3300047319 Bacteria 6616
366 Ga0495674_0197401 3300047319 Bacteria 1670
367 Ga0495674_0240474 3300047319 Bacteria 1492
368 Ga0495674_0410543 3300047319 Bacteria 1092
369 Ga0495676_0053391 3300047321 Bacteria 3221
370 Ga0495680_0072319 3300047322 Bacteria 2623
371 Ga0495687_011356 3300047443 Bacteria 4798
372 Ga0495687_090350 3300047443 Bacteria 1174
373 Ga0495675_0058341 3300047444 Bacteria 2447
374 Ga0495675_0570834 3300047444 Bacteria 644
375 Ga0495673_0211121 3300047469 Bacteria 722
376 Ga0495681_0193137 3300047470 Bacteria 830
377 Ga0495684_0066747 3300047471 Bacteria 2735
378 Ga0495686_0019599 3300047472 Bacteria 4520
379 Ga0495686_0096280 3300047472 Bacteria 1792
380 Ga0495686_0103351 3300047472 Bacteria 1716
381 Ga0495686_0680715 3300047472 Bacteria 526
382 Ga0495593_0004557 3300047673 Bacteria 8236
383 Ga0495602_0058117 3300048088 Bacteria 3388
384 Ga0495602_0600538 3300048088 Bacteria 757
385 Ga0495626_0148163 3300048091 Bacteria 991
386 Ga0495626_0245795 3300048091 Bacteria 719
387 Ga0496100_0160095 3300048903 Bacteria 1613
388 Ga0496100_0202830 3300048903 Bacteria 1446
389 Ga0496100_0237340 3300048903 Bacteria 1344
390 Ga0496101_0040220 3300048904 Bacteria 3330
391 Ga0496101_0137064 3300048904 Bacteria 1863
392 Ga0496101_0149953 3300048904 Bacteria 1783
393 Ga0496102_0065738 3300048905 Bacteria 3324
394 Ga0496102_0122301 3300048905 Bacteria 2431
395 Ga0496102_0139125 3300048905 Bacteria 2276
396 Ga0496104_0007469 3300048907 Bacteria 9661
397 Ga0496104_0108918 3300048907 Bacteria 2655
398 Ga0496105_0028038 3300048908 Bacteria 4605
399 Ga0496105_0041046 3300048908 Bacteria 3814
400 Ga0496105_0073134 3300048908 Bacteria 2832
401 Ga0496105_0512593 3300048908 Bacteria 940
402 Ga0496106_0111610 3300048909 Bacteria 2129
403 Ga0496107_0085584 3300048910 Bacteria 2300
404 Ga0496108_0013623 3300048911 Bacteria 6639
405 Ga0496108_0179760 3300048911 Bacteria 1832
406 Ga0496108_0998654 3300048911 Bacteria 715
407 Ga0496109_0036450 3300048912 Bacteria 4439
408 Ga0496109_0077439 3300048912 Bacteria 3060
409 Ga0496109_0277031 3300048912 Bacteria 1581
410 Ga0496109_0714287 3300048912 Bacteria 940
411 Ga0496110_0047316 3300048913 Bacteria 3766
412 Ga0496110_0048248 3300048913 Bacteria 3733
413 Ga0496110_0069938 3300048913 Bacteria 3109
414 Ga0496111_0370636 3300048914 Bacteria 1059
415 Ga0496111_0499899 3300048914 Bacteria 895
416 Ga0496112_0015856 3300048915 Bacteria 7042
417 Ga0496112_0035695 3300048915 Bacteria 4845
418 Ga0496112_0244486 3300048915 Bacteria 1746
419 Ga0496113_0034546 3300048916 Bacteria 3689
420 Ga0496113_0058559 3300048916 Bacteria 2899
421 Ga0496113_0075542 3300048916 Bacteria 2572
422 Ga0496113_0536033 3300048916 Bacteria 939
423 Ga0496114_0043573 3300048917 Bacteria 3721
424 Ga0496114_0453155 3300048917 Bacteria 1136
425 Ga0496115_0230094 3300048918 Bacteria 1529
426 Ga0496116_0082110 3300048919 Bacteria 1995
427 Ga0496117_0051706 3300048920 Bacteria 2902
428 Ga0496117_0300584 3300048920 Bacteria 850
429 Ga0496118_0033666 3300048921 Bacteria 4199
430 Ga0496118_0055688 3300048921 Bacteria 2981
431 Ga0496119_0056073 3300048922 Bacteria 2389
432 Ga0496119_0068253 3300048922 Bacteria 2094
433 Ga0496120_0018899 3300048923 Bacteria 4427
434 Ga0496120_0334003 3300048923 Bacteria 685
435 Ga0496121_0022110 3300048924 Bacteria 6188
436 Ga0496121_0055482 3300048924 Bacteria 3300
437 Ga0496121_0067329 3300048924 Bacteria 2903
438 Ga0496121_0235008 3300048924 Bacteria 1281
439 Ga0496121_0363026 3300048924 Bacteria 961
440 Ga0496121_0457168 3300048924 Bacteria 821
441 Ga0496125_0125900 3300048928 Bacteria 1816
442 Ga0501031_0100876 3300049568 Bacteria 1883
443 Ga0501031_0332633 3300049568 Bacteria 983
444 Ga0501032_0037191 3300049569 Bacteria 3319
445 Ga0501034_0728315 3300049571 Bacteria 888
446 Ga0501036_0437130 3300049572 Bacteria 1090
447 Ga0501046_0080505 3300049580 Bacteria 2517
448 Ga0501046_0648392 3300049580 Bacteria 747
449 Ga0501067_0332818 3300049583 Unclassified 846
450 Ga0501070_0596772 3300049586 Bacteria 880
451 Ga0501074_0052198 3300049590 Bacteria 2952
452 Ga0501080_0074727 3300049742 Bacteria 3152
453 Ga0501080_0130977 3300049742 Bacteria 2322
454 Ga0501044_0376152 3300049823 Bacteria 1336
455 nmdc:mga03n38_188376_c1 3300050490 Bacteria 1061
456 nmdc:mga00v17_61809_c1 3300050491 Bacteria 2303
457 nmdc:mga0yw44_101435_c1 3300050492 Bacteria 1834
458 nmdc:mga0yw44_129668_c1 3300050492 Bacteria 1631
459 nmdc:mga0yw44_177714_c1 3300050492 Bacteria 1400
460 nmdc:mga0k408_36783_c1 3300050493 Bacteria 2810
461 nmdc:mga06z11_28852_c1 3300050494 Bacteria 2667
462 nmdc:mga04h51_189442_c1 3300050495 Bacteria 804
463 nmdc:mga04h51_22672_c1 3300050495 Bacteria 1903
464 nmdc:mga07m45_454666_c1 3300050496 Bacteria 742
465 nmdc:mga07m45_8643_c1 3300050496 Bacteria 5244
466 nmdc:mga0n895_70689_c1 3300050512 Bacteria 3459
467 nmdc:mga0rr50_518172_c1 3300050513 Bacteria 1014
468 nmdc:mga0sz30_174023_c1 3300050516 Bacteria 954
469 nmdc:mga0sz30_55658_c1 3300050516 Bacteria 1684
470 Ga0495601_0021200 3300053077 Bacteria 3978
471 Ga0495601_0065495 3300053077 Bacteria 2313
472 Ga0495601_0073139 3300053077 Bacteria 2191
473 Ga0495612_0014786 3300053078 Bacteria 3132
474 Ga0500635_0100518 3300053080 Bacteria 1063
475 Ga0495595_0232064 3300053084 Bacteria 922
476 Ga0495595_0242977 3300053084 Bacteria 901
477 Ga0495619_0067470 3300053085 Bacteria 2389
478 Ga0500578_0059588 3300053086 Bacteria 2439
479 Ga0500578_0543686 3300053086 Bacteria 647
480 Ga0500643_000035 3300053087 Bacteria 184794
481 Ga0500583_0041239 3300053092 Bacteria 2095
482 Ga0500651_0233519 3300053093 Bacteria 1075
483 Ga0500651_0338794 3300053093 Bacteria 855
484 Ga0500651_0595285 3300053093 Bacteria 600
485 Ga0500566_0001359 3300053094 Bacteria 14314
486 Ga0500566_0338991 3300053094 Bacteria 693
487 Ga0500640_075214 3300053095 Bacteria 1442
488 Ga0500555_012606 3300053103 Bacteria 2434
489 Ga0500556_0023338 3300053104 Bacteria 2019
490 Ga0500557_000004 3300053105 Bacteria 202318
491 Ga0500569_006323 3300053109 Bacteria 2597
492 Ga0500569_143764 3300053109 Bacteria 803
493 Ga0500572_000619 3300053111 Bacteria 11919
494 Ga0500572_042027 3300053111 Bacteria 1330
495 Ga0500592_019082 3300053116 Bacteria 1101
496 Ga0500607_034406 3300053121 Bacteria 2774
497 Ga0500608_096171 3300053122 Bacteria 1377
498 Ga0500614_068093 3300053123 Bacteria 971
