F477296
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 720 | 527 | 527 | 144 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10344932|Ga0105240_103449322 |
| Length | 164 |
| Sequence | LNNDTRTQRTQAEGPEADLVKAADMLIARRADTRARADFATWKMMAKLNGSSALPPEAQEFLASYKNLLARMSEGEATEATIGAIYRAYYAEMGGAGAPPDVRPRPAEPAADNVTAFRRPAPKPKTTSFFRAGTAAGAQKRPLPVALIFACLVVVYVGIRLYWR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 9 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 16 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 22 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 23 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 24 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 25 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 26 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 27 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 28 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 29 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 30 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 31 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 32 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 33 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 34 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 35 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 36 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 37 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 38 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 39 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 40 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 41 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 42 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 43 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 44 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 45 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 46 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 47 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 48 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 49 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 50 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 51 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 52 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 53 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 54 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 58 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 59 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 60 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 61 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 62 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 63 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 64 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 65 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 66 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 67 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 68 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 69 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 70 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 71 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 72 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 73 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 74 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 75 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 76 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 77 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 78 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 79 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 80 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 81 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 82 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 83 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 84 | 2904699407 | |||
| 85 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 86 | 2906610324 | |||
| 87 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 88 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 89 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 90 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 91 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 92 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 93 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 94 | 2922368715 | |||
| 95 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 96 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 97 | 2922425934 | |||
| 98 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 99 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 100 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 101 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 102 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 103 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 104 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 105 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 106 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 107 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 108 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 109 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 110 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 111 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 112 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 113 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 114 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 115 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 116 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 117 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 118 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 119 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 120 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 121 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 122 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 123 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 124 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 125 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 126 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 127 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 128 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 129 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 130 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 131 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 132 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 133 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 134 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 135 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 136 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 137 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 138 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 139 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 140 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 141 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 142 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 143 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 144 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 145 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 146 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 147 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 148 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 149 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 150 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 151 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 152 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 153 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 154 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 155 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 156 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 157 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 158 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 159 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 160 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 161 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 162 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 163 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 164 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 165 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 166 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 167 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 168 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 169 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 170 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 171 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 174 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 176 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 184 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 188 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 190 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 191 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 192 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 194 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 196 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 197 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 198 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 199 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 200 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 201 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 202 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 203 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 204 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 205 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 206 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 207 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 208 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 209 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 210 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 211 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 212 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 214 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 215 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 216 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 217 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 219 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 220 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 221 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 222 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 225 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 226 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 227 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 228 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 229 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 230 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 231 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 232 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 233 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 235 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 239 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 240 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 242 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 243 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 244 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 245 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 246 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 247 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 250 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 252 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 255 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 298 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 299 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 300 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 301 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 302 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 305 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 306 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 307 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 308 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 309 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 310 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 312 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 313 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 314 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 315 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 316 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 317 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 318 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 321 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 322 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 323 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 324 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 325 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 326 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 327 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 328 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 329 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 330 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 331 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 333 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 334 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 335 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 336 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 337 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 338 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 339 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 340 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 341 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 342 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 343 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 409 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 411 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 412 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 413 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 414 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 415 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 416 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 417 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 418 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 419 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 420 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 421 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 422 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 423 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 424 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 425 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 426 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 427 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 428 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 429 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 430 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 436 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 441 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 442 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 443 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 444 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 445 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 446 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 447 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 453 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 458 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 459 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 460 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 461 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 462 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 463 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 464 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 465 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 466 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 468 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 469 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 470 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 471 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 472 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 473 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 475 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 476 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 477 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 478 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 479 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 480 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 481 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 482 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 483 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 484 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 485 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 487 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 488 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 489 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 490 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 492 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 493 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 494 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 495 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 496 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 497 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 498 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 499 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 500 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 501 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 502 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 503 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 504 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 505 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 506 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 507 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 508 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 509 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 510 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 511 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 512 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 513 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 514 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 515 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 516 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 517 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 518 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 519 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 520 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 521 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 522 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 523 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 524 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 525 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 526 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 527 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.6 |
| Metatranscriptomes | 0 |
| Isolates | 26.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.44 |
| Nodule | 21.67 |
| Rhizoplane | 5.83 |
| Rhizosphere | 48.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10033689 | 3300002075 | Bacteria | 1044 |
| 2 | JGI25406J46586_10027537 | 3300003203 | Bacteria | 2178 |
| 3 | JGI25153J46596_10006767 | 3300003215 | Bacteria | 5748 |
| 4 | JGI25153J46596_10007604 | 3300003215 | Bacteria | 5298 |
| 5 | JGI25153J46596_10017021 | 3300003215 | Bacteria | 2883 |
| 6 | rootH1_10156318 | 3300003323 | Bacteria | 4443 |
| 7 | JGI25160J50197_1000838 | 3300003354 | Bacteria | 16394 |
| 8 | JGI25160J50197_1008227 | 3300003354 | Bacteria | 3992 |
| 9 | JGI25404J52841_10000065 | 3300003659 | Bacteria | 9238 |
| 10 | JGI25404J52841_10035617 | 3300003659 | Bacteria | 1060 |
| 11 | JGI25404J52841_10070111 | 3300003659 | Bacteria | 732 |
| 12 | Ga0055526_1026655 | 3300003771 | Bacteria | 1813 |
| 13 | Ga0055531_10003336 | 3300003794 | Bacteria | 10275 |
| 14 | Ga0055543_1004059 | 3300004625 | Bacteria | 4101 |
| 15 | Ga0065165_1000433 | 3300005262 | Bacteria | 65855 |
| 16 | Ga0065165_1001403 | 3300005262 | Bacteria | 26300 |
| 17 | Ga0065165_1012388 | 3300005262 | Bacteria | 3476 |
| 18 | Ga0065165_1014587 | 3300005262 | Bacteria | 3042 |
| 19 | Ga0070658_10027089 | 3300005327 | Bacteria | 4601 |
| 20 | Ga0070658_10069245 | 3300005327 | Bacteria | 2886 |
| 21 | Ga0070683_100073360 | 3300005329 | Bacteria | 3196 |
| 22 | Ga0070680_100053675 | 3300005336 | Bacteria | 3290 |
| 23 | Ga0070682_100077523 | 3300005337 | Bacteria | 2142 |
| 24 | Ga0068868_100097012 | 3300005338 | Bacteria | 2381 |
| 25 | Ga0070660_100031993 | 3300005339 | Bacteria | 3955 |
| 26 | Ga0070660_100041483 | 3300005339 | Bacteria | 3508 |
| 27 | Ga0070660_100134022 | 3300005339 | Bacteria | 1984 |
| 28 | Ga0070661_100097630 | 3300005344 | Bacteria | 2181 |
| 29 | Ga0070661_100641667 | 3300005344 | Bacteria | 861 |
| 30 | Ga0070668_100107890 | 3300005347 | Bacteria | 2213 |
| 31 | Ga0070671_100074258 | 3300005355 | Bacteria | 2841 |
| 32 | Ga0070688_100298749 | 3300005365 | Bacteria | 1163 |
| 33 | Ga0070659_100093925 | 3300005366 | Bacteria | 2408 |
| 34 | Ga0070659_100408761 | 3300005366 | Bacteria | 1147 |
| 35 | Ga0070667_100471664 | 3300005367 | Bacteria | 1148 |
| 36 | Ga0070713_100007867 | 3300005436 | Bacteria | 7521 |
| 37 | Ga0070711_100129585 | 3300005439 | Bacteria | 1877 |
| 38 | Ga0070711_100837580 | 3300005439 | Bacteria | 782 |
| 39 | Ga0070663_100039008 | 3300005455 | Bacteria | 3317 |
| 40 | Ga0070663_100167997 | 3300005455 | Bacteria | 1693 |
| 41 | Ga0070662_100181854 | 3300005457 | Bacteria | 1658 |
| 42 | Ga0070681_10119178 | 3300005458 | Bacteria | 2575 |
| 43 | Ga0070698_100375669 | 3300005471 | Bacteria | 1354 |
| 44 | Ga0070679_100099935 | 3300005530 | Bacteria | 2888 |
| 45 | Ga0070684_100100507 | 3300005535 | Bacteria | 2583 |
| 46 | Ga0068853_100124457 | 3300005539 | Bacteria | 2302 |
| 47 | Ga0068853_101038498 | 3300005539 | Bacteria | 789 |
| 48 | Ga0070693_100668544 | 3300005547 | Bacteria | 757 |
| 49 | Ga0070693_100818806 | 3300005547 | Bacteria | 691 |
| 50 | Ga0068855_100141606 | 3300005563 | Bacteria | 2741 |
| 51 | Ga0070664_100118025 | 3300005564 | Bacteria | 2321 |
| 52 | Ga0068857_100125500 | 3300005577 | Bacteria | 2313 |
| 53 | Ga0068857_100134918 | 3300005577 | Bacteria | 2228 |
| 54 | Ga0068857_100637998 | 3300005577 | Bacteria | 1009 |
| 55 | Ga0068854_100317239 | 3300005578 | Bacteria | 1266 |
| 56 | Ga0068856_100078138 | 3300005614 | Bacteria | 3280 |
| 57 | Ga0068856_100144594 | 3300005614 | Bacteria | 2385 |
| 58 | Ga0068856_100323756 | 3300005614 | Bacteria | 1559 |
| 59 | Ga0068852_100042366 | 3300005616 | Bacteria | 3854 |
| 60 | Ga0068852_100675539 | 3300005616 | Bacteria | 1042 |
| 61 | Ga0068859_100548327 | 3300005617 | Bacteria | 1251 |
| 62 | Ga0068864_100236840 | 3300005618 | Bacteria | 1690 |
| 63 | Ga0068864_101158453 | 3300005618 | Bacteria | 771 |
| 64 | Ga0068851_10001206 | 3300005834 | Bacteria | 11224 |
| 65 | Ga0068851_10271276 | 3300005834 | Bacteria | 967 |
| 66 | Ga0068863_100760239 | 3300005841 | Bacteria | 965 |
| 67 | Ga0068862_100044071 | 3300005844 | Bacteria | 3805 |
| 68 | Ga0081455_10113250 | 3300005937 | Bacteria | 2152 |
| 69 | Ga0081455_10173033 | 3300005937 | Bacteria | 1643 |
| 70 | Ga0081540_1000933 | 3300005983 | Bacteria | 26285 |
| 71 | Ga0081540_1001807 | 3300005983 | Bacteria | 17952 |
| 72 | Ga0081540_1036527 | 3300005983 | Bacteria | 2618 |
| 73 | Ga0081540_1175932 | 3300005983 | Bacteria | 808 |
| 74 | Ga0081540_1294309 | 3300005983 | Bacteria | 558 |
| 75 | Ga0081539_10070243 | 3300005985 | Bacteria | 1881 |
| 76 | Ga0070717_10009668 | 3300006028 | Bacteria | 7259 |
| 77 | Ga0070717_10324065 | 3300006028 | Bacteria | 1373 |
| 78 | Ga0070717_10662249 | 3300006028 | Bacteria | 948 |
| 79 | Ga0075365_10082796 | 3300006038 | Bacteria | 2176 |
| 80 | Ga0075365_10236724 | 3300006038 | Bacteria | 1282 |
| 81 | Ga0075368_10011258 | 3300006042 | Bacteria | 3252 |
| 82 | Ga0075363_100008538 | 3300006048 | Bacteria | 4776 |
| 83 | Ga0075364_10025855 | 3300006051 | Bacteria | 3740 |
| 84 | Ga0070712_100312124 | 3300006175 | Bacteria | 1276 |
| 85 | Ga0075362_10150872 | 3300006177 | Bacteria | 1115 |
| 86 | Ga0075369_10035187 | 3300006186 | Bacteria | 2128 |
| 87 | Ga0075366_10017707 | 3300006195 | Bacteria | 4105 |
| 88 | Ga0075370_10086135 | 3300006353 | Bacteria | 1809 |
| 89 | Ga0097620_100548300 | 3300006931 | Bacteria | 1251 |
| 90 | Ga0099824_1004403 | 3300006942 | Bacteria | 20285 |
| 91 | Ga0099822_1018335 | 3300006943 | Bacteria | 7305 |
| 92 | Ga0075435_100133489 | 3300007076 | Bacteria | 2078 |
| 93 | Ga0099795_10085811 | 3300007788 | Bacteria | 1212 |
| 94 | Ga0105240_10091680 | 3300009093 | Bacteria | 3712 |
| 95 | Ga0105240_10344932 | 3300009093 | Bacteria | 1691 |