499 Ga0500626_168656 3300053128 Bacteria 893
500 Ga0500642_0000133 3300053130 Bacteria 33202
501 Ga0500642_0003332 3300053130 Bacteria 4841
502 Ga0500652_030127 3300053131 Bacteria 2121
503 Ga0500658_0067266 3300053134 Bacteria 1504
504 Ga0500559_0000143 3300053136 Bacteria 55572
505 Ga0500559_0098772 3300053136 Bacteria 1343
506 Ga0500568_0028188 3300053139 Bacteria 2342
507 Ga0500585_220876 3300053144 Bacteria 619
508 Ga0500588_0182140 3300053146 Bacteria 772
509 Ga0500589_105608 3300053147 Bacteria 1217
510 Ga0500603_100822 3300053150 Bacteria 858
511 Ga0500616_0041758 3300053153 Bacteria 2459
512 Ga0500619_026514 3300053154 Bacteria 1726
513 Ga0500620_042237 3300053155 Bacteria 1501
514 Ga0500622_0005064 3300053156 Bacteria 8022
515 Ga0500624_051945 3300053157 Bacteria 765
516 Ga0500627_0189762 3300053158 Bacteria 923
517 Ga0500639_091338 3300053163 Bacteria 1516
518 Ga0500639_138471 3300053163 Bacteria 1142
519 Ga0500636_0005675 3300053177 Bacteria 7136
520 Ga0500576_021443 3300053725 Bacteria 2949
521 Ga0500625_008128 3300053729 Bacteria 4609
522 Ga0500645_032606 3300053730 Bacteria 1561
523 Ga0500596_012989 3300053735 Bacteria 1259
524 Ga0500596_052729 3300053735 Bacteria 668
525 Ga0500599_000373 3300053736 Bacteria 4512
526 Ga0500601_000171 3300053737 Bacteria 13465
527 Ga0500661_009767 3300055283 Bacteria 1752

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0714684 Ga0495657_0714684_188_544 116
2 3300049568 Ga0501031_0332633 Ga0501031_0332633_604_963 116
3 3300005339 Ga0070660_100134022 Ga0070660_1001340221 124
4 3300005344 Ga0070661_100641667 Ga0070661_1006416671 124
5 3300005365 Ga0070688_100298749 Ga0070688_1002987491 124
6 3300005439 Ga0070711_100129585 Ga0070711_1001295852 124
7 3300005547 Ga0070693_100668544 Ga0070693_1006685441 124
8 3300005614 Ga0068856_100323756 Ga0068856_1003237562 124
9 3300005841 Ga0068863_100760239 Ga0068863_1007602392 124
10 3300009174 Ga0105241_10461147 Ga0105241_104611472 124
11 3300009553 Ga0105249_10438646 Ga0105249_104386462 124
12 3300010375 Ga0105239_10106865 Ga0105239_101068652 124
13 3300013306 Ga0163162_10061803 Ga0163162_100618033 124
14 3300025919 Ga0207657_10440883 Ga0207657_104408832 124
15 3300025931 Ga0207644_10309457 Ga0207644_103094572 124
16 3300025936 Ga0207670_10110368 Ga0207670_101103682 124
17 3300025961 Ga0207712_10355910 Ga0207712_103559102 124
18 3300026078 Ga0207702_10462088 Ga0207702_104620881 124
19 3300035084 Ga0373928_0125782 Ga0373928_0125782_32_613 124
20 3300048903 Ga0496100_0237340 Ga0496100_0237340_11_592 124
21 3300048904 Ga0496101_0137064 Ga0496101_0137064_454_1035 124
22 3300048905 Ga0496102_0139125 Ga0496102_0139125_1258_1839 124
23 3300048907 Ga0496104_0007469 Ga0496104_0007469_1841_2422 124
24 3300048908 Ga0496105_0041046 Ga0496105_0041046_2133_2714 124
25 3300048911 Ga0496108_0013623 Ga0496108_0013623_2385_2966 124
26 3300048912 Ga0496109_0036450 Ga0496109_0036450_1233_1814 124
27 3300048913 Ga0496110_0048248 Ga0496110_0048248_2219_2800 124
28 3300048915 Ga0496112_0035695 Ga0496112_0035695_3020_3601 124
29 3300048916 Ga0496113_0075542 Ga0496113_0075542_1443_2024 124
30 3300048917 Ga0496114_0453155 Ga0496114_0453155_244_825 124
31 3300009551 Ga0105238_10385424 Ga0105238_103854242 126
32 3300025924 Ga0207694_10537791 Ga0207694_105377912 126
33 3300038443 Ga0395901_0602443 Ga0395901_0602443_298_780 126
34 3300003203 JGI25406J46586_10027537 JGI25406J46586_100275372 130
35 3300047470 Ga0495681_0193137 Ga0495681_0193137_372_809 130
36 3300009098 Ga0105245_11133332 Ga0105245_111333322 131
37 3300046516 Ga0495628_0499106 Ga0495628_0499106_100_504 133
38 3300046529 Ga0495652_0174994 Ga0495652_0174994_1172_1576 133
39 3300047317 Ga0495604_0253469 Ga0495604_0253469_206_610 133
40 3300047319 Ga0495674_0410543 Ga0495674_0410543_322_726 133
41 3300053077 Ga0495601_0065495 Ga0495601_0065495_1885_2289 133
42 3300053084 Ga0495595_0242977 Ga0495595_0242977_282_692 133
43 3300053093 Ga0500651_0595285 Ga0500651_0595285_126_548 133
44 3300053109 Ga0500569_006323 Ga0500569_006323_73_495 133
45 3300009101 Ga0105247_10026105 Ga0105247_100261052 134
46 3300035171 Ga0373946_0130335 Ga0373946_0130335_353_757 134
47 3300035725 Ga0373947_0207066 Ga0373947_0207066_591_995 134
48 3300044706 Ga0466964_0858726 Ga0466964_0858726_83_487 134
49 3300044842 Ga0466957_0896358 Ga0466957_0896358_36_440 134
50 3300046455 Ga0495603_0113041 Ga0495603_0113041_976_1380 134
51 3300046500 Ga0495596_0099878 Ga0495596_0099878_438_842 134
52 3300046506 Ga0495583_0422553 Ga0495583_0422553_92_496 134
53 3300046518 Ga0495631_0129012 Ga0495631_0129012_27_431 134
54 3300046615 Ga0495656_0121423 Ga0495656_0121423_283_687 134
55 3300046616 Ga0495668_0115543 Ga0495668_0115543_602_1006 134
56 3300047315 Ga0495581_0103342 Ga0495581_0103342_556_960 134
57 3300048088 Ga0495602_0600538 Ga0495602_0600538_180_590 134
58 3300049568 Ga0501031_0100876 Ga0501031_0100876_297_710 134
59 3300049569 Ga0501032_0037191 Ga0501032_0037191_1903_2316 134
60 3300049571 Ga0501034_0728315 Ga0501034_0728315_141_554 134
61 3300049572 Ga0501036_0437130 Ga0501036_0437130_101_514 134
62 3300049580 Ga0501046_0080505 Ga0501046_0080505_1383_1862 134
63 3300049583 Ga0501067_0332818 Ga0501067_0332818_252_731 134
64 3300049742 Ga0501080_0130977 Ga0501080_0130977_199_678 134
65 3300053111 Ga0500572_000619 Ga0500572_000619_5646_6050 134
66 3300053136 Ga0500559_0000143 Ga0500559_0000143_1043_1447 134
67 3300053163 Ga0500639_091338 Ga0500639_091338_525_929 134
68 3300053725 Ga0500576_021443 Ga0500576_021443_867_1271 134
69 3300053735 Ga0500596_012989 Ga0500596_012989_225_629 134
70 iso_pu_bacteria 2513237096 2513657101 135
71 iso_pu_bacteria 2513237137 2513855543 135
72 iso_pu_bacteria 2513237145 2513918841 135
73 iso_pu_bacteria 2517572143 2517892088 135
74 iso_pu_bacteria 2524023228 2524534172 135
75 iso_pu_bacteria 2667528175 2671121874 135
76 iso_pu_bacteria 2791355197 2793068827 135
77 iso_pu_bacteria 2903748898 2903753398 135
78 iso_pu_bacteria 2935630451 2935631225 135
79 iso_pu_bacteria 3005474847 3005480521 135
80 iso_pu_bacteria 8006933436 8006940255 135
81 3300003354 JGI25160J50197_1008227 JGI25160J50197_10082272 136
82 3300005262 Ga0065165_1001403 Ga0065165_100140322 136
83 3300025302 Ga0207426_1001107 Ga0207426_100110712 136
84 3300049580 Ga0501046_0648392 Ga0501046_0648392_55_474 136