| 96 | Ga0105245_10382301 | 3300009098 | Bacteria | 1402 |
| 97 | Ga0105245_11133332 | 3300009098 | Bacteria | 829 |
| 98 | Ga0105245_11315059 | 3300009098 | Bacteria | 772 |
| 99 | Ga0105247_10015105 | 3300009101 | Bacteria | 4632 |
| 100 | Ga0105247_10026105 | 3300009101 | Bacteria | 3526 |
| 101 | Ga0105247_10321883 | 3300009101 | Bacteria | 1079 |
| 102 | Ga0105243_10092125 | 3300009148 | Bacteria | 2498 |
| 103 | Ga0105241_10114692 | 3300009174 | Bacteria | 2162 |
| 104 | Ga0105241_10461147 | 3300009174 | Bacteria | 1126 |
| 105 | Ga0105242_10814091 | 3300009176 | Bacteria | 926 |
| 106 | Ga0105248_11703461 | 3300009177 | Bacteria | 715 |
| 107 | Ga0105237_10092617 | 3300009545 | Bacteria | 3012 |
| 108 | Ga0105237_10106584 | 3300009545 | Bacteria | 2794 |
| 109 | Ga0105237_10110754 | 3300009545 | Bacteria | 2737 |
| 110 | Ga0105237_10536162 | 3300009545 | Bacteria | 1177 |
| 111 | Ga0105237_10609342 | 3300009545 | Bacteria | 1099 |
| 112 | Ga0105238_10085798 | 3300009551 | Bacteria | 3136 |
| 113 | Ga0105238_10385424 | 3300009551 | Bacteria | 1393 |
| 114 | Ga0105249_10125042 | 3300009553 | Bacteria | 2448 |
| 115 | Ga0105249_10438646 | 3300009553 | Bacteria | 1343 |
| 116 | Ga0105239_10106865 | 3300010375 | Bacteria | 3100 |
| 117 | Ga0105239_10133896 | 3300010375 | Bacteria | 2758 |
| 118 | Ga0105239_10140030 | 3300010375 | Bacteria | 2695 |
| 119 | Ga0105246_10080849 | 3300011119 | Bacteria | 2315 |
| 120 | Ga0157373_10221206 | 3300013100 | Bacteria | 1336 |
| 121 | Ga0157370_10079915 | 3300013104 | Bacteria | 3079 |
| 122 | Ga0157370_11134274 | 3300013104 | Bacteria | 706 |
| 123 | Ga0157369_10185397 | 3300013105 | Bacteria | 2188 |
| 124 | Ga0157369_10206150 | 3300013105 | Bacteria | 2062 |
| 125 | Ga0157374_10061400 | 3300013296 | Bacteria | 3520 |
| 126 | Ga0163162_10026189 | 3300013306 | Bacteria | 5764 |
| 127 | Ga0163162_10061803 | 3300013306 | Bacteria | 3784 |
| 128 | Ga0163162_10583675 | 3300013306 | Bacteria | 1244 |
| 129 | Ga0157375_10556350 | 3300013308 | Bacteria | 1308 |
| 130 | Ga0163163_10055860 | 3300014325 | Bacteria | 3903 |
| 131 | Ga0163163_10106415 | 3300014325 | Bacteria | 2831 |
| 132 | Ga0163163_12138590 | 3300014325 | Bacteria | 619 |
| 133 | Ga0182005_1108875 | 3300015265 | Bacteria | 782 |
| 134 | Ga0163161_10377745 | 3300017792 | Bacteria | 1132 |
| 135 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 136 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 137 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 138 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 139 | Ga0209563_103642 | 3300025230 | Bacteria | 3132 |
| 140 | Ga0209233_1008601 | 3300025261 | Bacteria | 3146 |
| 141 | Ga0209233_1017922 | 3300025261 | Bacteria | 1918 |
| 142 | Ga0209564_1018244 | 3300025295 | Bacteria | 2685 |
| 143 | Ga0209564_1019751 | 3300025295 | Bacteria | 2504 |
| 144 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 145 | Ga0209758_1001768 | 3300025297 | Bacteria | 23963 |
| 146 | Ga0209758_1004050 | 3300025297 | Bacteria | 12628 |
| 147 | Ga0209758_1007646 | 3300025297 | Bacteria | 7287 |
| 148 | Ga0209758_1114340 | 3300025297 | Bacteria | 740 |
| 149 | Ga0209256_1004722 | 3300025299 | Bacteria | 8339 |
| 150 | Ga0207426_1001107 | 3300025302 | Bacteria | 24820 |
| 151 | Ga0207426_1026026 | 3300025302 | Bacteria | 1964 |
| 152 | Ga0207426_1073848 | 3300025302 | Bacteria | 943 |
| 153 | Ga0209051_1045422 | 3300025303 | Bacteria | 1520 |
| 154 | Ga0209257_1002662 | 3300025304 | Bacteria | 17148 |
| 155 | Ga0209257_1026314 | 3300025304 | Bacteria | 1964 |
| 156 | Ga0207697_10023685 | 3300025315 | Bacteria | 2513 |
| 157 | Ga0207710_10017418 | 3300025900 | Bacteria | 3047 |
| 158 | Ga0207710_10019985 | 3300025900 | Bacteria | 2861 |
| 159 | Ga0207710_10347636 | 3300025900 | Bacteria | 755 |
| 160 | Ga0207688_10155218 | 3300025901 | Bacteria | 1354 |
| 161 | Ga0207647_10134992 | 3300025904 | Bacteria | 1448 |
| 162 | Ga0207654_10024818 | 3300025911 | Bacteria | 3227 |
| 163 | Ga0207707_10003260 | 3300025912 | Bacteria | 14418 |
| 164 | Ga0207707_10003603 | 3300025912 | Bacteria | 13734 |
| 165 | Ga0207695_10297720 | 3300025913 | Bacteria | 1505 |
| 166 | Ga0207671_10057777 | 3300025914 | Bacteria | 2876 |
| 167 | Ga0207671_10139839 | 3300025914 | Bacteria | 1865 |
| 168 | Ga0207671_10540347 | 3300025914 | Bacteria | 929 |
| 169 | Ga0207671_10727029 | 3300025914 | Bacteria | 789 |
| 170 | Ga0207693_10312729 | 3300025915 | Bacteria | 1230 |
| 171 | Ga0207663_11217728 | 3300025916 | Bacteria | 606 |
| 172 | Ga0207660_10342879 | 3300025917 | Bacteria | 1196 |
| 173 | Ga0207657_10012009 | 3300025919 | Bacteria | 8567 |
| 174 | Ga0207657_10028720 | 3300025919 | Bacteria | 5070 |
| 175 | Ga0207657_10440883 | 3300025919 | Bacteria | 1022 |
| 176 | Ga0207649_10122236 | 3300025920 | Bacteria | 1757 |
| 177 | Ga0207649_10489587 | 3300025920 | Bacteria | 934 |
| 178 | Ga0207652_10001857 | 3300025921 | Bacteria | 18344 |
| 179 | Ga0207652_10095685 | 3300025921 | Bacteria | 2616 |
| 180 | Ga0207681_10115332 | 3300025923 | Bacteria | 1961 |
| 181 | Ga0207694_10039124 | 3300025924 | Bacteria | 3648 |
| 182 | Ga0207694_10089000 | 3300025924 | Bacteria | 2434 |
| 183 | Ga0207694_10537791 | 3300025924 | Unclassified | 980 |
| 184 | Ga0207687_10456483 | 3300025927 | Bacteria | 1060 |
| 185 | Ga0207700_10004870 | 3300025928 | Bacteria | 7972 |
| 186 | Ga0207644_10044200 | 3300025931 | Bacteria | 3163 |
| 187 | Ga0207644_10309457 | 3300025931 | Bacteria | 1275 |
| 188 | Ga0207690_11095315 | 3300025932 | Bacteria | 664 |
| 189 | Ga0207706_10382150 | 3300025933 | Bacteria | 1222 |
| 190 | Ga0207709_10204047 | 3300025935 | Bacteria | 1414 |
| 191 | Ga0207670_10110368 | 3300025936 | Bacteria | 1981 |
| 192 | Ga0207665_10509451 | 3300025939 | Bacteria | 930 |
| 193 | Ga0207691_10418103 | 3300025940 | Bacteria | 1143 |
| 194 | Ga0207689_10406078 | 3300025942 | Bacteria | 1136 |
| 195 | Ga0207661_10344465 | 3300025944 | Bacteria | 1343 |
| 196 | Ga0207661_10426213 | 3300025944 | Bacteria | 1205 |
| 197 | Ga0207679_10372264 | 3300025945 | Bacteria | 1250 |
| 198 | Ga0207667_10060027 | 3300025949 | Bacteria | 3981 |
| 199 | Ga0207667_10071162 | 3300025949 | Bacteria | 3617 |
| 200 | Ga0207712_10355910 | 3300025961 | Bacteria | 1218 |
| 201 | Ga0207668_10136632 | 3300025972 | Bacteria | 1879 |
| 202 | Ga0207658_10160833 | 3300025986 | Bacteria | 1840 |
| 203 | Ga0207677_10108081 | 3300026023 | Bacteria | 2064 |
| 204 | Ga0207703_10666056 | 3300026035 | Bacteria | 988 |
| 205 | Ga0207703_10795917 | 3300026035 | Bacteria | 902 |
| 206 | Ga0207639_10083772 | 3300026041 | Bacteria | 2531 |
| 207 | Ga0207639_10218351 | 3300026041 | Bacteria | 1645 |
| 208 | Ga0207639_10230211 | 3300026041 | Bacteria | 1606 |
| 209 | Ga0207678_10060133 | 3300026067 | Bacteria | 3268 |
| 210 | Ga0207678_10177249 | 3300026067 | Bacteria | 1820 |
| 211 | Ga0207678_10358115 | 3300026067 | Bacteria | 1259 |
| 212 | Ga0207702_10083112 | 3300026078 | Bacteria | 2785 |
| 213 | Ga0207702_10462088 | 3300026078 | Bacteria | 1233 |
| 214 | Ga0207641_10509322 | 3300026088 | Bacteria | 1170 |
| 215 | Ga0207676_10967045 | 3300026095 | Bacteria | 838 |
| 216 | Ga0207674_10132679 | 3300026116 | Bacteria | 2453 |
| 217 | Ga0207674_10640442 | 3300026116 | Bacteria | 1026 |
| 218 | Ga0207683_10266888 | 3300026121 | Bacteria | 1563 |
| 219 | Ga0207698_10033713 | 3300026142 | Bacteria | 3724 |
| 220 | Ga0207698_10089235 | 3300026142 | Bacteria | 2517 |
| 221 | Ga0209389_1000040 | 3300027296 | Bacteria | 124256 |
| 222 | Ga0209389_1000123 | 3300027296 | Bacteria | 70041 |
| 223 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 224 | Ga0209589_1000036 | 3300027357 | Bacteria | 131278 |
| 225 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 226 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 227 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 228 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 229 | Ga0209813_10020077 | 3300027866 | Bacteria | 1865 |
| 230 | Ga0209813_10163541 | 3300027866 | Bacteria | 804 |
| 231 | Ga0268266_10325522 | 3300028379 | Bacteria | 1439 |
| 232 | Ga0268266_10727465 | 3300028379 | Bacteria | 957 |
| 233 | Ga0268265_10081543 | 3300028380 | Bacteria | 2555 |
| 234 | Ga0307413_10089201 | 3300031824 | Bacteria | 2003 |
| 235 | Ga0307411_10532155 | 3300032005 | Bacteria | 999 |
| 236 | Ga0307510_10014440 | 3300033180 | Bacteria | 9345 |
| 237 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 238 | Ga0373928_0125782 | 3300035084 | Bacteria | 691 |
| 239 | Ga0373944_0005698 | 3300035089 | Bacteria | 3286 |
| 240 | Ga0373923_0025408 | 3300035111 | Bacteria | 2347 |
| 241 | Ga0373923_0116466 | 3300035111 | Bacteria | 1190 |
| 242 | Ga0373936_0056776 | 3300035113 | Bacteria | 1591 |
| 243 | Ga0373939_0449670 | 3300035114 | Bacteria | 542 |
| 244 | Ga0373945_0005196 | 3300035116 | Bacteria | 4160 |
| 245 | Ga0373953_0036564 | 3300035117 | Bacteria | 1934 |
| 246 | Ga0373953_0341077 | 3300035117 | Bacteria | 656 |
| 247 | Ga0373954_0023809 | 3300035118 | Bacteria | 2788 |
| 248 | Ga0373956_0026692 | 3300035119 | Bacteria | 2503 |
| 249 | Ga0373956_0036543 | 3300035119 | Bacteria | 2168 |
| 250 | Ga0373957_0010704 | 3300035120 | Bacteria | 3040 |
| 251 | Ga0373946_0130335 | 3300035171 | Bacteria | 1156 |
| 252 | Ga0373946_0550163 | 3300035171 | Bacteria | 595 |
| 253 | Ga0373955_0028931 | 3300035172 | Bacteria | 2877 |
| 254 | Ga0373924_0061782 | 3300035410 | Bacteria | 1568 |
| 255 | Ga0373935_0200449 | 3300035692 | Bacteria | 1379 |
| 256 | Ga0373935_0586417 | 3300035692 | Bacteria | 814 |
| 257 | Ga0373933_0179705 | 3300035724 | Bacteria | 1349 |
| 258 | Ga0373947_0207066 | 3300035725 | Bacteria | 1285 |
| 259 | Ga0373937_0128498 | 3300036401 | Bacteria | 2365 |
| 260 | Ga0373937_0187021 | 3300036401 | Bacteria | 1945 |
| 261 | Ga0373925_0126944 | 3300037068 | Bacteria | 1985 |
| 262 | Ga0395899_0302526 | 3300037312 | Bacteria | 1082 |
| 263 | Ga0395900_0071844 | 3300037418 | Bacteria | 3558 |
| 264 | Ga0395900_1364142 | 3300037418 | Bacteria | 622 |
| 265 | Ga0395898_0046725 | 3300037466 | Bacteria | 4252 |
| 266 | Ga0395898_0126168 | 3300037466 | Bacteria | 2452 |
| 267 | Ga0395905_0001756 | 3300037471 | Bacteria | 25281 |
| 268 | Ga0395905_0047688 | 3300037471 | Bacteria | 4014 |
| 269 | Ga0395901_0602443 | 3300038443 | Bacteria | 1108 |
| 270 | Ga0395901_0836117 | 3300038443 | Bacteria | 907 |
| 271 | Ga0451791_1893118 | 3300041451 | Bacteria | 827 |
| 272 | Ga0451807_2629163 | 3300041486 | Bacteria | 943 |
| 273 | Ga0451835_0477346 | 3300041492 | Bacteria | 905 |
| 274 | Ga0451839_1247905 | 3300041496 | Bacteria | 603 |
| 275 | Ga0451849_1494901 | 3300041505 | Bacteria | 1113 |
| 276 | Ga0451853_1471601 | 3300041512 | Bacteria | 2693 |
| 277 | Ga0439431_0094488 | 3300041997 | Bacteria | 817 |
| 278 | Ga0439445_0136920 | 3300042004 | Bacteria | 709 |
| 279 | Ga0466972_0000122 | 3300044658 | Bacteria | 65679 |
| 280 | Ga0466965_0063626 | 3300044683 | Bacteria | 1846 |
| 281 | Ga0466965_0168149 | 3300044683 | Bacteria | 1152 |
| 282 | Ga0466965_0535224 | 3300044683 | Bacteria | 660 |
| 283 | Ga0466964_0217288 | 3300044706 | Bacteria | 926 |
| 284 | Ga0466964_0858726 | 3300044706 | Bacteria | 517 |
| 285 | Ga0466957_0896358 | 3300044842 | Bacteria | 634 |
| 286 | Ga0466967_0656202 | 3300045976 | Bacteria | 1038 |
| 287 | Ga0495592_0088121 | 3300046454 | Bacteria | 2231 |
| 288 | Ga0495592_0270697 | 3300046454 | Bacteria | 1115 |
| 289 | Ga0495603_0113041 | 3300046455 | Bacteria | 1583 |
| 290 | Ga0495603_0524214 | 3300046455 | Bacteria | 679 |
| 291 | Ga0495590_0077096 | 3300046457 | Bacteria | 1173 |
| 292 | Ga0495638_0006220 | 3300046460 | Bacteria | 8715 |
| 293 | Ga0495651_0064755 | 3300046462 | Bacteria | 2793 |
| 294 | Ga0495653_0090036 | 3300046463 | Bacteria | 2246 |
| 295 | Ga0495653_0665908 | 3300046463 | Bacteria | 635 |
| 296 | Ga0495650_0230755 | 3300046471 | Bacteria | 635 |
| 297 | Ga0495605_0083378 | 3300046474 | Bacteria | 1492 |
| 298 | Ga0495639_0230408 | 3300046475 | Bacteria | 912 |
| 299 | Ga0495639_0271372 | 3300046475 | Bacteria | 842 |
| 300 | Ga0495662_0031332 | 3300046476 | Bacteria | 2569 |
| 301 | Ga0495664_0014962 | 3300046477 | Bacteria | 4405 |
| 302 | Ga0495664_0256880 | 3300046477 | Bacteria | 1056 |
| 303 | Ga0495585_0098238 | 3300046492 | Bacteria | 1569 |
| 304 | Ga0495594_0039280 | 3300046499 | Bacteria | 2588 |
| 305 | Ga0495596_0099878 | 3300046500 | Bacteria | 1127 |
| 306 | Ga0495596_0105587 | 3300046500 | Bacteria | 1094 |
| 307 | Ga0495583_0422553 | 3300046506 | Bacteria | 523 |
| 308 | Ga0495606_0115424 | 3300046507 | Bacteria | 1614 |
| 309 | Ga0495606_0174122 | 3300046507 | Bacteria | 1246 |
| 310 | Ga0495606_0196577 | 3300046507 | Bacteria | 1152 |
| 311 | Ga0495608_0055907 | 3300046511 | Bacteria | 2607 |
| 312 | Ga0495610_0056970 | 3300046512 | Bacteria | 1877 |
| 313 | Ga0495610_0101021 | 3300046512 | Bacteria | 1292 |
| 314 | Ga0495618_0033162 | 3300046514 | Bacteria | 3237 |
| 315 | Ga0495618_0062804 | 3300046514 | Bacteria | 2357 |
| 316 | Ga0495628_0050841 | 3300046516 | Bacteria | 3278 |
| 317 | Ga0495628_0066723 | 3300046516 | Bacteria | 2812 |
| 318 | Ga0495628_0499106 | 3300046516 | Bacteria | 879 |
| 319 | Ga0495630_0084762 | 3300046517 | Bacteria | 2392 |
| 320 | Ga0495631_0077768 | 3300046518 | Bacteria | 1432 |
| 321 | Ga0495631_0129012 | 3300046518 | Bacteria | 1087 |
| 322 | Ga0495632_0029344 | 3300046519 | Bacteria | 2865 |
| 323 | Ga0495632_0258233 | 3300046519 | Bacteria | 780 |
| 324 | Ga0495643_0005870 | 3300046522 | Bacteria | 8212 |
| 325 | Ga0495643_0138246 | 3300046522 | Bacteria | 1217 |
| 326 | Ga0495648_0057102 | 3300046524 | Bacteria | 2344 |
| 327 | Ga0495648_0090173 | 3300046524 | Bacteria | 1719 |
| 328 | Ga0495652_0109203 | 3300046529 | Bacteria | 2227 |
| 329 | Ga0495652_0174994 | 3300046529 | Bacteria | 1653 |
| 330 | Ga0495665_0021744 | 3300046531 | Bacteria | 3450 |
| 331 | Ga0495640_0013662 | 3300046533 | Bacteria | 6171 |
| 332 | Ga0495640_0095043 | 3300046533 | Bacteria | 1962 |
| 333 | Ga0495586_0113104 | 3300046535 | Bacteria | 1512 |
| 334 | Ga0495587_0074078 | 3300046536 | Bacteria | 1977 |
| 335 | Ga0495587_0359559 | 3300046536 | Bacteria | 811 |
| 336 | Ga0495609_0141239 | 3300046538 | Bacteria | 1028 |
| 337 | Ga0495645_0021210 | 3300046543 | Bacteria | 4695 |
| 338 | Ga0495622_0086519 | 3300046557 | Bacteria | 1441 |
| 339 | Ga0495667_0007037 | 3300046559 | Bacteria | 7634 |
| 340 | Ga0495656_0121423 | 3300046615 | Bacteria | 1234 |
| 341 | Ga0495668_0030154 | 3300046616 | Bacteria | 3064 |
| 342 | Ga0495668_0115543 | 3300046616 | Bacteria | 1468 |
| 343 | Ga0495668_0144289 | 3300046616 | Bacteria | 1303 |
| 344 | Ga0495634_0267809 | 3300046642 | Bacteria | 1040 |
| 345 | Ga0495611_0040090 | 3300046648 | Bacteria | 2087 |
| 346 | Ga0495611_0086149 | 3300046648 | Bacteria | 1449 |
| 347 | Ga0495625_0035331 | 3300046660 | Bacteria | 3685 |
| 348 | Ga0495635_0048856 | 3300046663 | Bacteria | 2916 |
| 349 | Ga0495661_0110974 | 3300046665 | Bacteria | 1529 |
| 350 | Ga0495661_0179489 | 3300046665 | Bacteria | 1123 |
| 351 | Ga0495588_0160594 | 3300046674 | Bacteria | 1189 |
| 352 | Ga0495657_0714684 | 3300046675 | Bacteria | 575 |
| 353 | Ga0495599_0044339 | 3300046678 | Bacteria | 2789 |
| 354 | Ga0495623_0042610 | 3300046679 | Bacteria | 2891 |
| 355 | Ga0495646_0031778 | 3300046680 | Bacteria | 3288 |
| 356 | Ga0495646_0065546 | 3300046680 | Bacteria | 2150 |
| 357 | Ga0495658_0506004 | 3300046683 | Bacteria | 773 |
| 358 | Ga0495669_0147151 | 3300046684 | Bacteria | 1114 |
| 359 | Ga0495671_0044078 | 3300046692 | Bacteria | 2238 |
| 360 | Ga0495660_0195233 | 3300046810 | Bacteria | 970 |
| 361 | Ga0495581_0024060 | 3300047315 | Bacteria | 3529 |
| 362 | Ga0495581_0103342 | 3300047315 | Bacteria | 1656 |
| 363 | Ga0495604_0017963 | 3300047317 | Bacteria | 5659 |
| 364 | Ga0495604_0253469 | 3300047317 | Bacteria | 1199 |
| 365 | Ga0495674_0017800 | 3300047319 | Bacteria | 6616 |
| 366 | Ga0495674_0197401 | 3300047319 | Bacteria | 1670 |
| 367 | Ga0495674_0240474 | 3300047319 | Bacteria | 1492 |
| 368 | Ga0495674_0410543 | 3300047319 | Bacteria | 1092 |
| 369 | Ga0495676_0053391 | 3300047321 | Bacteria | 3221 |
| 370 | Ga0495680_0072319 | 3300047322 | Bacteria | 2623 |
| 371 | Ga0495687_011356 | 3300047443 | Bacteria | 4798 |
| 372 | Ga0495687_090350 | 3300047443 | Bacteria | 1174 |
| 373 | Ga0495675_0058341 | 3300047444 | Bacteria | 2447 |
| 374 | Ga0495675_0570834 | 3300047444 | Bacteria | 644 |
| 375 | Ga0495673_0211121 | 3300047469 | Bacteria | 722 |
| 376 | Ga0495681_0193137 | 3300047470 | Bacteria | 830 |
| 377 | Ga0495684_0066747 | 3300047471 | Bacteria | 2735 |
| 378 | Ga0495686_0019599 | 3300047472 | Bacteria | 4520 |
| 379 | Ga0495686_0096280 | 3300047472 | Bacteria | 1792 |
| 380 | Ga0495686_0103351 | 3300047472 | Bacteria | 1716 |
| 381 | Ga0495686_0680715 | 3300047472 | Bacteria | 526 |
| 382 | Ga0495593_0004557 | 3300047673 | Bacteria | 8236 |
| 383 | Ga0495602_0058117 | 3300048088 | Bacteria | 3388 |
| 384 | Ga0495602_0600538 | 3300048088 | Bacteria | 757 |
| 385 | Ga0495626_0148163 | 3300048091 | Bacteria | 991 |
| 386 | Ga0495626_0245795 | 3300048091 | Bacteria | 719 |
| 387 | Ga0496100_0160095 | 3300048903 | Bacteria | 1613 |
| 388 | Ga0496100_0202830 | 3300048903 | Bacteria | 1446 |
| 389 | Ga0496100_0237340 | 3300048903 | Bacteria | 1344 |
| 390 | Ga0496101_0040220 | 3300048904 | Bacteria | 3330 |
| 391 | Ga0496101_0137064 | 3300048904 | Bacteria | 1863 |
| 392 | Ga0496101_0149953 | 3300048904 | Bacteria | 1783 |
| 393 | Ga0496102_0065738 | 3300048905 | Bacteria | 3324 |
| 394 | Ga0496102_0122301 | 3300048905 | Bacteria | 2431 |
| 395 | Ga0496102_0139125 | 3300048905 | Bacteria | 2276 |
| 396 | Ga0496104_0007469 | 3300048907 | Bacteria | 9661 |
| 397 | Ga0496104_0108918 | 3300048907 | Bacteria | 2655 |
| 398 | Ga0496105_0028038 | 3300048908 | Bacteria | 4605 |
| 399 | Ga0496105_0041046 | 3300048908 | Bacteria | 3814 |
| 400 | Ga0496105_0073134 | 3300048908 | Bacteria | 2832 |
| 401 | Ga0496105_0512593 | 3300048908 | Bacteria | 940 |
| 402 | Ga0496106_0111610 | 3300048909 | Bacteria | 2129 |
| 403 | Ga0496107_0085584 | 3300048910 | Bacteria | 2300 |
| 404 | Ga0496108_0013623 | 3300048911 | Bacteria | 6639 |
| 405 | Ga0496108_0179760 | 3300048911 | Bacteria | 1832 |
| 406 | Ga0496108_0998654 | 3300048911 | Bacteria | 715 |
| 407 | Ga0496109_0036450 | 3300048912 | Bacteria | 4439 |
| 408 | Ga0496109_0077439 | 3300048912 | Bacteria | 3060 |
| 409 | Ga0496109_0277031 | 3300048912 | Bacteria | 1581 |
| 410 | Ga0496109_0714287 | 3300048912 | Bacteria | 940 |
| 411 | Ga0496110_0047316 | 3300048913 | Bacteria | 3766 |
| 412 | Ga0496110_0048248 | 3300048913 | Bacteria | 3733 |
| 413 | Ga0496110_0069938 | 3300048913 | Bacteria | 3109 |
| 414 | Ga0496111_0370636 | 3300048914 | Bacteria | 1059 |
| 415 | Ga0496111_0499899 | 3300048914 | Bacteria | 895 |
| 416 | Ga0496112_0015856 | 3300048915 | Bacteria | 7042 |
| 417 | Ga0496112_0035695 | 3300048915 | Bacteria | 4845 |
| 418 | Ga0496112_0244486 | 3300048915 | Bacteria | 1746 |
| 419 | Ga0496113_0034546 | 3300048916 | Bacteria | 3689 |
| 420 | Ga0496113_0058559 | 3300048916 | Bacteria | 2899 |
| 421 | Ga0496113_0075542 | 3300048916 | Bacteria | 2572 |
| 422 | Ga0496113_0536033 | 3300048916 | Bacteria | 939 |
| 423 | Ga0496114_0043573 | 3300048917 | Bacteria | 3721 |
| 424 | Ga0496114_0453155 | 3300048917 | Bacteria | 1136 |
| 425 | Ga0496115_0230094 | 3300048918 | Bacteria | 1529 |
| 426 | Ga0496116_0082110 | 3300048919 | Bacteria | 1995 |
| 427 | Ga0496117_0051706 | 3300048920 | Bacteria | 2902 |
| 428 | Ga0496117_0300584 | 3300048920 | Bacteria | 850 |
| 429 | Ga0496118_0033666 | 3300048921 | Bacteria | 4199 |
| 430 | Ga0496118_0055688 | 3300048921 | Bacteria | 2981 |
| 431 | Ga0496119_0056073 | 3300048922 | Bacteria | 2389 |
| 432 | Ga0496119_0068253 | 3300048922 | Bacteria | 2094 |
| 433 | Ga0496120_0018899 | 3300048923 | Bacteria | 4427 |
| 434 | Ga0496120_0334003 | 3300048923 | Bacteria | 685 |
| 435 | Ga0496121_0022110 | 3300048924 | Bacteria | 6188 |
| 436 | Ga0496121_0055482 | 3300048924 | Bacteria | 3300 |
| 437 | Ga0496121_0067329 | 3300048924 | Bacteria | 2903 |
| 438 | Ga0496121_0235008 | 3300048924 | Bacteria | 1281 |
| 439 | Ga0496121_0363026 | 3300048924 | Bacteria | 961 |
| 440 | Ga0496121_0457168 | 3300048924 | Bacteria | 821 |
| 441 | Ga0496125_0125900 | 3300048928 | Bacteria | 1816 |
| 442 | Ga0501031_0100876 | 3300049568 | Bacteria | 1883 |
| 443 | Ga0501031_0332633 | 3300049568 | Bacteria | 983 |
| 444 | Ga0501032_0037191 | 3300049569 | Bacteria | 3319 |
| 445 | Ga0501034_0728315 | 3300049571 | Bacteria | 888 |
| 446 | Ga0501036_0437130 | 3300049572 | Bacteria | 1090 |
| 447 | Ga0501046_0080505 | 3300049580 | Bacteria | 2517 |
| 448 | Ga0501046_0648392 | 3300049580 | Bacteria | 747 |
| 449 | Ga0501067_0332818 | 3300049583 | Unclassified | 846 |
| 450 | Ga0501070_0596772 | 3300049586 | Bacteria | 880 |
| 451 | Ga0501074_0052198 | 3300049590 | Bacteria | 2952 |
| 452 | Ga0501080_0074727 | 3300049742 | Bacteria | 3152 |
| 453 | Ga0501080_0130977 | 3300049742 | Bacteria | 2322 |
| 454 | Ga0501044_0376152 | 3300049823 | Bacteria | 1336 |
| 455 | nmdc:mga03n38_188376_c1 | 3300050490 | Bacteria | 1061 |
| 456 | nmdc:mga00v17_61809_c1 | 3300050491 | Bacteria | 2303 |
| 457 | nmdc:mga0yw44_101435_c1 | 3300050492 | Bacteria | 1834 |
| 458 | nmdc:mga0yw44_129668_c1 | 3300050492 | Bacteria | 1631 |
| 459 | nmdc:mga0yw44_177714_c1 | 3300050492 | Bacteria | 1400 |
| 460 | nmdc:mga0k408_36783_c1 | 3300050493 | Bacteria | 2810 |
| 461 | nmdc:mga06z11_28852_c1 | 3300050494 | Bacteria | 2667 |
| 462 | nmdc:mga04h51_189442_c1 | 3300050495 | Bacteria | 804 |
| 463 | nmdc:mga04h51_22672_c1 | 3300050495 | Bacteria | 1903 |
| 464 | nmdc:mga07m45_454666_c1 | 3300050496 | Bacteria | 742 |
| 465 | nmdc:mga07m45_8643_c1 | 3300050496 | Bacteria | 5244 |
| 466 | nmdc:mga0n895_70689_c1 | 3300050512 | Bacteria | 3459 |
| 467 | nmdc:mga0rr50_518172_c1 | 3300050513 | Bacteria | 1014 |
| 468 | nmdc:mga0sz30_174023_c1 | 3300050516 | Bacteria | 954 |
| 469 | nmdc:mga0sz30_55658_c1 | 3300050516 | Bacteria | 1684 |
| 470 | Ga0495601_0021200 | 3300053077 | Bacteria | 3978 |
| 471 | Ga0495601_0065495 | 3300053077 | Bacteria | 2313 |
| 472 | Ga0495601_0073139 | 3300053077 | Bacteria | 2191 |
| 473 | Ga0495612_0014786 | 3300053078 | Bacteria | 3132 |
| 474 | Ga0500635_0100518 | 3300053080 | Bacteria | 1063 |
| 475 | Ga0495595_0232064 | 3300053084 | Bacteria | 922 |
| 476 | Ga0495595_0242977 | 3300053084 | Bacteria | 901 |
| 477 | Ga0495619_0067470 | 3300053085 | Bacteria | 2389 |
| 478 | Ga0500578_0059588 | 3300053086 | Bacteria | 2439 |
| 479 | Ga0500578_0543686 | 3300053086 | Bacteria | 647 |
| 480 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 481 | Ga0500583_0041239 | 3300053092 | Bacteria | 2095 |
| 482 | Ga0500651_0233519 | 3300053093 | Bacteria | 1075 |
| 483 | Ga0500651_0338794 | 3300053093 | Bacteria | 855 |
| 484 | Ga0500651_0595285 | 3300053093 | Bacteria | 600 |
| 485 | Ga0500566_0001359 | 3300053094 | Bacteria | 14314 |
| 486 | Ga0500566_0338991 | 3300053094 | Bacteria | 693 |
| 487 | Ga0500640_075214 | 3300053095 | Bacteria | 1442 |
| 488 | Ga0500555_012606 | 3300053103 | Bacteria | 2434 |
| 489 | Ga0500556_0023338 | 3300053104 | Bacteria | 2019 |
| 490 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 491 | Ga0500569_006323 | 3300053109 | Bacteria | 2597 |
| 492 | Ga0500569_143764 | 3300053109 | Bacteria | 803 |
| 493 | Ga0500572_000619 | 3300053111 | Bacteria | 11919 |
| 494 | Ga0500572_042027 | 3300053111 | Bacteria | 1330 |
| 495 | Ga0500592_019082 | 3300053116 | Bacteria | 1101 |
| 496 | Ga0500607_034406 | 3300053121 | Bacteria | 2774 |
| 497 | Ga0500608_096171 | 3300053122 | Bacteria | 1377 |
| 498 | Ga0500614_068093 | 3300053123 | Bacteria | 971 |
| 499 | Ga0500626_168656 | 3300053128 | Bacteria | 893 |
| 500 | Ga0500642_0000133 | 3300053130 | Bacteria | 33202 |
| 501 | Ga0500642_0003332 | 3300053130 | Bacteria | 4841 |
| 502 | Ga0500652_030127 | 3300053131 | Bacteria | 2121 |
| 503 | Ga0500658_0067266 | 3300053134 | Bacteria | 1504 |
| 504 | Ga0500559_0000143 | 3300053136 | Bacteria | 55572 |
| 505 | Ga0500559_0098772 | 3300053136 | Bacteria | 1343 |
| 506 | Ga0500568_0028188 | 3300053139 | Bacteria | 2342 |
| 507 | Ga0500585_220876 | 3300053144 | Bacteria | 619 |
| 508 | Ga0500588_0182140 | 3300053146 | Bacteria | 772 |
| 509 | Ga0500589_105608 | 3300053147 | Bacteria | 1217 |
| 510 | Ga0500603_100822 | 3300053150 | Bacteria | 858 |
| 511 | Ga0500616_0041758 | 3300053153 | Bacteria | 2459 |
| 512 | Ga0500619_026514 | 3300053154 | Bacteria | 1726 |
| 513 | Ga0500620_042237 | 3300053155 | Bacteria | 1501 |
| 514 | Ga0500622_0005064 | 3300053156 | Bacteria | 8022 |
| 515 | Ga0500624_051945 | 3300053157 | Bacteria | 765 |
| 516 | Ga0500627_0189762 | 3300053158 | Bacteria | 923 |
| 517 | Ga0500639_091338 | 3300053163 | Bacteria | 1516 |
| 518 | Ga0500639_138471 | 3300053163 | Bacteria | 1142 |
| 519 | Ga0500636_0005675 | 3300053177 | Bacteria | 7136 |
| 520 | Ga0500576_021443 | 3300053725 | Bacteria | 2949 |
| 521 | Ga0500625_008128 | 3300053729 | Bacteria | 4609 |
| 522 | Ga0500645_032606 | 3300053730 | Bacteria | 1561 |
| 523 | Ga0500596_012989 | 3300053735 | Bacteria | 1259 |
| 524 | Ga0500596_052729 | 3300053735 | Bacteria | 668 |
| 525 | Ga0500599_000373 | 3300053736 | Bacteria | 4512 |
| 526 | Ga0500601_000171 | 3300053737 | Bacteria | 13465 |
| 527 | Ga0500661_009767 | 3300055283 | Bacteria | 1752 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046675 | Ga0495657_0714684 | Ga0495657_0714684_188_544 | 116 |
| 2 | 3300049568 | Ga0501031_0332633 | Ga0501031_0332633_604_963 | 116 |