85 3300049586 Ga0501070_0596772 Ga0501070_0596772_189_608 136
86 3300049590 Ga0501074_0052198 Ga0501074_0052198_400_819 136
87 3300049742 Ga0501080_0074727 Ga0501080_0074727_485_904 136
88 3300049823 Ga0501044_0376152 Ga0501044_0376152_880_1299 136
89 iso_pu_bacteria 2885374607 2885381720 136
90 iso_pu_bacteria 2904699407 2904702210 136
91 iso_pu_bacteria 2906610324 2906617219 136
92 iso_pu_bacteria 2906635258 2906643392 136
93 iso_pu_bacteria 2906660503 2906662477 136
94 iso_pu_bacteria 2908739725 2908742368 136
95 iso_pu_bacteria 2922425934 2922430610 136
96 iso_pu_bacteria 2941507105 2941509966 136
97 iso_pu_bacteria 2941515067 2941518947 136
98 iso_pu_bacteria 2941523033 2941525365 136
99 3300036401 Ga0373937_0128498 Ga0373937_0128498_83_496 137
100 3300046516 Ga0495628_0050841 Ga0495628_0050841_1910_2323 137
101 3300046680 Ga0495646_0065546 Ga0495646_0065546_944_1357 137
102 3300047319 Ga0495674_0017800 Ga0495674_0017800_5970_6383 137
103 iso_pu_bacteria 2874604998 2874605518 137
104 iso_pu_bacteria 2889033259 2889039460 137
105 iso_pu_bacteria 2904690495 2904694846 137
106 iso_pu_bacteria 2908756301 2908760012 137
107 iso_pu_bacteria 2922386360 2922391268 137
108 iso_pu_bacteria 8056689827 8056694261 137
109 3300006028 Ga0070717_10324065 Ga0070717_103240653 138
110 3300007788 Ga0099795_10085811 Ga0099795_100858111 138
111 3300013100 Ga0157373_10221206 Ga0157373_102212062 138
112 3300035111 Ga0373923_0025408 Ga0373923_0025408_711_1142 138
113 3300035117 Ga0373953_0036564 Ga0373953_0036564_1424_1855 138
114 3300035118 Ga0373954_0023809 Ga0373954_0023809_755_1186 138
115 3300035119 Ga0373956_0026692 Ga0373956_0026692_1916_2347 138
116 3300035120 Ga0373957_0010704 Ga0373957_0010704_389_820 138
117 3300035171 Ga0373946_0550163 Ga0373946_0550163_93_524 138
118 3300035172 Ga0373955_0028931 Ga0373955_0028931_658_1089 138
119 3300035410 Ga0373924_0061782 Ga0373924_0061782_911_1342 138
120 3300035692 Ga0373935_0200449 Ga0373935_0200449_755_1186 138
121 3300036401 Ga0373937_0187021 Ga0373937_0187021_413_844 138
122 3300044683 Ga0466965_0168149 Ga0466965_0168149_583_999 138
123 3300045976 Ga0466967_0656202 Ga0466967_0656202_181_597 138
124 3300046454 Ga0495592_0088121 Ga0495592_0088121_1626_2057 138
125 3300046462 Ga0495651_0064755 Ga0495651_0064755_1655_2086 138
126 3300046463 Ga0495653_0090036 Ga0495653_0090036_1431_1862 138
127 3300046475 Ga0495639_0271372 Ga0495639_0271372_256_678 138
128 3300046476 Ga0495662_0031332 Ga0495662_0031332_25_456 138
129 3300046477 Ga0495664_0256880 Ga0495664_0256880_448_879 138
130 3300046511 Ga0495608_0055907 Ga0495608_0055907_1572_2003 138
131 3300046514 Ga0495618_0033162 Ga0495618_0033162_2070_2501 138
132 3300046516 Ga0495628_0066723 Ga0495628_0066723_1341_1772 138
133 3300046517 Ga0495630_0084762 Ga0495630_0084762_733_1164 138
134 3300046529 Ga0495652_0109203 Ga0495652_0109203_614_1045 138
135 3300046533 Ga0495640_0095043 Ga0495640_0095043_492_923 138
136 3300046536 Ga0495587_0074078 Ga0495587_0074078_1134_1565 138
137 3300046543 Ga0495645_0021210 Ga0495645_0021210_1661_2092 138
138 3300046559 Ga0495667_0007037 Ga0495667_0007037_6145_6576 138
139 3300046642 Ga0495634_0267809 Ga0495634_0267809_265_696 138
140 3300046663 Ga0495635_0048856 Ga0495635_0048856_1739_2170 138
141 3300046678 Ga0495599_0044339 Ga0495599_0044339_1754_2185 138
142 3300046679 Ga0495623_0042610 Ga0495623_0042610_1046_1477 138
143 3300046680 Ga0495646_0031778 Ga0495646_0031778_853_1284 138
144 3300046683 Ga0495658_0506004 Ga0495658_0506004_182_613 138
145 3300047317 Ga0495604_0017963 Ga0495604_0017963_843_1274 138
146 3300047319 Ga0495674_0197401 Ga0495674_0197401_827_1258 138
147 3300047319 Ga0495674_0240474 Ga0495674_0240474_1038_1460 138
148 3300047322 Ga0495680_0072319 Ga0495680_0072319_708_1139 138
149 3300047444 Ga0495675_0058341 Ga0495675_0058341_600_1031 138
150 3300047471 Ga0495684_0066747 Ga0495684_0066747_605_1036 138
151 3300048088 Ga0495602_0058117 Ga0495602_0058117_1414_1845 138
152 3300053077 Ga0495601_0021200 Ga0495601_0021200_1722_2153 138
153 3300053078 Ga0495612_0014786 Ga0495612_0014786_1401_1832 138
154 3300053085 Ga0495619_0067470 Ga0495619_0067470_472_903 138
155 3300053094 Ga0500566_0338991 Ga0500566_0338991_14_445 138
156 3300005327 Ga0070658_10027089 Ga0070658_100270896 139
157 3300005329 Ga0070683_100073360 Ga0070683_1000733602 139
158 3300005336 Ga0070680_100053675 Ga0070680_1000536753 139
159 3300005339 Ga0070660_100041483 Ga0070660_1000414835 139
160 3300005366 Ga0070659_100093925 Ga0070659_1000939252 139
161 3300005458 Ga0070681_10119178 Ga0070681_101191783 139
162 3300005530 Ga0070679_100099935 Ga0070679_1000999353 139
163 3300005535 Ga0070684_100100507 Ga0070684_1001005072 139
164 3300005539 Ga0068853_100124457 Ga0068853_1001244573 139
165 3300005577 Ga0068857_100125500 Ga0068857_1001255002 139
166 3300005616 Ga0068852_100675539 Ga0068852_1006755392 139
167 3300005834 Ga0068851_10001206 Ga0068851_1000120610 139
168 3300006028 Ga0070717_10662249 Ga0070717_106622492 139
169 3300009093 Ga0105240_10091680 Ga0105240_100916805 139
170 3300009098 Ga0105245_11315059 Ga0105245_113150592 139
171 3300009101 Ga0105247_10321883 Ga0105247_103218832 139
172 3300009177 Ga0105248_11703461 Ga0105248_117034612 139
173 3300009545 Ga0105237_10106584 Ga0105237_101065844 139
174 3300009545 Ga0105237_10536162 Ga0105237_105361622 139
175 3300009551 Ga0105238_10085798 Ga0105238_100857983 139
176 3300010375 Ga0105239_10133896 Ga0105239_101338962 139
177 3300013104 Ga0157370_10079915 Ga0157370_100799152 139
178 3300013105 Ga0157369_10185397 Ga0157369_101853972 139
179 3300013308 Ga0157375_10556350 Ga0157375_105563502 139
180 3300014325 Ga0163163_10106415 Ga0163163_101064152 139
181 3300025904 Ga0207647_10134992 Ga0207647_101349922 139
182 3300025912 Ga0207707_10003603 Ga0207707_1000360311 139
183 3300025913 Ga0207695_10297720 Ga0207695_102977201 139
184 3300025914 Ga0207671_10139839 Ga0207671_101398392 139
185 3300025914 Ga0207671_10540347 Ga0207671_105403472 139
186 3300025919 Ga0207657_10012009 Ga0207657_100120093 139
187 3300025920 Ga0207649_10122236 Ga0207649_101222361 139
188 3300025921 Ga0207652_10001857 Ga0207652_1000185710 139
189 3300025924 Ga0207694_10039124 Ga0207694_100391245 139
190 3300025932 Ga0207690_11095315 Ga0207690_110953151 139
191 3300025944 Ga0207661_10344465 Ga0207661_103444652 139
192 3300025949 Ga0207667_10060027 Ga0207667_100600273 139
193 3300026041 Ga0207639_10083772 Ga0207639_100837723 139
194 3300026067 Ga0207678_10358115 Ga0207678_103581151 139
195 3300026142 Ga0207698_10089235 Ga0207698_100892352 139
196 3300033442 Ga0315911_1000006 Ga0315911_1000006329 139
197 3300046455 Ga0495603_0524214 Ga0495603_0524214_239_658 139
198 3300046460 Ga0495638_0006220 Ga0495638_0006220_6290_6715 139
199 3300046500 Ga0495596_0105587 Ga0495596_0105587_633_1052 139
200 3300046518 Ga0495631_0077768 Ga0495631_0077768_760_1179 139
201 3300046519 Ga0495632_0029344 Ga0495632_0029344_1502_1921 139
202 3300046648 Ga0495611_0040090 Ga0495611_0040090_296_715 139
203 3300046660 Ga0495625_0035331 Ga0495625_0035331_1614_2033 139
204 3300046665 Ga0495661_0110974 Ga0495661_0110974_194_613 139
205 3300047443 Ga0495687_090350 Ga0495687_090350_77_499 139
206 3300047472 Ga0495686_0019599 Ga0495686_0019599_2776_3195 139
207 3300048903 Ga0496100_0160095 Ga0496100_0160095_419_838 139
208 3300048904 Ga0496101_0040220 Ga0496101_0040220_2527_2946 139
209 3300048907 Ga0496104_0108918 Ga0496104_0108918_990_1409 139
210 3300048909 Ga0496106_0111610 Ga0496106_0111610_1449_1868 139
211 3300048910 Ga0496107_0085584 Ga0496107_0085584_1135_1554 139
212 3300048911 Ga0496108_0179760 Ga0496108_0179760_1184_1603 139
213 3300048912 Ga0496109_0714287 Ga0496109_0714287_385_804 139
214 3300048914 Ga0496111_0370636 Ga0496111_0370636_196_615 139
215 3300048917 Ga0496114_0043573 Ga0496114_0043573_1684_2103 139
216 3300048918 Ga0496115_0230094 Ga0496115_0230094_608_1030 139
217 3300048924 Ga0496121_0022110 Ga0496121_0022110_624_1043 139
218 3300048924 Ga0496121_0235008 Ga0496121_0235008_167_595 139
219 3300048924 Ga0496121_0363026 Ga0496121_0363026_518_946 139
220 3300048924 Ga0496121_0457168 Ga0496121_0457168_125_553 139
221 3300050492 nmdc:mga0yw44_129668_c1 nmdc:mga0yw44_129668_c1_990_1409 139
222 3300050495 nmdc:mga04h51_189442_c1 nmdc:mga04h51_189442_c1_22_441 139
223 3300053093 Ga0500651_0338794 Ga0500651_0338794_203_688 139
224 3300053111 Ga0500572_042027 Ga0500572_042027_691_1176 139
225 3300053136 Ga0500559_0098772 Ga0500559_0098772_455_940 139
226 3300053146 Ga0500588_0182140 Ga0500588_0182140_324_746 139
227 3300053150 Ga0500603_100822 Ga0500603_100822_148_633 139
228 3300053153 Ga0500616_0041758 Ga0500616_0041758_75_500 139
229 3300053157 Ga0500624_051945 Ga0500624_051945_44_529 139
230 3300053177 Ga0500636_0005675 Ga0500636_0005675_2318_2803 139
231 3300053735 Ga0500596_052729 Ga0500596_052729_112_597 139
232 iso_pu_bacteria 8006973647 8006980033 139
233 iso_pu_bacteria 8019555841 8019556238 139
234 iso_pu_bacteria 8019565922 8019569071 139
235 3300005617 Ga0068859_100548327 Ga0068859_1005483272 140
236 3300005618 Ga0068864_101158453 Ga0068864_1011584532 140
237 3300006931 Ga0097620_100548300 Ga0097620_1005483002 140
238 3300006942 Ga0099824_1004403 Ga0099824_10044034 140
239 3300006943 Ga0099822_1018335 Ga0099822_10183357 140
240 3300010375 Ga0105239_10140030 Ga0105239_101400304 140
241 3300013104 Ga0157370_11134274 Ga0157370_111342742 140
242 3300013105 Ga0157369_10206150 Ga0157369_102061504 140
243 3300013306 Ga0163162_10026189 Ga0163162_100261894 140
244 3300013306 Ga0163162_10583675 Ga0163162_105836751 140
245 3300014325 Ga0163163_12138590 Ga0163163_121385901 140
246 3300015265 Ga0182005_1108875 Ga0182005_11088752 140
247 3300025261 Ga0209233_1017922 Ga0209233_10179222 140
248 3300025900 Ga0207710_10019985 Ga0207710_100199854 140
249 3300026088 Ga0207641_10509322 Ga0207641_105093222 140
250 3300026095 Ga0207676_10967045 Ga0207676_109670452 140
251 3300027357 Ga0209589_1000001 Ga0209589_1000001223 140
252 3300027361 Ga0209489_100001 Ga0209489_100001223 140
253 3300027363 Ga0209700_100001 Ga0209700_100001223 140
254 3300031824 Ga0307413_10089201 Ga0307413_100892013 140
255 3300032005 Ga0307411_10532155 Ga0307411_105321551 140
256 3300035117 Ga0373953_0341077 Ga0373953_0341077_141_569 140
257 3300037418 Ga0395900_1364142 Ga0395900_1364142_164_586 140
258 3300037466 Ga0395898_0046725 Ga0395898_0046725_2240_2662 140
259 3300037471 Ga0395905_0001756 Ga0395905_0001756_17120_17542 140
260 3300041451 Ga0451791_1893118 Ga0451791_1893118_50_472 140
261 3300041486 Ga0451807_2629163 Ga0451807_2629163_147_569 140
262 3300041492 Ga0451835_0477346 Ga0451835_0477346_171_593 140
263 3300041496 Ga0451839_1247905 Ga0451839_1247905_88_510 140
264 3300041505 Ga0451849_1494901 Ga0451849_1494901_155_577 140
265 3300041512 Ga0451853_1471601 Ga0451853_1471601_1402_1824 140
266 3300041997 Ga0439431_0094488 Ga0439431_0094488_40_471 140
267 3300042004 Ga0439445_0136920 Ga0439445_0136920_231_662 140
268 3300044683 Ga0466965_0063626 Ga0466965_0063626_240_662 140
269 3300044706 Ga0466964_0217288 Ga0466964_0217288_141_563 140
270 3300046457 Ga0495590_0077096 Ga0495590_0077096_76_498 140
271 3300046507 Ga0495606_0196577 Ga0495606_0196577_207_629 140
272 3300046512 Ga0495610_0056970 Ga0495610_0056970_246_674 140
273 3300046524 Ga0495648_0057102 Ga0495648_0057102_1322_1747 140
274 3300046524 Ga0495648_0090173 Ga0495648_0090173_318_740 140
275 3300046538 Ga0495609_0141239 Ga0495609_0141239_240_662 140
276 3300046648 Ga0495611_0086149 Ga0495611_0086149_522_944 140
277 3300046665 Ga0495661_0179489 Ga0495661_0179489_362_829 140
278 3300046684 Ga0495669_0147151 Ga0495669_0147151_428_850 140
279 3300047469 Ga0495673_0211121 Ga0495673_0211121_281_703 140
280 3300047472 Ga0495686_0096280 Ga0495686_0096280_39_461 140
281 3300047472 Ga0495686_0103351 Ga0495686_0103351_1270_1692 140
282 3300047472 Ga0495686_0680715 Ga0495686_0680715_26_448 140
283 3300048091 Ga0495626_0148163 Ga0495626_0148163_536_958 140
284 3300048904 Ga0496101_0149953 Ga0496101_0149953_621_1043 140
285 3300048908 Ga0496105_0028038 Ga0496105_0028038_1862_2284 140
286 3300048908 Ga0496105_0512593 Ga0496105_0512593_49_471 140
287 3300048911 Ga0496108_0998654 Ga0496108_0998654_131_553 140
288 3300048912 Ga0496109_0277031 Ga0496109_0277031_403_825 140
289 3300048914 Ga0496111_0499899 Ga0496111_0499899_175_597 140
290 3300048921 Ga0496118_0033666 Ga0496118_0033666_2197_2619 140
291 3300048923 Ga0496120_0018899 Ga0496120_0018899_2387_2809 140
292 3300048923 Ga0496120_0334003 Ga0496120_0334003_93_515 140
293 3300048924 Ga0496121_0055482 Ga0496121_0055482_1880_2302 140