| 3 | 3300005339 | Ga0070660_100134022 | Ga0070660_1001340221 | 124 |
| 4 | 3300005344 | Ga0070661_100641667 | Ga0070661_1006416671 | 124 |
| 5 | 3300005365 | Ga0070688_100298749 | Ga0070688_1002987491 | 124 |
| 6 | 3300005439 | Ga0070711_100129585 | Ga0070711_1001295852 | 124 |
| 7 | 3300005547 | Ga0070693_100668544 | Ga0070693_1006685441 | 124 |
| 8 | 3300005614 | Ga0068856_100323756 | Ga0068856_1003237562 | 124 |
| 9 | 3300005841 | Ga0068863_100760239 | Ga0068863_1007602392 | 124 |
| 10 | 3300009174 | Ga0105241_10461147 | Ga0105241_104611472 | 124 |
| 11 | 3300009553 | Ga0105249_10438646 | Ga0105249_104386462 | 124 |
| 12 | 3300010375 | Ga0105239_10106865 | Ga0105239_101068652 | 124 |
| 13 | 3300013306 | Ga0163162_10061803 | Ga0163162_100618033 | 124 |
| 14 | 3300025919 | Ga0207657_10440883 | Ga0207657_104408832 | 124 |
| 15 | 3300025931 | Ga0207644_10309457 | Ga0207644_103094572 | 124 |
| 16 | 3300025936 | Ga0207670_10110368 | Ga0207670_101103682 | 124 |
| 17 | 3300025961 | Ga0207712_10355910 | Ga0207712_103559102 | 124 |
| 18 | 3300026078 | Ga0207702_10462088 | Ga0207702_104620881 | 124 |
| 19 | 3300035084 | Ga0373928_0125782 | Ga0373928_0125782_32_613 | 124 |
| 20 | 3300048903 | Ga0496100_0237340 | Ga0496100_0237340_11_592 | 124 |
| 21 | 3300048904 | Ga0496101_0137064 | Ga0496101_0137064_454_1035 | 124 |
| 22 | 3300048905 | Ga0496102_0139125 | Ga0496102_0139125_1258_1839 | 124 |
| 23 | 3300048907 | Ga0496104_0007469 | Ga0496104_0007469_1841_2422 | 124 |
| 24 | 3300048908 | Ga0496105_0041046 | Ga0496105_0041046_2133_2714 | 124 |
| 25 | 3300048911 | Ga0496108_0013623 | Ga0496108_0013623_2385_2966 | 124 |
| 26 | 3300048912 | Ga0496109_0036450 | Ga0496109_0036450_1233_1814 | 124 |
| 27 | 3300048913 | Ga0496110_0048248 | Ga0496110_0048248_2219_2800 | 124 |
| 28 | 3300048915 | Ga0496112_0035695 | Ga0496112_0035695_3020_3601 | 124 |
| 29 | 3300048916 | Ga0496113_0075542 | Ga0496113_0075542_1443_2024 | 124 |
| 30 | 3300048917 | Ga0496114_0453155 | Ga0496114_0453155_244_825 | 124 |
| 31 | 3300009551 | Ga0105238_10385424 | Ga0105238_103854242 | 126 |
| 32 | 3300025924 | Ga0207694_10537791 | Ga0207694_105377912 | 126 |
| 33 | 3300038443 | Ga0395901_0602443 | Ga0395901_0602443_298_780 | 126 |
| 34 | 3300003203 | JGI25406J46586_10027537 | JGI25406J46586_100275372 | 130 |
| 35 | 3300047470 | Ga0495681_0193137 | Ga0495681_0193137_372_809 | 130 |
| 36 | 3300009098 | Ga0105245_11133332 | Ga0105245_111333322 | 131 |
| 37 | 3300046516 | Ga0495628_0499106 | Ga0495628_0499106_100_504 | 133 |
| 38 | 3300046529 | Ga0495652_0174994 | Ga0495652_0174994_1172_1576 | 133 |
| 39 | 3300047317 | Ga0495604_0253469 | Ga0495604_0253469_206_610 | 133 |
| 40 | 3300047319 | Ga0495674_0410543 | Ga0495674_0410543_322_726 | 133 |
| 41 | 3300053077 | Ga0495601_0065495 | Ga0495601_0065495_1885_2289 | 133 |
| 42 | 3300053084 | Ga0495595_0242977 | Ga0495595_0242977_282_692 | 133 |
| 43 | 3300053093 | Ga0500651_0595285 | Ga0500651_0595285_126_548 | 133 |
| 44 | 3300053109 | Ga0500569_006323 | Ga0500569_006323_73_495 | 133 |
| 45 | 3300009101 | Ga0105247_10026105 | Ga0105247_100261052 | 134 |
| 46 | 3300035171 | Ga0373946_0130335 | Ga0373946_0130335_353_757 | 134 |
| 47 | 3300035725 | Ga0373947_0207066 | Ga0373947_0207066_591_995 | 134 |
| 48 | 3300044706 | Ga0466964_0858726 | Ga0466964_0858726_83_487 | 134 |
| 49 | 3300044842 | Ga0466957_0896358 | Ga0466957_0896358_36_440 | 134 |
| 50 | 3300046455 | Ga0495603_0113041 | Ga0495603_0113041_976_1380 | 134 |
| 51 | 3300046500 | Ga0495596_0099878 | Ga0495596_0099878_438_842 | 134 |
| 52 | 3300046506 | Ga0495583_0422553 | Ga0495583_0422553_92_496 | 134 |
| 53 | 3300046518 | Ga0495631_0129012 | Ga0495631_0129012_27_431 | 134 |
| 54 | 3300046615 | Ga0495656_0121423 | Ga0495656_0121423_283_687 | 134 |
| 55 | 3300046616 | Ga0495668_0115543 | Ga0495668_0115543_602_1006 | 134 |
| 56 | 3300047315 | Ga0495581_0103342 | Ga0495581_0103342_556_960 | 134 |
| 57 | 3300048088 | Ga0495602_0600538 | Ga0495602_0600538_180_590 | 134 |
| 58 | 3300049568 | Ga0501031_0100876 | Ga0501031_0100876_297_710 | 134 |
| 59 | 3300049569 | Ga0501032_0037191 | Ga0501032_0037191_1903_2316 | 134 |
| 60 | 3300049571 | Ga0501034_0728315 | Ga0501034_0728315_141_554 | 134 |
| 61 | 3300049572 | Ga0501036_0437130 | Ga0501036_0437130_101_514 | 134 |
| 62 | 3300049580 | Ga0501046_0080505 | Ga0501046_0080505_1383_1862 | 134 |
| 63 | 3300049583 | Ga0501067_0332818 | Ga0501067_0332818_252_731 | 134 |
| 64 | 3300049742 | Ga0501080_0130977 | Ga0501080_0130977_199_678 | 134 |
| 65 | 3300053111 | Ga0500572_000619 | Ga0500572_000619_5646_6050 | 134 |
| 66 | 3300053136 | Ga0500559_0000143 | Ga0500559_0000143_1043_1447 | 134 |
| 67 | 3300053163 | Ga0500639_091338 | Ga0500639_091338_525_929 | 134 |
| 68 | 3300053725 | Ga0500576_021443 | Ga0500576_021443_867_1271 | 134 |
| 69 | 3300053735 | Ga0500596_012989 | Ga0500596_012989_225_629 | 134 |
| 70 | iso_pu_bacteria | 2513237096 | 2513657101 | 135 |
| 71 | iso_pu_bacteria | 2513237137 | 2513855543 | 135 |
| 72 | iso_pu_bacteria | 2513237145 | 2513918841 | 135 |
| 73 | iso_pu_bacteria | 2517572143 | 2517892088 | 135 |
| 74 | iso_pu_bacteria | 2524023228 | 2524534172 | 135 |
| 75 | iso_pu_bacteria | 2667528175 | 2671121874 | 135 |
| 76 | iso_pu_bacteria | 2791355197 | 2793068827 | 135 |
| 77 | iso_pu_bacteria | 2903748898 | 2903753398 | 135 |
| 78 | iso_pu_bacteria | 2935630451 | 2935631225 | 135 |
| 79 | iso_pu_bacteria | 3005474847 | 3005480521 | 135 |
| 80 | iso_pu_bacteria | 8006933436 | 8006940255 | 135 |
| 81 | 3300003354 | JGI25160J50197_1008227 | JGI25160J50197_10082272 | 136 |
| 82 | 3300005262 | Ga0065165_1001403 | Ga0065165_100140322 | 136 |
| 83 | 3300025302 | Ga0207426_1001107 | Ga0207426_100110712 | 136 |
| 84 | 3300049580 | Ga0501046_0648392 | Ga0501046_0648392_55_474 | 136 |
| 85 | 3300049586 | Ga0501070_0596772 | Ga0501070_0596772_189_608 | 136 |
| 86 | 3300049590 | Ga0501074_0052198 | Ga0501074_0052198_400_819 | 136 |
| 87 | 3300049742 | Ga0501080_0074727 | Ga0501080_0074727_485_904 | 136 |
| 88 | 3300049823 | Ga0501044_0376152 | Ga0501044_0376152_880_1299 | 136 |
| 89 | iso_pu_bacteria | 2885374607 | 2885381720 | 136 |
| 90 | iso_pu_bacteria | 2904699407 | 2904702210 | 136 |
| 91 | iso_pu_bacteria | 2906610324 | 2906617219 | 136 |
| 92 | iso_pu_bacteria | 2906635258 | 2906643392 | 136 |
| 93 | iso_pu_bacteria | 2906660503 | 2906662477 | 136 |
| 94 | iso_pu_bacteria | 2908739725 | 2908742368 | 136 |
| 95 | iso_pu_bacteria | 2922425934 | 2922430610 | 136 |
| 96 | iso_pu_bacteria | 2941507105 | 2941509966 | 136 |
| 97 | iso_pu_bacteria | 2941515067 | 2941518947 | 136 |
| 98 | iso_pu_bacteria | 2941523033 | 2941525365 | 136 |
| 99 | 3300036401 | Ga0373937_0128498 | Ga0373937_0128498_83_496 | 137 |
| 100 | 3300046516 | Ga0495628_0050841 | Ga0495628_0050841_1910_2323 | 137 |
| 101 | 3300046680 | Ga0495646_0065546 | Ga0495646_0065546_944_1357 | 137 |
| 102 | 3300047319 | Ga0495674_0017800 | Ga0495674_0017800_5970_6383 | 137 |
| 103 | iso_pu_bacteria | 2874604998 | 2874605518 | 137 |
| 104 | iso_pu_bacteria | 2889033259 | 2889039460 | 137 |
| 105 | iso_pu_bacteria | 2904690495 | 2904694846 | 137 |
| 106 | iso_pu_bacteria | 2908756301 | 2908760012 | 137 |
| 107 | iso_pu_bacteria | 2922386360 | 2922391268 | 137 |
| 108 | iso_pu_bacteria | 8056689827 | 8056694261 | 137 |
| 109 | 3300006028 | Ga0070717_10324065 | Ga0070717_103240653 | 138 |
| 110 | 3300007788 | Ga0099795_10085811 | Ga0099795_100858111 | 138 |
| 111 | 3300013100 | Ga0157373_10221206 | Ga0157373_102212062 | 138 |
| 112 | 3300035111 | Ga0373923_0025408 | Ga0373923_0025408_711_1142 | 138 |
| 113 | 3300035117 | Ga0373953_0036564 | Ga0373953_0036564_1424_1855 | 138 |
| 114 | 3300035118 | Ga0373954_0023809 | Ga0373954_0023809_755_1186 | 138 |
| 115 | 3300035119 | Ga0373956_0026692 | Ga0373956_0026692_1916_2347 | 138 |
| 116 | 3300035120 | Ga0373957_0010704 | Ga0373957_0010704_389_820 | 138 |
| 117 | 3300035171 | Ga0373946_0550163 | Ga0373946_0550163_93_524 | 138 |
| 118 | 3300035172 | Ga0373955_0028931 | Ga0373955_0028931_658_1089 | 138 |
| 119 | 3300035410 | Ga0373924_0061782 | Ga0373924_0061782_911_1342 | 138 |
| 120 | 3300035692 | Ga0373935_0200449 | Ga0373935_0200449_755_1186 | 138 |
| 121 | 3300036401 | Ga0373937_0187021 | Ga0373937_0187021_413_844 | 138 |
| 122 | 3300044683 | Ga0466965_0168149 | Ga0466965_0168149_583_999 | 138 |
| 123 | 3300045976 | Ga0466967_0656202 | Ga0466967_0656202_181_597 | 138 |
| 124 | 3300046454 | Ga0495592_0088121 | Ga0495592_0088121_1626_2057 | 138 |
| 125 | 3300046462 | Ga0495651_0064755 | Ga0495651_0064755_1655_2086 | 138 |
| 126 | 3300046463 | Ga0495653_0090036 | Ga0495653_0090036_1431_1862 | 138 |
| 127 | 3300046475 | Ga0495639_0271372 | Ga0495639_0271372_256_678 | 138 |
| 128 | 3300046476 | Ga0495662_0031332 | Ga0495662_0031332_25_456 | 138 |
| 129 | 3300046477 | Ga0495664_0256880 | Ga0495664_0256880_448_879 | 138 |
| 130 | 3300046511 | Ga0495608_0055907 | Ga0495608_0055907_1572_2003 | 138 |
| 131 | 3300046514 | Ga0495618_0033162 | Ga0495618_0033162_2070_2501 | 138 |
| 132 | 3300046516 | Ga0495628_0066723 | Ga0495628_0066723_1341_1772 | 138 |
| 133 | 3300046517 | Ga0495630_0084762 | Ga0495630_0084762_733_1164 | 138 |
| 134 | 3300046529 | Ga0495652_0109203 | Ga0495652_0109203_614_1045 | 138 |
| 135 | 3300046533 | Ga0495640_0095043 | Ga0495640_0095043_492_923 | 138 |
| 136 | 3300046536 | Ga0495587_0074078 | Ga0495587_0074078_1134_1565 | 138 |
| 137 | 3300046543 | Ga0495645_0021210 | Ga0495645_0021210_1661_2092 | 138 |
| 138 | 3300046559 | Ga0495667_0007037 | Ga0495667_0007037_6145_6576 | 138 |
| 139 | 3300046642 | Ga0495634_0267809 | Ga0495634_0267809_265_696 | 138 |
| 140 | 3300046663 | Ga0495635_0048856 | Ga0495635_0048856_1739_2170 | 138 |
| 141 | 3300046678 | Ga0495599_0044339 | Ga0495599_0044339_1754_2185 | 138 |
| 142 | 3300046679 | Ga0495623_0042610 | Ga0495623_0042610_1046_1477 | 138 |
| 143 | 3300046680 | Ga0495646_0031778 | Ga0495646_0031778_853_1284 | 138 |
| 144 | 3300046683 | Ga0495658_0506004 | Ga0495658_0506004_182_613 | 138 |
| 145 | 3300047317 | Ga0495604_0017963 | Ga0495604_0017963_843_1274 | 138 |
| 146 | 3300047319 | Ga0495674_0197401 | Ga0495674_0197401_827_1258 | 138 |
| 147 | 3300047319 | Ga0495674_0240474 | Ga0495674_0240474_1038_1460 | 138 |
| 148 | 3300047322 | Ga0495680_0072319 | Ga0495680_0072319_708_1139 | 138 |
| 149 | 3300047444 | Ga0495675_0058341 | Ga0495675_0058341_600_1031 | 138 |
| 150 | 3300047471 | Ga0495684_0066747 | Ga0495684_0066747_605_1036 | 138 |
| 151 | 3300048088 | Ga0495602_0058117 | Ga0495602_0058117_1414_1845 | 138 |
| 152 | 3300053077 | Ga0495601_0021200 | Ga0495601_0021200_1722_2153 | 138 |
| 153 | 3300053078 | Ga0495612_0014786 | Ga0495612_0014786_1401_1832 | 138 |
| 154 | 3300053085 | Ga0495619_0067470 | Ga0495619_0067470_472_903 | 138 |
| 155 | 3300053094 | Ga0500566_0338991 | Ga0500566_0338991_14_445 | 138 |
| 156 | 3300005327 | Ga0070658_10027089 | Ga0070658_100270896 | 139 |
| 157 | 3300005329 | Ga0070683_100073360 | Ga0070683_1000733602 | 139 |
| 158 | 3300005336 | Ga0070680_100053675 | Ga0070680_1000536753 | 139 |
| 159 | 3300005339 | Ga0070660_100041483 | Ga0070660_1000414835 | 139 |
| 160 | 3300005366 | Ga0070659_100093925 | Ga0070659_1000939252 | 139 |
| 161 | 3300005458 | Ga0070681_10119178 | Ga0070681_101191783 | 139 |
| 162 | 3300005530 | Ga0070679_100099935 | Ga0070679_1000999353 | 139 |
| 163 | 3300005535 | Ga0070684_100100507 | Ga0070684_1001005072 | 139 |
| 164 | 3300005539 | Ga0068853_100124457 | Ga0068853_1001244573 | 139 |
| 165 | 3300005577 | Ga0068857_100125500 | Ga0068857_1001255002 | 139 |
| 166 | 3300005616 | Ga0068852_100675539 | Ga0068852_1006755392 | 139 |
| 167 | 3300005834 | Ga0068851_10001206 | Ga0068851_1000120610 | 139 |
| 168 | 3300006028 | Ga0070717_10662249 | Ga0070717_106622492 | 139 |
| 169 | 3300009093 | Ga0105240_10091680 | Ga0105240_100916805 | 139 |
| 170 | 3300009098 | Ga0105245_11315059 | Ga0105245_113150592 | 139 |
| 171 | 3300009101 | Ga0105247_10321883 | Ga0105247_103218832 | 139 |
| 172 | 3300009177 | Ga0105248_11703461 | Ga0105248_117034612 | 139 |
| 173 | 3300009545 | Ga0105237_10106584 | Ga0105237_101065844 | 139 |
| 174 | 3300009545 | Ga0105237_10536162 | Ga0105237_105361622 | 139 |
| 175 | 3300009551 | Ga0105238_10085798 | Ga0105238_100857983 | 139 |
| 176 | 3300010375 | Ga0105239_10133896 | Ga0105239_101338962 | 139 |
| 177 | 3300013104 | Ga0157370_10079915 | Ga0157370_100799152 | 139 |
| 178 | 3300013105 | Ga0157369_10185397 | Ga0157369_101853972 | 139 |
| 179 | 3300013308 | Ga0157375_10556350 | Ga0157375_105563502 | 139 |
| 180 | 3300014325 | Ga0163163_10106415 | Ga0163163_101064152 | 139 |
| 181 | 3300025904 | Ga0207647_10134992 | Ga0207647_101349922 | 139 |
| 182 | 3300025912 | Ga0207707_10003603 | Ga0207707_1000360311 | 139 |
| 183 | 3300025913 | Ga0207695_10297720 | Ga0207695_102977201 | 139 |