294 3300048924 Ga0496121_0067329 Ga0496121_0067329_1249_1671 140
295 3300048928 Ga0496125_0125900 Ga0496125_0125900_245_667 140
296 3300050490 nmdc:mga03n38_188376_c1 nmdc:mga03n38_188376_c1_158_580 140
297 3300050492 nmdc:mga0yw44_177714_c1 nmdc:mga0yw44_177714_c1_585_1007 140
298 3300050516 nmdc:mga0sz30_174023_c1 nmdc:mga0sz30_174023_c1_300_722 140
299 3300053086 Ga0500578_0543686 Ga0500578_0543686_51_479 140
300 3300053087 Ga0500643_000035 Ga0500643_000035_93559_93981 140
301 3300053092 Ga0500583_0041239 Ga0500583_0041239_1072_1494 140
302 3300053093 Ga0500651_0233519 Ga0500651_0233519_11_433 140
303 3300053094 Ga0500566_0001359 Ga0500566_0001359_10156_10578 140
304 3300053103 Ga0500555_012606 Ga0500555_012606_950_1372 140
305 3300053104 Ga0500556_0023338 Ga0500556_0023338_1125_1553 140
306 3300053105 Ga0500557_000004 Ga0500557_000004_62877_63299 140
307 3300053116 Ga0500592_019082 Ga0500592_019082_537_959 140
308 3300053130 Ga0500642_0000133 Ga0500642_0000133_18322_18744 140
309 3300053130 Ga0500642_0003332 Ga0500642_0003332_1605_2027 140
310 3300053131 Ga0500652_030127 Ga0500652_030127_175_597 140
311 3300053134 Ga0500658_0067266 Ga0500658_0067266_1007_1429 140
312 3300053139 Ga0500568_0028188 Ga0500568_0028188_294_716 140
313 3300053147 Ga0500589_105608 Ga0500589_105608_366_788 140
314 3300053156 Ga0500622_0005064 Ga0500622_0005064_5043_5471 140
315 3300053158 Ga0500627_0189762 Ga0500627_0189762_122_544 140
316 3300053729 Ga0500625_008128 Ga0500625_008128_814_1236 140
317 3300053730 Ga0500645_032606 Ga0500645_032606_51_473 140
318 3300053736 Ga0500599_000373 Ga0500599_000373_475_903 140
319 3300053737 Ga0500601_000171 Ga0500601_000171_7432_7854 140
320 3300055283 Ga0500661_009767 Ga0500661_009767_1269_1691 140
321 3300046463 Ga0495653_0665908 Ga0495653_0665908_94_528 141
322 3300046674 Ga0495588_0160594 Ga0495588_0160594_593_1018 141
323 3300053084 Ga0495595_0232064 Ga0495595_0232064_424_858 141
324 iso_pu_bacteria 2528768022 2528848597 141
325 iso_pu_bacteria 2824661429 2824661483 141
326 iso_pu_bacteria 2874628541 2874632170 141
327 iso_pu_bacteria 2879099564 2879104587 141
328 iso_pu_bacteria 2922368715 2922374755 141
329 iso_pu_bacteria 2932784394 2932788688 141
330 iso_pu_bacteria 2932809354 2932817371 141
331 iso_pu_bacteria 2932818245 2932826140 141
332 iso_pu_bacteria 2932828146 2932830336 141
333 iso_pu_bacteria 2935616580 2935616626 141
334 iso_pu_bacteria 2935638405 2935642043 141
335 iso_pu_bacteria 2935665750 2935672573 141
336 iso_pu_bacteria 2935675223 2935675956 141
337 iso_pu_bacteria 2935684952 2935685953 141
338 iso_pu_bacteria 2935694250 2935697802 141
339 iso_pu_bacteria 2935703347 2935705794 141
340 iso_pu_bacteria 2935713505 2935714505 141
341 iso_pu_bacteria 2935722832 2935725124 141
342 iso_pu_bacteria 2935732158 2935732516 141
343 iso_pu_bacteria 2935741537 2935741895 141
344 iso_pu_bacteria 2935750917 2935751918 141
345 iso_pu_bacteria 2935760218 2935765171 141
346 iso_pu_bacteria 2935801545 2935802791 141
347 iso_pu_bacteria 2935810662 2935813377 141
348 iso_pu_bacteria 2935827899 2935830210 141
349 iso_pu_bacteria 2935837841 2935838107 141
350 iso_pu_bacteria 2935855204 2935855250 141
351 iso_pu_bacteria 2935864058 2935867487 141
352 iso_pu_bacteria 2935873716 2935875675 141
353 iso_pu_bacteria 2935992306 2935996359 141
354 iso_pu_bacteria 2936002035 2936003642 141
355 iso_pu_bacteria 2936037263 2936042326 141
356 iso_pu_bacteria 2940556831 2940557279 141
357 iso_pu_bacteria 2941538514 2941539226 141
358 iso_pu_bacteria 8016511872 8016521969 141
359 iso_pu_bacteria 8017057580 8017063697 141
360 iso_pu_bacteria 8019576017 8019583026 141
361 iso_pu_bacteria 8019586578 8019590824 141
362 iso_pu_bacteria 8019597564 8019600524 141
363 iso_pu_bacteria 8019608314 8019618021 141
364 3300003659 JGI25404J52841_10000065 JGI25404J52841_100000656 142
365 3300003659 JGI25404J52841_10035617 JGI25404J52841_100356172 142
366 3300005436 Ga0070713_100007867 Ga0070713_1000078678 142
367 3300005471 Ga0070698_100375669 Ga0070698_1003756691 142
368 3300005937 Ga0081455_10173033 Ga0081455_101730332 142
369 3300005983 Ga0081540_1001807 Ga0081540_10018077 142
370 3300005983 Ga0081540_1036527 Ga0081540_10365271 142
371 3300006028 Ga0070717_10009668 Ga0070717_100096688 142
372 3300006175 Ga0070712_100312124 Ga0070712_1003121242 142
373 3300007076 Ga0075435_100133489 Ga0075435_1001334892 142
374 3300025915 Ga0207693_10312729 Ga0207693_103127292 142
375 3300025928 Ga0207700_10004870 Ga0207700_100048702 142
376 3300035114 Ga0373939_0449670 Ga0373939_0449670_104_532 142
377 3300050512 nmdc:mga0n895_70689_c1 nmdc:mga0n895_70689_c1_864_1292 142
378 3300050513 nmdc:mga0rr50_518172_c1 nmdc:mga0rr50_518172_c1_184_612 142
379 iso_pu_bacteria 2507262055 2507508295 142
380 iso_pu_bacteria 2508501009 2508542363 142
381 iso_pu_bacteria 2508501042 2508691883 142
382 iso_pu_bacteria 2511231028 2511397422 142
383 iso_pu_bacteria 2513237092 2513622425 142
384 iso_pu_bacteria 2513237095 2513645533 142
385 iso_pu_bacteria 2513237102 2513702381 142
386 iso_pu_bacteria 2513237104 2513718466 142
387 iso_pu_bacteria 2513237139 2513873059 142
388 iso_pu_bacteria 2513237161 2514015641 142
389 iso_pu_bacteria 2515154112 2515627201 142
390 iso_pu_bacteria 2517093001 2517102752 142
391 iso_pu_bacteria 2617270735 2617347078 142
392 iso_pu_bacteria 2617270741 2617375473 142
393 iso_pu_bacteria 2791355196 2793062678 142
394 iso_pu_bacteria 2802429603 2805915042 142
395 iso_pu_bacteria 2816332527 2818238580 142
396 iso_pu_bacteria 2824600985 2824602441 142
397 iso_pu_bacteria 2824609381 2824610444 142
398 iso_pu_bacteria 2824617872 2824618021 142
399 iso_pu_bacteria 2824626560 2824626689 142
400 iso_pu_bacteria 2824635225 2824636676 142
401 iso_pu_bacteria 2824644064 2824648979 142
402 iso_pu_bacteria 2824653114 2824657396 142
403 iso_pu_bacteria 2824671348 2824674898 142
404 iso_pu_bacteria 2824679649 2824685812 142
405 iso_pu_bacteria 2824687955 2824691323 142
406 iso_pu_bacteria 2824696289 2824699497 142
407 iso_pu_bacteria 2824704595 2824714256 142
408 iso_pu_bacteria 2824714736 2824723162 142
409 iso_pu_bacteria 2824723954 2824725112 142
410 iso_pu_bacteria 2824732956 2824733365 142
411 iso_pu_bacteria 2824746037 2824746508 142
412 iso_pu_bacteria 2824753945 2824754272 142
413 iso_pu_bacteria 2824763712 2824767771 142
414 iso_pu_bacteria 2824773399 2824775334 142
415 iso_pu_bacteria 2838122688 2838123432 142
416 iso_pu_bacteria 2841941048 2841947795 142
417 iso_pu_bacteria 2841949485 2841949534 142
418 iso_pu_bacteria 2841957949 2841964129 142
419 iso_pu_bacteria 2841966195 2841971959 142
420 iso_pu_bacteria 2841974524 2841974698 142
421 iso_pu_bacteria 2841983080 2841983744 142
422 iso_pu_bacteria 2842038055 2842040102 142
423 iso_pu_bacteria 2842045827 2842046953 142
424 iso_pu_bacteria 2847930680 2847936514 142
425 iso_pu_bacteria 2847939898 2847946860 142
426 iso_pu_bacteria 2849076700 2849079036 142
427 iso_pu_bacteria 2857509624 2857516713 142
428 iso_pu_bacteria 2874590934 2874598337 142
429 iso_pu_bacteria 2874612657 2874619455 142
430 iso_pu_bacteria 2874620515 2874627512 142
431 iso_pu_bacteria 2874645413 2874652607 142
432 iso_pu_bacteria 2876771140 2876778185 142
433 iso_pu_bacteria 2876818435 2876825946 142
434 iso_pu_bacteria 2879074833 2879081979 142
435 iso_pu_bacteria 2879083081 2879089450 142
436 iso_pu_bacteria 2879127579 2879135101 142
437 iso_pu_bacteria 2879142872 2879149785 142
438 iso_pu_bacteria 2881364244 2881368560 142
439 iso_pu_bacteria 2881665667 2881672605 142
440 iso_pu_bacteria 2885366525 2885369185 142
441 iso_pu_bacteria 2885409591 2885410463 142
442 iso_pu_bacteria 2888378607 2888384390 142
443 iso_pu_bacteria 2888388044 2888393528 142
444 iso_pu_bacteria 2888419890 2888424819 142
445 iso_pu_bacteria 2904666416 2904673168 142
446 iso_pu_bacteria 2904711408 2904714995 142
447 iso_pu_bacteria 2906626472 2906633624 142
448 iso_pu_bacteria 2906643746 2906651287 142
449 iso_pu_bacteria 2908775508 2908780467 142
450 iso_pu_bacteria 2922393267 2922400507 142
451 iso_pu_bacteria 2929615660 2929621827 142
452 iso_pu_bacteria 2929624759 2929629866 142
453 iso_pu_bacteria 2933577622 2933583897 142
454 iso_pu_bacteria 2935608549 2935609218 142
455 iso_pu_bacteria 2935648319 2935650980 142
456 iso_pu_bacteria 2935656913 2935659161 142
457 iso_pu_bacteria 2935769743 2935771770 142
458 iso_pu_bacteria 2935777560 2935778791 142
459 iso_pu_bacteria 2935785616 2935788821 142
460 iso_pu_bacteria 2935793552 2935795379 142
461 iso_pu_bacteria 2935819856 2935822378 142
462 iso_pu_bacteria 2935847175 2935847960 142
463 iso_pu_bacteria 2935908558 2935908819 142
464 iso_pu_bacteria 2935916978 2935919539 142
465 iso_pu_bacteria 2935926038 2935926607 142
466 iso_pu_bacteria 2935934488 2935935057 142
467 iso_pu_bacteria 2935942939 2935943507 142
468 iso_pu_bacteria 2935951376 2935951945 142
469 iso_pu_bacteria 2935967501 2935968070 142
470 iso_pu_bacteria 2935975950 2935978695 142
471 iso_pu_bacteria 2935984226 2935987432 142
472 iso_pu_bacteria 2936011229 2936013576 142
473 iso_pu_bacteria 2936019824 2936022297 142
474 iso_pu_bacteria 2936028420 2936030743 142
475 iso_pu_bacteria 2936046547 2936048556 142
476 iso_pu_bacteria 2936055302 2936058770 142
477 iso_pu_bacteria 3005483717 3005484608 142
478 iso_pu_bacteria 3005506211 3005510606 142
479 iso_pu_bacteria 3005587118 3005587752 142
480 iso_pu_bacteria 8016522445 8016529329 142
481 iso_pu_bacteria 8016530956 8016534544 142
482 iso_pu_bacteria 8016539877 8016547762 142
483 iso_pu_bacteria 8016548790 8016554374 142
484 iso_pu_bacteria 8016557553 8016562742 142
485 iso_pu_bacteria 8016566248 8016572885 142
486 iso_pu_bacteria 8016575299 8016577044 142
487 iso_pu_bacteria 8016595262 8016600526 142
488 iso_pu_bacteria 8016603502 8016610220 142
489 iso_pu_bacteria 8016613128 8016614713 142
490 iso_pu_bacteria 8016622563 8016626276 142
491 iso_pu_bacteria 8016630954 8016640014 142
492 iso_pu_bacteria 8019530166 8019534305 142
493 iso_pu_bacteria 8019538911 8019545154 142
494 iso_pu_bacteria 8019547302 8019553370 142
495 iso_pu_bacteria 8019619141 8019628496 142
496 iso_pu_bacteria 8019629233 8019634137 142
497 iso_pu_bacteria 8019638758 8019645592 142
498 iso_pu_bacteria 8019659431 8019662015 142
499 iso_pu_bacteria 8019668869 8019671542 142
500 iso_pu_bacteria 8055742211 8055746007 142
501 3300003659 JGI25404J52841_10070111 JGI25404J52841_100701111 143
502 3300005577 Ga0068857_100637998 Ga0068857_1006379982 143
503 3300005937 Ga0081455_10113250 Ga0081455_101132502 143
504 3300005983 Ga0081540_1000933 Ga0081540_10009337 143
505 3300009545 Ga0105237_10110754 Ga0105237_101107544 143
506 3300009545 Ga0105237_10609342 Ga0105237_106093422 143
507 3300025912 Ga0207707_10003260 Ga0207707_100032605 143
508 3300025914 Ga0207671_10727029 Ga0207671_107270291 143
509 3300025917 Ga0207660_10342879 Ga0207660_103428792 143
510 3300025920 Ga0207649_10489587 Ga0207649_104895871 143
511 3300025921 Ga0207652_10095685 Ga0207652_100956852 143
512 3300025944 Ga0207661_10426213 Ga0207661_104262132 143
513 3300026041 Ga0207639_10230211 Ga0207639_102302112 143
514 3300026116 Ga0207674_10640442 Ga0207674_106404421 143
515 3300035089 Ga0373944_0005698 Ga0373944_0005698_2035_2466 143
516 3300035111 Ga0373923_0116466 Ga0373923_0116466_218_649 143
517 3300035113 Ga0373936_0056776 Ga0373936_0056776_652_1083 143
518 3300035116 Ga0373945_0005196 Ga0373945_0005196_1417_1848 143
519 3300035119 Ga0373956_0036543 Ga0373956_0036543_654_1085 143
520 3300035692 Ga0373935_0586417 Ga0373935_0586417_120_551 143
521 3300035724 Ga0373933_0179705 Ga0373933_0179705_356_787 143
522 3300037068 Ga0373925_0126944 Ga0373925_0126944_1464_1895 143
523 3300046475 Ga0495639_0230408 Ga0495639_0230408_143_574 143
524 3300046477 Ga0495664_0014962 Ga0495664_0014962_1736_2167 143
525 3300046499 Ga0495594_0039280 Ga0495594_0039280_239_670 143
526 3300046514 Ga0495618_0062804 Ga0495618_0062804_1366_1797 143
527 3300046531 Ga0495665_0021744 Ga0495665_0021744_1603_2034 143
528 3300046533 Ga0495640_0013662 Ga0495640_0013662_3396_3827 143
529 3300046535 Ga0495586_0113104 Ga0495586_0113104_545_976 143
530 3300046536 Ga0495587_0359559 Ga0495587_0359559_342_773 143
531 3300047315 Ga0495581_0024060 Ga0495581_0024060_1887_2318 143
532 3300047321 Ga0495676_0053391 Ga0495676_0053391_565_996 143
533 3300047444 Ga0495675_0570834 Ga0495675_0570834_47_478 143
534 3300047673 Ga0495593_0004557 Ga0495593_0004557_4155_4586 143
535 3300053077 Ga0495601_0073139 Ga0495601_0073139_873_1304 143
536 3300005985 Ga0081539_10070243 Ga0081539_100702432 144
537 3300044658 Ga0466972_0000122 Ga0466972_0000122_60994_61428 144