| 184 | 3300025914 | Ga0207671_10139839 | Ga0207671_101398392 | 139 |
| 185 | 3300025914 | Ga0207671_10540347 | Ga0207671_105403472 | 139 |
| 186 | 3300025919 | Ga0207657_10012009 | Ga0207657_100120093 | 139 |
| 187 | 3300025920 | Ga0207649_10122236 | Ga0207649_101222361 | 139 |
| 188 | 3300025921 | Ga0207652_10001857 | Ga0207652_1000185710 | 139 |
| 189 | 3300025924 | Ga0207694_10039124 | Ga0207694_100391245 | 139 |
| 190 | 3300025932 | Ga0207690_11095315 | Ga0207690_110953151 | 139 |
| 191 | 3300025944 | Ga0207661_10344465 | Ga0207661_103444652 | 139 |
| 192 | 3300025949 | Ga0207667_10060027 | Ga0207667_100600273 | 139 |
| 193 | 3300026041 | Ga0207639_10083772 | Ga0207639_100837723 | 139 |
| 194 | 3300026067 | Ga0207678_10358115 | Ga0207678_103581151 | 139 |
| 195 | 3300026142 | Ga0207698_10089235 | Ga0207698_100892352 | 139 |
| 196 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006329 | 139 |
| 197 | 3300046455 | Ga0495603_0524214 | Ga0495603_0524214_239_658 | 139 |
| 198 | 3300046460 | Ga0495638_0006220 | Ga0495638_0006220_6290_6715 | 139 |
| 199 | 3300046500 | Ga0495596_0105587 | Ga0495596_0105587_633_1052 | 139 |
| 200 | 3300046518 | Ga0495631_0077768 | Ga0495631_0077768_760_1179 | 139 |
| 201 | 3300046519 | Ga0495632_0029344 | Ga0495632_0029344_1502_1921 | 139 |
| 202 | 3300046648 | Ga0495611_0040090 | Ga0495611_0040090_296_715 | 139 |
| 203 | 3300046660 | Ga0495625_0035331 | Ga0495625_0035331_1614_2033 | 139 |
| 204 | 3300046665 | Ga0495661_0110974 | Ga0495661_0110974_194_613 | 139 |
| 205 | 3300047443 | Ga0495687_090350 | Ga0495687_090350_77_499 | 139 |
| 206 | 3300047472 | Ga0495686_0019599 | Ga0495686_0019599_2776_3195 | 139 |
| 207 | 3300048903 | Ga0496100_0160095 | Ga0496100_0160095_419_838 | 139 |
| 208 | 3300048904 | Ga0496101_0040220 | Ga0496101_0040220_2527_2946 | 139 |
| 209 | 3300048907 | Ga0496104_0108918 | Ga0496104_0108918_990_1409 | 139 |
| 210 | 3300048909 | Ga0496106_0111610 | Ga0496106_0111610_1449_1868 | 139 |
| 211 | 3300048910 | Ga0496107_0085584 | Ga0496107_0085584_1135_1554 | 139 |
| 212 | 3300048911 | Ga0496108_0179760 | Ga0496108_0179760_1184_1603 | 139 |
| 213 | 3300048912 | Ga0496109_0714287 | Ga0496109_0714287_385_804 | 139 |
| 214 | 3300048914 | Ga0496111_0370636 | Ga0496111_0370636_196_615 | 139 |
| 215 | 3300048917 | Ga0496114_0043573 | Ga0496114_0043573_1684_2103 | 139 |
| 216 | 3300048918 | Ga0496115_0230094 | Ga0496115_0230094_608_1030 | 139 |
| 217 | 3300048924 | Ga0496121_0022110 | Ga0496121_0022110_624_1043 | 139 |
| 218 | 3300048924 | Ga0496121_0235008 | Ga0496121_0235008_167_595 | 139 |
| 219 | 3300048924 | Ga0496121_0363026 | Ga0496121_0363026_518_946 | 139 |
| 220 | 3300048924 | Ga0496121_0457168 | Ga0496121_0457168_125_553 | 139 |
| 221 | 3300050492 | nmdc:mga0yw44_129668_c1 | nmdc:mga0yw44_129668_c1_990_1409 | 139 |
| 222 | 3300050495 | nmdc:mga04h51_189442_c1 | nmdc:mga04h51_189442_c1_22_441 | 139 |
| 223 | 3300053093 | Ga0500651_0338794 | Ga0500651_0338794_203_688 | 139 |
| 224 | 3300053111 | Ga0500572_042027 | Ga0500572_042027_691_1176 | 139 |
| 225 | 3300053136 | Ga0500559_0098772 | Ga0500559_0098772_455_940 | 139 |
| 226 | 3300053146 | Ga0500588_0182140 | Ga0500588_0182140_324_746 | 139 |
| 227 | 3300053150 | Ga0500603_100822 | Ga0500603_100822_148_633 | 139 |
| 228 | 3300053153 | Ga0500616_0041758 | Ga0500616_0041758_75_500 | 139 |
| 229 | 3300053157 | Ga0500624_051945 | Ga0500624_051945_44_529 | 139 |
| 230 | 3300053177 | Ga0500636_0005675 | Ga0500636_0005675_2318_2803 | 139 |
| 231 | 3300053735 | Ga0500596_052729 | Ga0500596_052729_112_597 | 139 |
| 232 | iso_pu_bacteria | 8006973647 | 8006980033 | 139 |
| 233 | iso_pu_bacteria | 8019555841 | 8019556238 | 139 |
| 234 | iso_pu_bacteria | 8019565922 | 8019569071 | 139 |
| 235 | 3300005617 | Ga0068859_100548327 | Ga0068859_1005483272 | 140 |
| 236 | 3300005618 | Ga0068864_101158453 | Ga0068864_1011584532 | 140 |
| 237 | 3300006931 | Ga0097620_100548300 | Ga0097620_1005483002 | 140 |
| 238 | 3300006942 | Ga0099824_1004403 | Ga0099824_10044034 | 140 |
| 239 | 3300006943 | Ga0099822_1018335 | Ga0099822_10183357 | 140 |
| 240 | 3300010375 | Ga0105239_10140030 | Ga0105239_101400304 | 140 |
| 241 | 3300013104 | Ga0157370_11134274 | Ga0157370_111342742 | 140 |
| 242 | 3300013105 | Ga0157369_10206150 | Ga0157369_102061504 | 140 |
| 243 | 3300013306 | Ga0163162_10026189 | Ga0163162_100261894 | 140 |
| 244 | 3300013306 | Ga0163162_10583675 | Ga0163162_105836751 | 140 |
| 245 | 3300014325 | Ga0163163_12138590 | Ga0163163_121385901 | 140 |
| 246 | 3300015265 | Ga0182005_1108875 | Ga0182005_11088752 | 140 |
| 247 | 3300025261 | Ga0209233_1017922 | Ga0209233_10179222 | 140 |
| 248 | 3300025900 | Ga0207710_10019985 | Ga0207710_100199854 | 140 |
| 249 | 3300026088 | Ga0207641_10509322 | Ga0207641_105093222 | 140 |
| 250 | 3300026095 | Ga0207676_10967045 | Ga0207676_109670452 | 140 |
| 251 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001223 | 140 |
| 252 | 3300027361 | Ga0209489_100001 | Ga0209489_100001223 | 140 |
| 253 | 3300027363 | Ga0209700_100001 | Ga0209700_100001223 | 140 |
| 254 | 3300031824 | Ga0307413_10089201 | Ga0307413_100892013 | 140 |
| 255 | 3300032005 | Ga0307411_10532155 | Ga0307411_105321551 | 140 |
| 256 | 3300035117 | Ga0373953_0341077 | Ga0373953_0341077_141_569 | 140 |
| 257 | 3300037418 | Ga0395900_1364142 | Ga0395900_1364142_164_586 | 140 |
| 258 | 3300037466 | Ga0395898_0046725 | Ga0395898_0046725_2240_2662 | 140 |
| 259 | 3300037471 | Ga0395905_0001756 | Ga0395905_0001756_17120_17542 | 140 |
| 260 | 3300041451 | Ga0451791_1893118 | Ga0451791_1893118_50_472 | 140 |
| 261 | 3300041486 | Ga0451807_2629163 | Ga0451807_2629163_147_569 | 140 |
| 262 | 3300041492 | Ga0451835_0477346 | Ga0451835_0477346_171_593 | 140 |
| 263 | 3300041496 | Ga0451839_1247905 | Ga0451839_1247905_88_510 | 140 |
| 264 | 3300041505 | Ga0451849_1494901 | Ga0451849_1494901_155_577 | 140 |
| 265 | 3300041512 | Ga0451853_1471601 | Ga0451853_1471601_1402_1824 | 140 |
| 266 | 3300041997 | Ga0439431_0094488 | Ga0439431_0094488_40_471 | 140 |
| 267 | 3300042004 | Ga0439445_0136920 | Ga0439445_0136920_231_662 | 140 |
| 268 | 3300044683 | Ga0466965_0063626 | Ga0466965_0063626_240_662 | 140 |
| 269 | 3300044706 | Ga0466964_0217288 | Ga0466964_0217288_141_563 | 140 |
| 270 | 3300046457 | Ga0495590_0077096 | Ga0495590_0077096_76_498 | 140 |
| 271 | 3300046507 | Ga0495606_0196577 | Ga0495606_0196577_207_629 | 140 |
| 272 | 3300046512 | Ga0495610_0056970 | Ga0495610_0056970_246_674 | 140 |
| 273 | 3300046524 | Ga0495648_0057102 | Ga0495648_0057102_1322_1747 | 140 |
| 274 | 3300046524 | Ga0495648_0090173 | Ga0495648_0090173_318_740 | 140 |
| 275 | 3300046538 | Ga0495609_0141239 | Ga0495609_0141239_240_662 | 140 |
| 276 | 3300046648 | Ga0495611_0086149 | Ga0495611_0086149_522_944 | 140 |
| 277 | 3300046665 | Ga0495661_0179489 | Ga0495661_0179489_362_829 | 140 |
| 278 | 3300046684 | Ga0495669_0147151 | Ga0495669_0147151_428_850 | 140 |
| 279 | 3300047469 | Ga0495673_0211121 | Ga0495673_0211121_281_703 | 140 |
| 280 | 3300047472 | Ga0495686_0096280 | Ga0495686_0096280_39_461 | 140 |
| 281 | 3300047472 | Ga0495686_0103351 | Ga0495686_0103351_1270_1692 | 140 |
| 282 | 3300047472 | Ga0495686_0680715 | Ga0495686_0680715_26_448 | 140 |
| 283 | 3300048091 | Ga0495626_0148163 | Ga0495626_0148163_536_958 | 140 |
| 284 | 3300048904 | Ga0496101_0149953 | Ga0496101_0149953_621_1043 | 140 |
| 285 | 3300048908 | Ga0496105_0028038 | Ga0496105_0028038_1862_2284 | 140 |
| 286 | 3300048908 | Ga0496105_0512593 | Ga0496105_0512593_49_471 | 140 |
| 287 | 3300048911 | Ga0496108_0998654 | Ga0496108_0998654_131_553 | 140 |
| 288 | 3300048912 | Ga0496109_0277031 | Ga0496109_0277031_403_825 | 140 |
| 289 | 3300048914 | Ga0496111_0499899 | Ga0496111_0499899_175_597 | 140 |
| 290 | 3300048921 | Ga0496118_0033666 | Ga0496118_0033666_2197_2619 | 140 |
| 291 | 3300048923 | Ga0496120_0018899 | Ga0496120_0018899_2387_2809 | 140 |
| 292 | 3300048923 | Ga0496120_0334003 | Ga0496120_0334003_93_515 | 140 |
| 293 | 3300048924 | Ga0496121_0055482 | Ga0496121_0055482_1880_2302 | 140 |
| 294 | 3300048924 | Ga0496121_0067329 | Ga0496121_0067329_1249_1671 | 140 |
| 295 | 3300048928 | Ga0496125_0125900 | Ga0496125_0125900_245_667 | 140 |
| 296 | 3300050490 | nmdc:mga03n38_188376_c1 | nmdc:mga03n38_188376_c1_158_580 | 140 |
| 297 | 3300050492 | nmdc:mga0yw44_177714_c1 | nmdc:mga0yw44_177714_c1_585_1007 | 140 |
| 298 | 3300050516 | nmdc:mga0sz30_174023_c1 | nmdc:mga0sz30_174023_c1_300_722 | 140 |
| 299 | 3300053086 | Ga0500578_0543686 | Ga0500578_0543686_51_479 | 140 |
| 300 | 3300053087 | Ga0500643_000035 | Ga0500643_000035_93559_93981 | 140 |
| 301 | 3300053092 | Ga0500583_0041239 | Ga0500583_0041239_1072_1494 | 140 |
| 302 | 3300053093 | Ga0500651_0233519 | Ga0500651_0233519_11_433 | 140 |
| 303 | 3300053094 | Ga0500566_0001359 | Ga0500566_0001359_10156_10578 | 140 |
| 304 | 3300053103 | Ga0500555_012606 | Ga0500555_012606_950_1372 | 140 |
| 305 | 3300053104 | Ga0500556_0023338 | Ga0500556_0023338_1125_1553 | 140 |
| 306 | 3300053105 | Ga0500557_000004 | Ga0500557_000004_62877_63299 | 140 |
| 307 | 3300053116 | Ga0500592_019082 | Ga0500592_019082_537_959 | 140 |
| 308 | 3300053130 | Ga0500642_0000133 | Ga0500642_0000133_18322_18744 | 140 |
| 309 | 3300053130 | Ga0500642_0003332 | Ga0500642_0003332_1605_2027 | 140 |
| 310 | 3300053131 | Ga0500652_030127 | Ga0500652_030127_175_597 | 140 |
| 311 | 3300053134 | Ga0500658_0067266 | Ga0500658_0067266_1007_1429 | 140 |
| 312 | 3300053139 | Ga0500568_0028188 | Ga0500568_0028188_294_716 | 140 |
| 313 | 3300053147 | Ga0500589_105608 | Ga0500589_105608_366_788 | 140 |
| 314 | 3300053156 | Ga0500622_0005064 | Ga0500622_0005064_5043_5471 | 140 |
| 315 | 3300053158 | Ga0500627_0189762 | Ga0500627_0189762_122_544 | 140 |
| 316 | 3300053729 | Ga0500625_008128 | Ga0500625_008128_814_1236 | 140 |
| 317 | 3300053730 | Ga0500645_032606 | Ga0500645_032606_51_473 | 140 |
| 318 | 3300053736 | Ga0500599_000373 | Ga0500599_000373_475_903 | 140 |
| 319 | 3300053737 | Ga0500601_000171 | Ga0500601_000171_7432_7854 | 140 |
| 320 | 3300055283 | Ga0500661_009767 | Ga0500661_009767_1269_1691 | 140 |
| 321 | 3300046463 | Ga0495653_0665908 | Ga0495653_0665908_94_528 | 141 |
| 322 | 3300046674 | Ga0495588_0160594 | Ga0495588_0160594_593_1018 | 141 |
| 323 | 3300053084 | Ga0495595_0232064 | Ga0495595_0232064_424_858 | 141 |
| 324 | iso_pu_bacteria | 2528768022 | 2528848597 | 141 |
| 325 | iso_pu_bacteria | 2824661429 | 2824661483 | 141 |
| 326 | iso_pu_bacteria | 2874628541 | 2874632170 | 141 |
| 327 | iso_pu_bacteria | 2879099564 | 2879104587 | 141 |
| 328 | iso_pu_bacteria | 2922368715 | 2922374755 | 141 |
| 329 | iso_pu_bacteria | 2932784394 | 2932788688 | 141 |
| 330 | iso_pu_bacteria | 2932809354 | 2932817371 | 141 |
| 331 | iso_pu_bacteria | 2932818245 | 2932826140 | 141 |
| 332 | iso_pu_bacteria | 2932828146 | 2932830336 | 141 |
| 333 | iso_pu_bacteria | 2935616580 | 2935616626 | 141 |
| 334 | iso_pu_bacteria | 2935638405 | 2935642043 | 141 |
| 335 | iso_pu_bacteria | 2935665750 | 2935672573 | 141 |
| 336 | iso_pu_bacteria | 2935675223 | 2935675956 | 141 |
| 337 | iso_pu_bacteria | 2935684952 | 2935685953 | 141 |
| 338 | iso_pu_bacteria | 2935694250 | 2935697802 | 141 |
| 339 | iso_pu_bacteria | 2935703347 | 2935705794 | 141 |
| 340 | iso_pu_bacteria | 2935713505 | 2935714505 | 141 |
| 341 | iso_pu_bacteria | 2935722832 | 2935725124 | 141 |
| 342 | iso_pu_bacteria | 2935732158 | 2935732516 | 141 |
| 343 | iso_pu_bacteria | 2935741537 | 2935741895 | 141 |
| 344 | iso_pu_bacteria | 2935750917 | 2935751918 | 141 |
| 345 | iso_pu_bacteria | 2935760218 | 2935765171 | 141 |
| 346 | iso_pu_bacteria | 2935801545 | 2935802791 | 141 |
| 347 | iso_pu_bacteria | 2935810662 | 2935813377 | 141 |
| 348 | iso_pu_bacteria | 2935827899 | 2935830210 | 141 |
| 349 | iso_pu_bacteria | 2935837841 | 2935838107 | 141 |
| 350 | iso_pu_bacteria | 2935855204 | 2935855250 | 141 |
| 351 | iso_pu_bacteria | 2935864058 | 2935867487 | 141 |
| 352 | iso_pu_bacteria | 2935873716 | 2935875675 | 141 |
| 353 | iso_pu_bacteria | 2935992306 | 2935996359 | 141 |
| 354 | iso_pu_bacteria | 2936002035 | 2936003642 | 141 |
| 355 | iso_pu_bacteria | 2936037263 | 2936042326 | 141 |
| 356 | iso_pu_bacteria | 2940556831 | 2940557279 | 141 |
| 357 | iso_pu_bacteria | 2941538514 | 2941539226 | 141 |
| 358 | iso_pu_bacteria | 8016511872 | 8016521969 | 141 |
| 359 | iso_pu_bacteria | 8017057580 | 8017063697 | 141 |
| 360 | iso_pu_bacteria | 8019576017 | 8019583026 | 141 |
| 361 | iso_pu_bacteria | 8019586578 | 8019590824 | 141 |
| 362 | iso_pu_bacteria | 8019597564 | 8019600524 | 141 |
| 363 | iso_pu_bacteria | 8019608314 | 8019618021 | 141 |
| 364 | 3300003659 | JGI25404J52841_10000065 | JGI25404J52841_100000656 | 142 |
| 365 | 3300003659 | JGI25404J52841_10035617 | JGI25404J52841_100356172 | 142 |
| 366 | 3300005436 | Ga0070713_100007867 | Ga0070713_1000078678 | 142 |
| 367 | 3300005471 | Ga0070698_100375669 | Ga0070698_1003756691 | 142 |
| 368 | 3300005937 | Ga0081455_10173033 | Ga0081455_101730332 | 142 |
| 369 | 3300005983 | Ga0081540_1001807 | Ga0081540_10018077 | 142 |
| 370 | 3300005983 | Ga0081540_1036527 | Ga0081540_10365271 | 142 |
| 371 | 3300006028 | Ga0070717_10009668 | Ga0070717_100096688 | 142 |
| 372 | 3300006175 | Ga0070712_100312124 | Ga0070712_1003121242 | 142 |
| 373 | 3300007076 | Ga0075435_100133489 | Ga0075435_1001334892 | 142 |
| 374 | 3300025915 | Ga0207693_10312729 | Ga0207693_103127292 | 142 |
| 375 | 3300025928 | Ga0207700_10004870 | Ga0207700_100048702 | 142 |
| 376 | 3300035114 | Ga0373939_0449670 | Ga0373939_0449670_104_532 | 142 |
| 377 | 3300050512 | nmdc:mga0n895_70689_c1 | nmdc:mga0n895_70689_c1_864_1292 | 142 |
| 378 | 3300050513 | nmdc:mga0rr50_518172_c1 | nmdc:mga0rr50_518172_c1_184_612 | 142 |
| 379 | iso_pu_bacteria | 2507262055 | 2507508295 | 142 |
| 380 | iso_pu_bacteria | 2508501009 | 2508542363 | 142 |
| 381 | iso_pu_bacteria | 2508501042 | 2508691883 | 142 |
| 382 | iso_pu_bacteria | 2511231028 | 2511397422 | 142 |
| 383 | iso_pu_bacteria | 2513237092 | 2513622425 | 142 |
| 384 | iso_pu_bacteria | 2513237095 | 2513645533 | 142 |
| 385 | iso_pu_bacteria | 2513237102 | 2513702381 | 142 |
| 386 | iso_pu_bacteria | 2513237104 | 2513718466 | 142 |
| 387 | iso_pu_bacteria | 2513237139 | 2513873059 | 142 |
| 388 | iso_pu_bacteria | 2513237161 | 2514015641 | 142 |
| 389 | iso_pu_bacteria | 2515154112 | 2515627201 | 142 |
| 390 | iso_pu_bacteria | 2517093001 | 2517102752 | 142 |
| 391 | iso_pu_bacteria | 2617270735 | 2617347078 | 142 |
| 392 | iso_pu_bacteria | 2617270741 | 2617375473 | 142 |
| 393 | iso_pu_bacteria | 2791355196 | 2793062678 | 142 |
| 394 | iso_pu_bacteria | 2802429603 | 2805915042 | 142 |
| 395 | iso_pu_bacteria | 2816332527 | 2818238580 | 142 |
| 396 | iso_pu_bacteria | 2824600985 | 2824602441 | 142 |
| 397 | iso_pu_bacteria | 2824609381 | 2824610444 | 142 |
| 398 | iso_pu_bacteria | 2824617872 | 2824618021 | 142 |
| 399 | iso_pu_bacteria | 2824626560 | 2824626689 | 142 |
| 400 | iso_pu_bacteria | 2824635225 | 2824636676 | 142 |
| 401 | iso_pu_bacteria | 2824644064 | 2824648979 | 142 |
| 402 | iso_pu_bacteria | 2824653114 | 2824657396 | 142 |
| 403 | iso_pu_bacteria | 2824671348 | 2824674898 | 142 |
| 404 | iso_pu_bacteria | 2824679649 | 2824685812 | 142 |
| 405 | iso_pu_bacteria | 2824687955 | 2824691323 | 142 |
| 406 | iso_pu_bacteria | 2824696289 | 2824699497 | 142 |
| 407 | iso_pu_bacteria | 2824704595 | 2824714256 | 142 |
| 408 | iso_pu_bacteria | 2824714736 | 2824723162 | 142 |
| 409 | iso_pu_bacteria | 2824723954 | 2824725112 | 142 |
| 410 | iso_pu_bacteria | 2824732956 | 2824733365 | 142 |
| 411 | iso_pu_bacteria | 2824746037 | 2824746508 | 142 |
| 412 | iso_pu_bacteria | 2824753945 | 2824754272 | 142 |
| 413 | iso_pu_bacteria | 2824763712 | 2824767771 | 142 |
| 414 | iso_pu_bacteria | 2824773399 | 2824775334 | 142 |
| 415 | iso_pu_bacteria | 2838122688 | 2838123432 | 142 |
| 416 | iso_pu_bacteria | 2841941048 | 2841947795 | 142 |
| 417 | iso_pu_bacteria | 2841949485 | 2841949534 | 142 |
| 418 | iso_pu_bacteria | 2841957949 | 2841964129 | 142 |
| 419 | iso_pu_bacteria | 2841966195 | 2841971959 | 142 |
| 420 | iso_pu_bacteria | 2841974524 | 2841974698 | 142 |
| 421 | iso_pu_bacteria | 2841983080 | 2841983744 | 142 |
| 422 | iso_pu_bacteria | 2842038055 | 2842040102 | 142 |
| 423 | iso_pu_bacteria | 2842045827 | 2842046953 | 142 |
| 424 | iso_pu_bacteria | 2847930680 | 2847936514 | 142 |
| 425 | iso_pu_bacteria | 2847939898 | 2847946860 | 142 |
| 426 | iso_pu_bacteria | 2849076700 | 2849079036 | 142 |
| 427 | iso_pu_bacteria | 2857509624 | 2857516713 | 142 |
| 428 | iso_pu_bacteria | 2874590934 | 2874598337 | 142 |
| 429 | iso_pu_bacteria | 2874612657 | 2874619455 | 142 |
| 430 | iso_pu_bacteria | 2874620515 | 2874627512 | 142 |
| 431 | iso_pu_bacteria | 2874645413 | 2874652607 | 142 |
| 432 | iso_pu_bacteria | 2876771140 | 2876778185 | 142 |
| 433 | iso_pu_bacteria | 2876818435 | 2876825946 | 142 |
| 434 | iso_pu_bacteria | 2879074833 | 2879081979 | 142 |
| 435 | iso_pu_bacteria | 2879083081 | 2879089450 | 142 |
| 436 | iso_pu_bacteria | 2879127579 | 2879135101 | 142 |
| 437 | iso_pu_bacteria | 2879142872 | 2879149785 | 142 |
| 438 | iso_pu_bacteria | 2881364244 | 2881368560 | 142 |
| 439 | iso_pu_bacteria | 2881665667 | 2881672605 | 142 |
| 440 | iso_pu_bacteria | 2885366525 | 2885369185 | 142 |
| 441 | iso_pu_bacteria | 2885409591 | 2885410463 | 142 |
| 442 | iso_pu_bacteria | 2888378607 | 2888384390 | 142 |
| 443 | iso_pu_bacteria | 2888388044 | 2888393528 | 142 |
| 444 | iso_pu_bacteria | 2888419890 | 2888424819 | 142 |
| 445 | iso_pu_bacteria | 2904666416 | 2904673168 | 142 |
| 446 | iso_pu_bacteria | 2904711408 | 2904714995 | 142 |
| 447 | iso_pu_bacteria | 2906626472 | 2906633624 | 142 |
| 448 | iso_pu_bacteria | 2906643746 | 2906651287 | 142 |
| 449 | iso_pu_bacteria | 2908775508 | 2908780467 | 142 |
| 450 | iso_pu_bacteria | 2922393267 | 2922400507 | 142 |
| 451 | iso_pu_bacteria | 2929615660 | 2929621827 | 142 |
| 452 | iso_pu_bacteria | 2929624759 | 2929629866 | 142 |
| 453 | iso_pu_bacteria | 2933577622 | 2933583897 | 142 |
| 454 | iso_pu_bacteria | 2935608549 | 2935609218 | 142 |
| 455 | iso_pu_bacteria | 2935648319 | 2935650980 | 142 |
| 456 | iso_pu_bacteria | 2935656913 | 2935659161 | 142 |
| 457 | iso_pu_bacteria | 2935769743 | 2935771770 | 142 |
| 458 | iso_pu_bacteria | 2935777560 | 2935778791 | 142 |
| 459 | iso_pu_bacteria | 2935785616 | 2935788821 | 142 |
| 460 | iso_pu_bacteria | 2935793552 | 2935795379 | 142 |
| 461 | iso_pu_bacteria | 2935819856 | 2935822378 | 142 |
| 462 | iso_pu_bacteria | 2935847175 | 2935847960 | 142 |
| 463 | iso_pu_bacteria | 2935908558 | 2935908819 | 142 |
| 464 | iso_pu_bacteria | 2935916978 | 2935919539 | 142 |
| 465 | iso_pu_bacteria | 2935926038 | 2935926607 | 142 |
| 466 | iso_pu_bacteria | 2935934488 | 2935935057 | 142 |
| 467 | iso_pu_bacteria | 2935942939 | 2935943507 | 142 |
| 468 | iso_pu_bacteria | 2935951376 | 2935951945 | 142 |
| 469 | iso_pu_bacteria | 2935967501 | 2935968070 | 142 |
| 470 | iso_pu_bacteria | 2935975950 | 2935978695 | 142 |
| 471 | iso_pu_bacteria | 2935984226 | 2935987432 | 142 |
| 472 | iso_pu_bacteria | 2936011229 | 2936013576 | 142 |
| 473 | iso_pu_bacteria | 2936019824 | 2936022297 | 142 |
| 474 | iso_pu_bacteria | 2936028420 | 2936030743 | 142 |
| 475 | iso_pu_bacteria | 2936046547 | 2936048556 | 142 |
| 476 | iso_pu_bacteria | 2936055302 | 2936058770 | 142 |
| 477 | iso_pu_bacteria | 3005483717 | 3005484608 | 142 |
| 478 | iso_pu_bacteria | 3005506211 | 3005510606 | 142 |
| 479 | iso_pu_bacteria | 3005587118 | 3005587752 | 142 |
| 480 | iso_pu_bacteria | 8016522445 | 8016529329 | 142 |
| 481 | iso_pu_bacteria | 8016530956 | 8016534544 | 142 |
| 482 | iso_pu_bacteria | 8016539877 | 8016547762 | 142 |
| 483 | iso_pu_bacteria | 8016548790 | 8016554374 | 142 |
| 484 | iso_pu_bacteria | 8016557553 | 8016562742 | 142 |
| 485 | iso_pu_bacteria | 8016566248 | 8016572885 | 142 |
| 486 | iso_pu_bacteria | 8016575299 | 8016577044 | 142 |
| 487 | iso_pu_bacteria | 8016595262 | 8016600526 | 142 |
| 488 | iso_pu_bacteria | 8016603502 | 8016610220 | 142 |
| 489 | iso_pu_bacteria | 8016613128 | 8016614713 | 142 |
| 490 | iso_pu_bacteria | 8016622563 | 8016626276 | 142 |
| 491 | iso_pu_bacteria | 8016630954 | 8016640014 | 142 |
| 492 | iso_pu_bacteria | 8019530166 | 8019534305 | 142 |
| 493 | iso_pu_bacteria | 8019538911 | 8019545154 | 142 |
| 494 | iso_pu_bacteria | 8019547302 | 8019553370 | 142 |
| 495 | iso_pu_bacteria | 8019619141 | 8019628496 | 142 |
| 496 | iso_pu_bacteria | 8019629233 | 8019634137 | 142 |
| 497 | iso_pu_bacteria | 8019638758 | 8019645592 | 142 |
| 498 | iso_pu_bacteria | 8019659431 | 8019662015 | 142 |
| 499 | iso_pu_bacteria | 8019668869 | 8019671542 | 142 |
| 500 | iso_pu_bacteria | 8055742211 | 8055746007 | 142 |
| 501 | 3300003659 | JGI25404J52841_10070111 | JGI25404J52841_100701111 | 143 |
| 502 | 3300005577 | Ga0068857_100637998 | Ga0068857_1006379982 | 143 |
| 503 | 3300005937 | Ga0081455_10113250 | Ga0081455_101132502 | 143 |
| 504 | 3300005983 | Ga0081540_1000933 | Ga0081540_10009337 | 143 |
| 505 | 3300009545 | Ga0105237_10110754 | Ga0105237_101107544 | 143 |
| 506 | 3300009545 | Ga0105237_10609342 | Ga0105237_106093422 | 143 |
| 507 | 3300025912 | Ga0207707_10003260 | Ga0207707_100032605 | 143 |
| 508 | 3300025914 | Ga0207671_10727029 | Ga0207671_107270291 | 143 |
| 509 | 3300025917 | Ga0207660_10342879 | Ga0207660_103428792 | 143 |
| 510 | 3300025920 | Ga0207649_10489587 | Ga0207649_104895871 | 143 |
| 511 | 3300025921 | Ga0207652_10095685 | Ga0207652_100956852 | 143 |
| 512 | 3300025944 | Ga0207661_10426213 | Ga0207661_104262132 | 143 |
| 513 | 3300026041 | Ga0207639_10230211 | Ga0207639_102302112 | 143 |
| 514 | 3300026116 | Ga0207674_10640442 | Ga0207674_106404421 | 143 |
| 515 | 3300035089 | Ga0373944_0005698 | Ga0373944_0005698_2035_2466 | 143 |
| 516 | 3300035111 | Ga0373923_0116466 | Ga0373923_0116466_218_649 | 143 |
| 517 | 3300035113 | Ga0373936_0056776 | Ga0373936_0056776_652_1083 | 143 |
| 518 | 3300035116 | Ga0373945_0005196 | Ga0373945_0005196_1417_1848 | 143 |
| 519 | 3300035119 | Ga0373956_0036543 | Ga0373956_0036543_654_1085 | 143 |
| 520 | 3300035692 | Ga0373935_0586417 | Ga0373935_0586417_120_551 | 143 |
| 521 | 3300035724 | Ga0373933_0179705 | Ga0373933_0179705_356_787 | 143 |
| 522 | 3300037068 | Ga0373925_0126944 | Ga0373925_0126944_1464_1895 | 143 |
| 523 | 3300046475 | Ga0495639_0230408 | Ga0495639_0230408_143_574 | 143 |
| 524 | 3300046477 | Ga0495664_0014962 | Ga0495664_0014962_1736_2167 | 143 |
| 525 | 3300046499 | Ga0495594_0039280 | Ga0495594_0039280_239_670 | 143 |
| 526 | 3300046514 | Ga0495618_0062804 | Ga0495618_0062804_1366_1797 | 143 |
| 527 | 3300046531 | Ga0495665_0021744 | Ga0495665_0021744_1603_2034 | 143 |
| 528 | 3300046533 | Ga0495640_0013662 | Ga0495640_0013662_3396_3827 | 143 |
| 529 | 3300046535 | Ga0495586_0113104 | Ga0495586_0113104_545_976 | 143 |
| 530 | 3300046536 | Ga0495587_0359559 | Ga0495587_0359559_342_773 | 143 |
| 531 | 3300047315 | Ga0495581_0024060 | Ga0495581_0024060_1887_2318 | 143 |
| 532 | 3300047321 | Ga0495676_0053391 | Ga0495676_0053391_565_996 | 143 |
| 533 | 3300047444 | Ga0495675_0570834 | Ga0495675_0570834_47_478 | 143 |
| 534 | 3300047673 | Ga0495593_0004557 | Ga0495593_0004557_4155_4586 | 143 |
| 535 | 3300053077 | Ga0495601_0073139 | Ga0495601_0073139_873_1304 | 143 |
| 536 | 3300005985 | Ga0081539_10070243 | Ga0081539_100702432 | 144 |
| 537 | 3300044658 | Ga0466972_0000122 | Ga0466972_0000122_60994_61428 | 144 |
| 538 | 3300044683 | Ga0466965_0535224 | Ga0466965_0535224_73_507 | 144 |
| 539 | 3300003215 | JGI25153J46596_10006767 | JGI25153J46596_100067674 | 145 |
| 540 | 3300004625 | Ga0055543_1004059 | Ga0055543_10040595 | 145 |
| 541 | 3300005262 | Ga0065165_1000433 | Ga0065165_100043352 | 145 |
| 542 | 3300005338 | Ga0068868_100097012 | Ga0068868_1000970122 | 145 |
| 543 | 3300005366 | Ga0070659_100408761 | Ga0070659_1004087612 | 145 |
| 544 | 3300005455 | Ga0070663_100039008 | Ga0070663_1000390082 | 145 |
| 545 | 3300005564 | Ga0070664_100118025 | Ga0070664_1001180252 | 145 |
| 546 | 3300005834 | Ga0068851_10271276 | Ga0068851_102712762 | 145 |
| 547 | 3300025261 | Ga0209233_1008601 | Ga0209233_10086013 | 145 |
| 548 | 3300025297 | Ga0209758_1004050 | Ga0209758_100405010 | 145 |
| 549 | 3300025900 | Ga0207710_10347636 | Ga0207710_103476362 | 145 |
| 550 | 3300025940 | Ga0207691_10418103 | Ga0207691_104181032 | 145 |
| 551 | 3300025942 | Ga0207689_10406078 | Ga0207689_104060782 | 145 |
| 552 | 3300025945 | Ga0207679_10372264 | Ga0207679_103722642 | 145 |
| 553 | 3300026023 | Ga0207677_10108081 | Ga0207677_101080813 | 145 |
| 554 | 3300026035 | Ga0207703_10666056 | Ga0207703_106660561 | 145 |
| 555 | 3300026067 | Ga0207678_10060133 | Ga0207678_100601332 | 145 |
| 556 | 3300026121 | Ga0207683_10266888 | Ga0207683_102668882 | 145 |
| 557 | 3300027866 | Ga0209813_10163541 | Ga0209813_101635412 | 145 |
| 558 | 3300028379 | Ga0268266_10727465 | Ga0268266_107274652 | 145 |
| 559 | 3300046454 | Ga0495592_0270697 | Ga0495592_0270697_145_630 | 145 |
| 560 | 3300046492 | Ga0495585_0098238 | Ga0495585_0098238_80_517 | 145 |
| 561 | 3300046507 | Ga0495606_0174122 | Ga0495606_0174122_202_639 | 145 |
| 562 | 3300046512 | Ga0495610_0101021 | Ga0495610_0101021_838_1275 | 145 |
| 563 | 3300046557 | Ga0495622_0086519 | Ga0495622_0086519_43_480 | 145 |
| 564 | 3300046616 | Ga0495668_0144289 | Ga0495668_0144289_709_1146 | 145 |
| 565 | 3300046692 | Ga0495671_0044078 | Ga0495671_0044078_1504_1941 | 145 |
| 566 | 3300048905 | Ga0496102_0122301 | Ga0496102_0122301_1295_1732 | 145 |
| 567 | 3300048908 | Ga0496105_0073134 | Ga0496105_0073134_927_1364 | 145 |