538 3300044683 Ga0466965_0535224 Ga0466965_0535224_73_507 144
539 3300003215 JGI25153J46596_10006767 JGI25153J46596_100067674 145
540 3300004625 Ga0055543_1004059 Ga0055543_10040595 145
541 3300005262 Ga0065165_1000433 Ga0065165_100043352 145
542 3300005338 Ga0068868_100097012 Ga0068868_1000970122 145
543 3300005366 Ga0070659_100408761 Ga0070659_1004087612 145
544 3300005455 Ga0070663_100039008 Ga0070663_1000390082 145
545 3300005564 Ga0070664_100118025 Ga0070664_1001180252 145
546 3300005834 Ga0068851_10271276 Ga0068851_102712762 145
547 3300025261 Ga0209233_1008601 Ga0209233_10086013 145
548 3300025297 Ga0209758_1004050 Ga0209758_100405010 145
549 3300025900 Ga0207710_10347636 Ga0207710_103476362 145
550 3300025940 Ga0207691_10418103 Ga0207691_104181032 145
551 3300025942 Ga0207689_10406078 Ga0207689_104060782 145
552 3300025945 Ga0207679_10372264 Ga0207679_103722642 145
553 3300026023 Ga0207677_10108081 Ga0207677_101080813 145
554 3300026035 Ga0207703_10666056 Ga0207703_106660561 145
555 3300026067 Ga0207678_10060133 Ga0207678_100601332 145
556 3300026121 Ga0207683_10266888 Ga0207683_102668882 145
557 3300027866 Ga0209813_10163541 Ga0209813_101635412 145
558 3300028379 Ga0268266_10727465 Ga0268266_107274652 145
559 3300046454 Ga0495592_0270697 Ga0495592_0270697_145_630 145
560 3300046492 Ga0495585_0098238 Ga0495585_0098238_80_517 145
561 3300046507 Ga0495606_0174122 Ga0495606_0174122_202_639 145
562 3300046512 Ga0495610_0101021 Ga0495610_0101021_838_1275 145
563 3300046557 Ga0495622_0086519 Ga0495622_0086519_43_480 145
564 3300046616 Ga0495668_0144289 Ga0495668_0144289_709_1146 145
565 3300046692 Ga0495671_0044078 Ga0495671_0044078_1504_1941 145
566 3300048905 Ga0496102_0122301 Ga0496102_0122301_1295_1732 145
567 3300048908 Ga0496105_0073134 Ga0496105_0073134_927_1364 145
568 3300048913 Ga0496110_0047316 Ga0496110_0047316_1318_1755 145
569 3300048915 Ga0496112_0015856 Ga0496112_0015856_1197_1634 145
570 3300048916 Ga0496113_0058559 Ga0496113_0058559_1167_1604 145
571 3300048919 Ga0496116_0082110 Ga0496116_0082110_916_1353 145
572 3300048920 Ga0496117_0051706 Ga0496117_0051706_1199_1636 145
573 3300048921 Ga0496118_0055688 Ga0496118_0055688_1961_2398 145
574 3300048922 Ga0496119_0068253 Ga0496119_0068253_1283_1720 145
575 3300053080 Ga0500635_0100518 Ga0500635_0100518_44_529 145
576 3300053095 Ga0500640_075214 Ga0500640_075214_631_1116 145
577 3300053121 Ga0500607_034406 Ga0500607_034406_513_998 145
578 3300053122 Ga0500608_096171 Ga0500608_096171_661_1146 145
579 3300053123 Ga0500614_068093 Ga0500614_068093_315_800 145
580 3300053128 Ga0500626_168656 Ga0500626_168656_283_768 145
581 3300053144 Ga0500585_220876 Ga0500585_220876_44_529 145
582 3300053154 Ga0500619_026514 Ga0500619_026514_926_1411 145
583 3300053155 Ga0500620_042237 Ga0500620_042237_554_1039 145
584 3300053163 Ga0500639_138471 Ga0500639_138471_549_1034 145
585 3300002075 JGI24738J21930_10033689 JGI24738J21930_100336892 146
586 3300003215 JGI25153J46596_10007604 JGI25153J46596_100076044 146
587 3300003215 JGI25153J46596_10017021 JGI25153J46596_100170212 146
588 3300003323 rootH1_10156318 rootH1_101563184 146
589 3300003354 JGI25160J50197_1000838 JGI25160J50197_10008389 146
590 3300003771 Ga0055526_1026655 Ga0055526_10266552 146
591 3300003794 Ga0055531_10003336 Ga0055531_100033369 146
592 3300005262 Ga0065165_1012388 Ga0065165_10123884 146
593 3300005262 Ga0065165_1014587 Ga0065165_10145873 146
594 3300005327 Ga0070658_10069245 Ga0070658_100692452 146
595 3300005337 Ga0070682_100077523 Ga0070682_1000775232 146
596 3300005339 Ga0070660_100031993 Ga0070660_1000319934 146
597 3300005344 Ga0070661_100097630 Ga0070661_1000976303 146
598 3300005347 Ga0070668_100107890 Ga0070668_1001078902 146
599 3300005355 Ga0070671_100074258 Ga0070671_1000742583 146
600 3300005367 Ga0070667_100471664 Ga0070667_1004716641 146
601 3300005439 Ga0070711_100837580 Ga0070711_1008375801 146
602 3300005455 Ga0070663_100167997 Ga0070663_1001679972 146
603 3300005457 Ga0070662_100181854 Ga0070662_1001818542 146
604 3300005539 Ga0068853_101038498 Ga0068853_1010384981 146
605 3300005547 Ga0070693_100818806 Ga0070693_1008188061 146
606 3300005563 Ga0068855_100141606 Ga0068855_1001416062 146
607 3300005577 Ga0068857_100134918 Ga0068857_1001349182 146
608 3300005578 Ga0068854_100317239 Ga0068854_1003172392 146
609 3300005614 Ga0068856_100078138 Ga0068856_1000781383 146
610 3300005614 Ga0068856_100144594 Ga0068856_1001445942 146
611 3300005616 Ga0068852_100042366 Ga0068852_1000423662 146
612 3300005618 Ga0068864_100236840 Ga0068864_1002368402 146
613 3300005844 Ga0068862_100044071 Ga0068862_1000440712 146
614 3300005983 Ga0081540_1175932 Ga0081540_11759322 146
615 3300005983 Ga0081540_1294309 Ga0081540_12943091 146
616 3300006038 Ga0075365_10082796 Ga0075365_100827962 146
617 3300006038 Ga0075365_10236724 Ga0075365_102367242 146
618 3300006042 Ga0075368_10011258 Ga0075368_100112582 146
619 3300006048 Ga0075363_100008538 Ga0075363_1000085384 146
620 3300006051 Ga0075364_10025855 Ga0075364_100258552 146
621 3300006177 Ga0075362_10150872 Ga0075362_101508722 146
622 3300006186 Ga0075369_10035187 Ga0075369_100351872 146
623 3300006195 Ga0075366_10017707 Ga0075366_100177074 146
624 3300006353 Ga0075370_10086135 Ga0075370_100861352 146
625 3300009093 Ga0105240_10344932 Ga0105240_103449322 146
626 3300009098 Ga0105245_10382301 Ga0105245_103823012 146
627 3300009101 Ga0105247_10015105 Ga0105247_100151055 146
628 3300009148 Ga0105243_10092125 Ga0105243_100921252 146
629 3300009174 Ga0105241_10114692 Ga0105241_101146922 146
630 3300009176 Ga0105242_10814091 Ga0105242_108140912 146
631 3300009545 Ga0105237_10092617 Ga0105237_100926173 146
632 3300009553 Ga0105249_10125042 Ga0105249_101250423 146
633 3300011119 Ga0105246_10080849 Ga0105246_100808492 146
634 3300013296 Ga0157374_10061400 Ga0157374_100614003 146
635 3300014325 Ga0163163_10055860 Ga0163163_100558605 146
636 3300017792 Ga0163161_10377745 Ga0163161_103777452 146
637 3300021320 Ga0214544_1000002 Ga0214544_1000002155 146
638 3300021321 Ga0214542_1000001 Ga0214542_1000001505 146
639 3300021324 Ga0214545_1000001 Ga0214545_1000001571 146
640 3300021327 Ga0214543_1000001 Ga0214543_1000001625 146
641 3300025230 Ga0209563_103642 Ga0209563_1036423 146
642 3300025295 Ga0209564_1018244 Ga0209564_10182443 146
643 3300025295 Ga0209564_1019751 Ga0209564_10197514 146
644 3300025297 Ga0209758_1000024 Ga0209758_10000248 146
645 3300025297 Ga0209758_1001768 Ga0209758_10017689 146
646 3300025297 Ga0209758_1007646 Ga0209758_10076464 146
647 3300025297 Ga0209758_1114340 Ga0209758_11143402 146
648 3300025299 Ga0209256_1004722 Ga0209256_10047226 146
649 3300025302 Ga0207426_1026026 Ga0207426_10260264 146
650 3300025302 Ga0207426_1073848 Ga0207426_10738482 146
651 3300025303 Ga0209051_1045422 Ga0209051_10454222 146
652 3300025304 Ga0209257_1002662 Ga0209257_100266211 146
653 3300025304 Ga0209257_1026314 Ga0209257_10263143 146
654 3300025315 Ga0207697_10023685 Ga0207697_100236852 146
655 3300025900 Ga0207710_10017418 Ga0207710_100174184 146
656 3300025901 Ga0207688_10155218 Ga0207688_101552182 146
657 3300025911 Ga0207654_10024818 Ga0207654_100248182 146
658 3300025914 Ga0207671_10057777 Ga0207671_100577773 146
659 3300025916 Ga0207663_11217728 Ga0207663_112177281 146
660 3300025919 Ga0207657_10028720 Ga0207657_100287205 146
661 3300025923 Ga0207681_10115332 Ga0207681_101153322 146
662 3300025924 Ga0207694_10089000 Ga0207694_100890003 146
663 3300025927 Ga0207687_10456483 Ga0207687_104564832 146
664 3300025931 Ga0207644_10044200 Ga0207644_100442004 146
665 3300025933 Ga0207706_10382150 Ga0207706_103821502 146
666 3300025935 Ga0207709_10204047 Ga0207709_102040472 146
667 3300025939 Ga0207665_10509451 Ga0207665_105094512 146
668 3300025949 Ga0207667_10071162 Ga0207667_100711623 146
669 3300025972 Ga0207668_10136632 Ga0207668_101366323 146
670 3300025986 Ga0207658_10160833 Ga0207658_101608332 146
671 3300026035 Ga0207703_10795917 Ga0207703_107959172 146
672 3300026041 Ga0207639_10218351 Ga0207639_102183513 146
673 3300026067 Ga0207678_10177249 Ga0207678_101772493 146
674 3300026078 Ga0207702_10083112 Ga0207702_100831124 146
675 3300026116 Ga0207674_10132679 Ga0207674_101326793 146
676 3300026142 Ga0207698_10033713 Ga0207698_100337135 146
677 3300027296 Ga0209389_1000040 Ga0209389_100004050 146
678 3300027296 Ga0209389_1000123 Ga0209389_100012354 146
679 3300027357 Ga0209589_1000036 Ga0209589_100003654 146
680 3300027361 Ga0209489_100006 Ga0209489_100006382 146
681 3300027363 Ga0209700_100005 Ga0209700_100005249 146
682 3300027866 Ga0209813_10020077 Ga0209813_100200772 146
683 3300028379 Ga0268266_10325522 Ga0268266_103255222 146
684 3300028380 Ga0268265_10081543 Ga0268265_100815432 146
685 3300033180 Ga0307510_10014440 Ga0307510_100144407 146
686 3300037312 Ga0395899_0302526 Ga0395899_0302526_210_695 146
687 3300037418 Ga0395900_0071844 Ga0395900_0071844_1910_2395 146
688 3300037466 Ga0395898_0126168 Ga0395898_0126168_1131_1616 146
689 3300037471 Ga0395905_0047688 Ga0395905_0047688_1365_1850 146
690 3300038443 Ga0395901_0836117 Ga0395901_0836117_359_844 146
691 3300046471 Ga0495650_0230755 Ga0495650_0230755_153_593 146
692 3300046474 Ga0495605_0083378 Ga0495605_0083378_249_743 146
693 3300046507 Ga0495606_0115424 Ga0495606_0115424_126_620 146
694 3300046519 Ga0495632_0258233 Ga0495632_0258233_218_712 146
695 3300046522 Ga0495643_0005870 Ga0495643_0005870_5233_5727 146
696 3300046522 Ga0495643_0138246 Ga0495643_0138246_251_739 146
697 3300046616 Ga0495668_0030154 Ga0495668_0030154_670_1164 146
698 3300046810 Ga0495660_0195233 Ga0495660_0195233_60_554 146
699 3300047443 Ga0495687_011356 Ga0495687_011356_484_978 146
700 3300048091 Ga0495626_0245795 Ga0495626_0245795_158_646 146
701 3300048903 Ga0496100_0202830 Ga0496100_0202830_435_929 146
702 3300048905 Ga0496102_0065738 Ga0496102_0065738_1665_2159 146
703 3300048912 Ga0496109_0077439 Ga0496109_0077439_1272_1766 146
704 3300048913 Ga0496110_0069938 Ga0496110_0069938_1321_1815 146
705 3300048915 Ga0496112_0244486 Ga0496112_0244486_372_866 146
706 3300048916 Ga0496113_0034546 Ga0496113_0034546_1073_1567 146
707 3300048916 Ga0496113_0536033 Ga0496113_0536033_328_813 146
708 3300048920 Ga0496117_0300584 Ga0496117_0300584_51_545 146
709 3300048922 Ga0496119_0056073 Ga0496119_0056073_1409_1903 146
710 3300050491 nmdc:mga00v17_61809_c1 nmdc:mga00v17_61809_c1_1482_1976 146
711 3300050492 nmdc:mga0yw44_101435_c1 nmdc:mga0yw44_101435_c1_478_972 146
712 3300050493 nmdc:mga0k408_36783_c1 nmdc:mga0k408_36783_c1_799_1293 146
713 3300050494 nmdc:mga06z11_28852_c1 nmdc:mga06z11_28852_c1_1502_1996 146
714 3300050495 nmdc:mga04h51_22672_c1 nmdc:mga04h51_22672_c1_1193_1687 146
715 3300050496 nmdc:mga07m45_454666_c1 nmdc:mga07m45_454666_c1_56_496 146
716 3300050496 nmdc:mga07m45_8643_c1 nmdc:mga07m45_8643_c1_1760_2254 146
717 3300050516 nmdc:mga0sz30_55658_c1 nmdc:mga0sz30_55658_c1_940_1434 146
718 3300053086 Ga0500578_0059588 Ga0500578_0059588_264_752 146
719 3300053109 Ga0500569_143764 Ga0500569_143764_17_460 146
720 iso_pu_bacteria 8016583857 8016593179 146

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5c-assembly1.cif.gz_E inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic v1-atpase 0.5367 6 65
6vq9-assembly1.cif.gz_D mammalian v-atpase from rat brain soluble v1 region rotational state 1 with sidk and adp (from focused refinement) 0.5087 6 69
2rkw-assembly1.cif.gz_B intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase 0.5078 6 73
3dsr-assembly1.cif.gz_A adp in transition binding site in the subunit b of the energy converter a1ao atp synthase 0.5039 6 76
3dsr-assembly1.cif.gz_B adp in transition binding site in the subunit b of the energy converter a1ao atp synthase 0.5039 6 73
ID Description Score Start End Superfamily
4eznA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4552 3 75 1.20.1270.10
3exaA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain 0.4546 1 75 1.10.287.890
4ezpA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4512 3 75 1.20.1270.10
4jwiA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4426 3 74 1.20.1270.10
4hybA02 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; 0.4381 3 74 1.20.1270.10
ID Description Score Start End GO Terms
AF-A0A525ISS0-F1-model_v4 Uncharacterized protein 0.9608 1 88
AF-A0A525ISS0-F1-model_v4 Uncharacterized protein 0.9503 1 88
AF-A0A1H1SDV5-F1-model_v4 Uncharacterized protein 0.9103 6 95
AF-A0A2H9VCN2-F1-model_v4 deleted 0.8103 6 84
AF-A0A2H9VCN2-F1-model_v4 deleted 0.6902 6 84

Feature Viewer

pLDDT pTM Quality
78.61 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map