| 568 | 3300048913 | Ga0496110_0047316 | Ga0496110_0047316_1318_1755 | 145 |
| 569 | 3300048915 | Ga0496112_0015856 | Ga0496112_0015856_1197_1634 | 145 |
| 570 | 3300048916 | Ga0496113_0058559 | Ga0496113_0058559_1167_1604 | 145 |
| 571 | 3300048919 | Ga0496116_0082110 | Ga0496116_0082110_916_1353 | 145 |
| 572 | 3300048920 | Ga0496117_0051706 | Ga0496117_0051706_1199_1636 | 145 |
| 573 | 3300048921 | Ga0496118_0055688 | Ga0496118_0055688_1961_2398 | 145 |
| 574 | 3300048922 | Ga0496119_0068253 | Ga0496119_0068253_1283_1720 | 145 |
| 575 | 3300053080 | Ga0500635_0100518 | Ga0500635_0100518_44_529 | 145 |
| 576 | 3300053095 | Ga0500640_075214 | Ga0500640_075214_631_1116 | 145 |
| 577 | 3300053121 | Ga0500607_034406 | Ga0500607_034406_513_998 | 145 |
| 578 | 3300053122 | Ga0500608_096171 | Ga0500608_096171_661_1146 | 145 |
| 579 | 3300053123 | Ga0500614_068093 | Ga0500614_068093_315_800 | 145 |
| 580 | 3300053128 | Ga0500626_168656 | Ga0500626_168656_283_768 | 145 |
| 581 | 3300053144 | Ga0500585_220876 | Ga0500585_220876_44_529 | 145 |
| 582 | 3300053154 | Ga0500619_026514 | Ga0500619_026514_926_1411 | 145 |
| 583 | 3300053155 | Ga0500620_042237 | Ga0500620_042237_554_1039 | 145 |
| 584 | 3300053163 | Ga0500639_138471 | Ga0500639_138471_549_1034 | 145 |
| 585 | 3300002075 | JGI24738J21930_10033689 | JGI24738J21930_100336892 | 146 |
| 586 | 3300003215 | JGI25153J46596_10007604 | JGI25153J46596_100076044 | 146 |
| 587 | 3300003215 | JGI25153J46596_10017021 | JGI25153J46596_100170212 | 146 |
| 588 | 3300003323 | rootH1_10156318 | rootH1_101563184 | 146 |
| 589 | 3300003354 | JGI25160J50197_1000838 | JGI25160J50197_10008389 | 146 |
| 590 | 3300003771 | Ga0055526_1026655 | Ga0055526_10266552 | 146 |
| 591 | 3300003794 | Ga0055531_10003336 | Ga0055531_100033369 | 146 |
| 592 | 3300005262 | Ga0065165_1012388 | Ga0065165_10123884 | 146 |
| 593 | 3300005262 | Ga0065165_1014587 | Ga0065165_10145873 | 146 |
| 594 | 3300005327 | Ga0070658_10069245 | Ga0070658_100692452 | 146 |
| 595 | 3300005337 | Ga0070682_100077523 | Ga0070682_1000775232 | 146 |
| 596 | 3300005339 | Ga0070660_100031993 | Ga0070660_1000319934 | 146 |
| 597 | 3300005344 | Ga0070661_100097630 | Ga0070661_1000976303 | 146 |
| 598 | 3300005347 | Ga0070668_100107890 | Ga0070668_1001078902 | 146 |
| 599 | 3300005355 | Ga0070671_100074258 | Ga0070671_1000742583 | 146 |
| 600 | 3300005367 | Ga0070667_100471664 | Ga0070667_1004716641 | 146 |
| 601 | 3300005439 | Ga0070711_100837580 | Ga0070711_1008375801 | 146 |
| 602 | 3300005455 | Ga0070663_100167997 | Ga0070663_1001679972 | 146 |
| 603 | 3300005457 | Ga0070662_100181854 | Ga0070662_1001818542 | 146 |
| 604 | 3300005539 | Ga0068853_101038498 | Ga0068853_1010384981 | 146 |
| 605 | 3300005547 | Ga0070693_100818806 | Ga0070693_1008188061 | 146 |
| 606 | 3300005563 | Ga0068855_100141606 | Ga0068855_1001416062 | 146 |
| 607 | 3300005577 | Ga0068857_100134918 | Ga0068857_1001349182 | 146 |
| 608 | 3300005578 | Ga0068854_100317239 | Ga0068854_1003172392 | 146 |
| 609 | 3300005614 | Ga0068856_100078138 | Ga0068856_1000781383 | 146 |
| 610 | 3300005614 | Ga0068856_100144594 | Ga0068856_1001445942 | 146 |
| 611 | 3300005616 | Ga0068852_100042366 | Ga0068852_1000423662 | 146 |
| 612 | 3300005618 | Ga0068864_100236840 | Ga0068864_1002368402 | 146 |
| 613 | 3300005844 | Ga0068862_100044071 | Ga0068862_1000440712 | 146 |
| 614 | 3300005983 | Ga0081540_1175932 | Ga0081540_11759322 | 146 |
| 615 | 3300005983 | Ga0081540_1294309 | Ga0081540_12943091 | 146 |
| 616 | 3300006038 | Ga0075365_10082796 | Ga0075365_100827962 | 146 |
| 617 | 3300006038 | Ga0075365_10236724 | Ga0075365_102367242 | 146 |
| 618 | 3300006042 | Ga0075368_10011258 | Ga0075368_100112582 | 146 |
| 619 | 3300006048 | Ga0075363_100008538 | Ga0075363_1000085384 | 146 |
| 620 | 3300006051 | Ga0075364_10025855 | Ga0075364_100258552 | 146 |
| 621 | 3300006177 | Ga0075362_10150872 | Ga0075362_101508722 | 146 |
| 622 | 3300006186 | Ga0075369_10035187 | Ga0075369_100351872 | 146 |
| 623 | 3300006195 | Ga0075366_10017707 | Ga0075366_100177074 | 146 |
| 624 | 3300006353 | Ga0075370_10086135 | Ga0075370_100861352 | 146 |
| 625 | 3300009093 | Ga0105240_10344932 | Ga0105240_103449322 | 146 |
| 626 | 3300009098 | Ga0105245_10382301 | Ga0105245_103823012 | 146 |
| 627 | 3300009101 | Ga0105247_10015105 | Ga0105247_100151055 | 146 |
| 628 | 3300009148 | Ga0105243_10092125 | Ga0105243_100921252 | 146 |
| 629 | 3300009174 | Ga0105241_10114692 | Ga0105241_101146922 | 146 |
| 630 | 3300009176 | Ga0105242_10814091 | Ga0105242_108140912 | 146 |
| 631 | 3300009545 | Ga0105237_10092617 | Ga0105237_100926173 | 146 |
| 632 | 3300009553 | Ga0105249_10125042 | Ga0105249_101250423 | 146 |
| 633 | 3300011119 | Ga0105246_10080849 | Ga0105246_100808492 | 146 |
| 634 | 3300013296 | Ga0157374_10061400 | Ga0157374_100614003 | 146 |
| 635 | 3300014325 | Ga0163163_10055860 | Ga0163163_100558605 | 146 |
| 636 | 3300017792 | Ga0163161_10377745 | Ga0163161_103777452 | 146 |
| 637 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002155 | 146 |
| 638 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001505 | 146 |
| 639 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001571 | 146 |
| 640 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001625 | 146 |
| 641 | 3300025230 | Ga0209563_103642 | Ga0209563_1036423 | 146 |
| 642 | 3300025295 | Ga0209564_1018244 | Ga0209564_10182443 | 146 |
| 643 | 3300025295 | Ga0209564_1019751 | Ga0209564_10197514 | 146 |
| 644 | 3300025297 | Ga0209758_1000024 | Ga0209758_10000248 | 146 |
| 645 | 3300025297 | Ga0209758_1001768 | Ga0209758_10017689 | 146 |
| 646 | 3300025297 | Ga0209758_1007646 | Ga0209758_10076464 | 146 |
| 647 | 3300025297 | Ga0209758_1114340 | Ga0209758_11143402 | 146 |
| 648 | 3300025299 | Ga0209256_1004722 | Ga0209256_10047226 | 146 |
| 649 | 3300025302 | Ga0207426_1026026 | Ga0207426_10260264 | 146 |
| 650 | 3300025302 | Ga0207426_1073848 | Ga0207426_10738482 | 146 |
| 651 | 3300025303 | Ga0209051_1045422 | Ga0209051_10454222 | 146 |
| 652 | 3300025304 | Ga0209257_1002662 | Ga0209257_100266211 | 146 |
| 653 | 3300025304 | Ga0209257_1026314 | Ga0209257_10263143 | 146 |
| 654 | 3300025315 | Ga0207697_10023685 | Ga0207697_100236852 | 146 |
| 655 | 3300025900 | Ga0207710_10017418 | Ga0207710_100174184 | 146 |
| 656 | 3300025901 | Ga0207688_10155218 | Ga0207688_101552182 | 146 |
| 657 | 3300025911 | Ga0207654_10024818 | Ga0207654_100248182 | 146 |
| 658 | 3300025914 | Ga0207671_10057777 | Ga0207671_100577773 | 146 |
| 659 | 3300025916 | Ga0207663_11217728 | Ga0207663_112177281 | 146 |
| 660 | 3300025919 | Ga0207657_10028720 | Ga0207657_100287205 | 146 |
| 661 | 3300025923 | Ga0207681_10115332 | Ga0207681_101153322 | 146 |
| 662 | 3300025924 | Ga0207694_10089000 | Ga0207694_100890003 | 146 |
| 663 | 3300025927 | Ga0207687_10456483 | Ga0207687_104564832 | 146 |
| 664 | 3300025931 | Ga0207644_10044200 | Ga0207644_100442004 | 146 |
| 665 | 3300025933 | Ga0207706_10382150 | Ga0207706_103821502 | 146 |
| 666 | 3300025935 | Ga0207709_10204047 | Ga0207709_102040472 | 146 |
| 667 | 3300025939 | Ga0207665_10509451 | Ga0207665_105094512 | 146 |
| 668 | 3300025949 | Ga0207667_10071162 | Ga0207667_100711623 | 146 |
| 669 | 3300025972 | Ga0207668_10136632 | Ga0207668_101366323 | 146 |
| 670 | 3300025986 | Ga0207658_10160833 | Ga0207658_101608332 | 146 |
| 671 | 3300026035 | Ga0207703_10795917 | Ga0207703_107959172 | 146 |
| 672 | 3300026041 | Ga0207639_10218351 | Ga0207639_102183513 | 146 |
| 673 | 3300026067 | Ga0207678_10177249 | Ga0207678_101772493 | 146 |
| 674 | 3300026078 | Ga0207702_10083112 | Ga0207702_100831124 | 146 |
| 675 | 3300026116 | Ga0207674_10132679 | Ga0207674_101326793 | 146 |
| 676 | 3300026142 | Ga0207698_10033713 | Ga0207698_100337135 | 146 |
| 677 | 3300027296 | Ga0209389_1000040 | Ga0209389_100004050 | 146 |
| 678 | 3300027296 | Ga0209389_1000123 | Ga0209389_100012354 | 146 |
| 679 | 3300027357 | Ga0209589_1000036 | Ga0209589_100003654 | 146 |
| 680 | 3300027361 | Ga0209489_100006 | Ga0209489_100006382 | 146 |
| 681 | 3300027363 | Ga0209700_100005 | Ga0209700_100005249 | 146 |
| 682 | 3300027866 | Ga0209813_10020077 | Ga0209813_100200772 | 146 |
| 683 | 3300028379 | Ga0268266_10325522 | Ga0268266_103255222 | 146 |
| 684 | 3300028380 | Ga0268265_10081543 | Ga0268265_100815432 | 146 |
| 685 | 3300033180 | Ga0307510_10014440 | Ga0307510_100144407 | 146 |
| 686 | 3300037312 | Ga0395899_0302526 | Ga0395899_0302526_210_695 | 146 |
| 687 | 3300037418 | Ga0395900_0071844 | Ga0395900_0071844_1910_2395 | 146 |
| 688 | 3300037466 | Ga0395898_0126168 | Ga0395898_0126168_1131_1616 | 146 |
| 689 | 3300037471 | Ga0395905_0047688 | Ga0395905_0047688_1365_1850 | 146 |
| 690 | 3300038443 | Ga0395901_0836117 | Ga0395901_0836117_359_844 | 146 |
| 691 | 3300046471 | Ga0495650_0230755 | Ga0495650_0230755_153_593 | 146 |
| 692 | 3300046474 | Ga0495605_0083378 | Ga0495605_0083378_249_743 | 146 |
| 693 | 3300046507 | Ga0495606_0115424 | Ga0495606_0115424_126_620 | 146 |
| 694 | 3300046519 | Ga0495632_0258233 | Ga0495632_0258233_218_712 | 146 |
| 695 | 3300046522 | Ga0495643_0005870 | Ga0495643_0005870_5233_5727 | 146 |
| 696 | 3300046522 | Ga0495643_0138246 | Ga0495643_0138246_251_739 | 146 |
| 697 | 3300046616 | Ga0495668_0030154 | Ga0495668_0030154_670_1164 | 146 |
| 698 | 3300046810 | Ga0495660_0195233 | Ga0495660_0195233_60_554 | 146 |
| 699 | 3300047443 | Ga0495687_011356 | Ga0495687_011356_484_978 | 146 |
| 700 | 3300048091 | Ga0495626_0245795 | Ga0495626_0245795_158_646 | 146 |
| 701 | 3300048903 | Ga0496100_0202830 | Ga0496100_0202830_435_929 | 146 |
| 702 | 3300048905 | Ga0496102_0065738 | Ga0496102_0065738_1665_2159 | 146 |
| 703 | 3300048912 | Ga0496109_0077439 | Ga0496109_0077439_1272_1766 | 146 |
| 704 | 3300048913 | Ga0496110_0069938 | Ga0496110_0069938_1321_1815 | 146 |
| 705 | 3300048915 | Ga0496112_0244486 | Ga0496112_0244486_372_866 | 146 |
| 706 | 3300048916 | Ga0496113_0034546 | Ga0496113_0034546_1073_1567 | 146 |
| 707 | 3300048916 | Ga0496113_0536033 | Ga0496113_0536033_328_813 | 146 |
| 708 | 3300048920 | Ga0496117_0300584 | Ga0496117_0300584_51_545 | 146 |
| 709 | 3300048922 | Ga0496119_0056073 | Ga0496119_0056073_1409_1903 | 146 |
| 710 | 3300050491 | nmdc:mga00v17_61809_c1 | nmdc:mga00v17_61809_c1_1482_1976 | 146 |
| 711 | 3300050492 | nmdc:mga0yw44_101435_c1 | nmdc:mga0yw44_101435_c1_478_972 | 146 |
| 712 | 3300050493 | nmdc:mga0k408_36783_c1 | nmdc:mga0k408_36783_c1_799_1293 | 146 |
| 713 | 3300050494 | nmdc:mga06z11_28852_c1 | nmdc:mga06z11_28852_c1_1502_1996 | 146 |
| 714 | 3300050495 | nmdc:mga04h51_22672_c1 | nmdc:mga04h51_22672_c1_1193_1687 | 146 |
| 715 | 3300050496 | nmdc:mga07m45_454666_c1 | nmdc:mga07m45_454666_c1_56_496 | 146 |
| 716 | 3300050496 | nmdc:mga07m45_8643_c1 | nmdc:mga07m45_8643_c1_1760_2254 | 146 |
| 717 | 3300050516 | nmdc:mga0sz30_55658_c1 | nmdc:mga0sz30_55658_c1_940_1434 | 146 |
| 718 | 3300053086 | Ga0500578_0059588 | Ga0500578_0059588_264_752 | 146 |
| 719 | 3300053109 | Ga0500569_143764 | Ga0500569_143764_17_460 | 146 |
| 720 | iso_pu_bacteria | 8016583857 | 8016593179 | 146 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a5c-assembly1.cif.gz_E | inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic v1-atpase | 0.5367 | 6 | 65 |
| 6vq9-assembly1.cif.gz_D | mammalian v-atpase from rat brain soluble v1 region rotational state 1 with sidk and adp (from focused refinement) | 0.5087 | 6 | 69 |
| 2rkw-assembly1.cif.gz_B | intermediate position of atp on its trail to the binding pocket inside the subunit b mutant r416w of the energy converter a1ao atp synthase | 0.5078 | 6 | 73 |
| 3dsr-assembly1.cif.gz_A | adp in transition binding site in the subunit b of the energy converter a1ao atp synthase | 0.5039 | 6 | 76 |
| 3dsr-assembly1.cif.gz_B | adp in transition binding site in the subunit b of the energy converter a1ao atp synthase | 0.5039 | 6 | 73 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4eznA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4552 | 3 | 75 | 1.20.1270.10 |
| 3exaA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) domain | 0.4546 | 1 | 75 | 1.10.287.890 |
| 4ezpA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4512 | 3 | 75 | 1.20.1270.10 |
| 4jwiA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4426 | 3 | 74 | 1.20.1270.10 |
| 4hybA02 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2; | 0.4381 | 3 | 74 | 1.20.1270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525ISS0-F1-model_v4 | Uncharacterized protein | 0.9608 | 1 | 88 |
|
| AF-A0A525ISS0-F1-model_v4 | Uncharacterized protein | 0.9503 | 1 | 88 |
|
| AF-A0A1H1SDV5-F1-model_v4 | Uncharacterized protein | 0.9103 | 6 | 95 |
|
| AF-A0A2H9VCN2-F1-model_v4 | deleted | 0.8103 | 6 | 84 |
|
| AF-A0A2H9VCN2-F1-model_v4 | deleted | 0.6902 | 6 | 84 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar