F477288

General Info

Members Datasets Scaffolds Average Seq Length
720 382 492 386

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10144624|rootL2_101446242
Length 427
Sequence MSKTEDKDISPGMVLLLAAATGLIVANLYYAQTLVGPISQSTGLSPQAAGLIVTLTQIGYCLGLLFIVPLGDLLENRRLIVTGLLFTSAMLVLAAFSTTAWMFLTAALGIGLGSVAAQIVVPFAAHLSKEGTRGHTVGKVVSGLLLGIMLSRPVASLVADASNWHVVFGGGALIVLLVALVLRAKLPLRVPNHHMTYPKLMGSLWHLFLQTSVLRRRAAYHAGLFGSFSLFWTVTPLMLAGPLFHLSQTGIAIFALVGMAGAVASPVAGKLADAGHTLMATAAALGLGVIGFALPLIAPGSRDIALAILVLASIILDMGVAANLVLGQRAIFTLGAEVRSRLNGVYFALFFAGGALGSALGGWMYATHGWHAALLTGMAFNGAALLYWLTEYASHTTPTVIPAKAGIHTPQALKLSMDSGLRRNDVA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
24 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
25 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
26 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
27 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
28 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
29 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
30 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
31 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
32 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
33 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
34 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
35 2643221556 Massilia sp. Root1485 Isolate Unclassified
36 2643221638 Duganella sp. Root336D2 Isolate Unclassified
37 2643221645 Massilia sp. Root351 Isolate Unclassified
38 2643221664 Massilia sp. Root418 Isolate Unclassified
39 2643221684 Massilia sp. Root133 Isolate Unclassified
40 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
41 2718217882 Rhizobium sp. N741 Isolate Nodule
42 2718217927 Rhizobium sp. N324 Isolate Nodule
43 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
44 2718218009 Rhizobium sp. N561 Isolate Nodule
45 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
46 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
47 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
48 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
49 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
50 2718218363 Rhizobium sp. N113 Isolate Nodule
51 2718218365 Rhizobium sp. N731 Isolate Nodule
52 2718218366 Rhizobium sp. N621 Isolate Nodule
53 2718218423 Rhizobium sp. N941 Isolate Nodule
54 2721755514 Rhizobium sp. N6212 Isolate Nodule
55 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
56 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
57 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
58 2721755809 Rhizobium sp. N541 Isolate Nodule
59 2721755810 Rhizobium sp. N871 Isolate Nodule
60 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
61 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
62 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
63 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
64 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
65 2728369365 Rhizobium sp. N1341 Isolate Nodule
66 2728369397 Rhizobium sp. N1314 Isolate Nodule
67 2738541280 Massilia sp. GV090 Isolate Unclassified
68 2738541293 Rhizobium sp. GV031 Isolate Unclassified
69 2738541297 Duganella sp. GV083 Isolate Unclassified
70 2738541300 Massilia sp. GV016 Isolate Unclassified
71 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
72 2738541357 Duganella sp. GV053 Isolate Unclassified
73 2738543003 Duganella sp. GV066 Isolate Unclassified
74 2738543018 Massilia sp. GV045 Isolate Unclassified
75 2738543026 Duganella sp. GV089 Isolate Unclassified
76 2738543029 Duganella sp. GV039 Isolate Unclassified
77 2738543030 Massilia sp. GV097 Isolate Unclassified
78 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
79 2791355256 Rhizobium sp. M10 Isolate Nodule
80 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
81 2791355260 Rhizobium sp. L9 Isolate Nodule
82 2791355261 Rhizobium sp. J15 Isolate Nodule
83 2791355262 Rhizobium sp. M1 Isolate Nodule
84 2791355263 Rhizobium chutanense C5 Isolate Nodule
85 2791355264 Rhizobium sp. S9 Isolate Nodule
86 2791355265 Rhizobium sp. H4 Isolate Nodule
87 2791355266 Rhizobium sp. L43 Isolate Nodule
88 2791355267 Rhizobium sp. L18 Isolate Nodule
89 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
90 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
91 2802429633 Rhizobium anhuiense J3 Isolate Nodule
92 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
93 2802429637 Rhizobium anhuiense C15 Isolate Nodule
94 2818991436 Collimonas arenae 515 Isolate Unclassified
95 2821131069 Duganella sp. 1224 Isolate Unclassified
96 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
97 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
98 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
99 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
100 2838048938 Rhizobium pisi 27/80 Isolate Nodule
101 2838061910 Rhizobium phaseoli L15 Isolate Nodule
102 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
103 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
104 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
105 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
106 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
107 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
108 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
109 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
110 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
111 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
112 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
113 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
114 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
115 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
116 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
117 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
118 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
119 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
120 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
121 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
122 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
123 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
124 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
125 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
126 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
127 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
128 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
129 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
130 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
131 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
132 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
133 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
134 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
135 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
136 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
137 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
138 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
139 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
140 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
141 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
142 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
143 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
144 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
145 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
146 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
147 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
148 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
149 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
150 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
151 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
152 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
153 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
154 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
155 2842711865 Duganella sp. R-73148 Isolate Unclassified
156 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
157 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
158 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
159 2857553236 Duganella sp. R-74557 Isolate Unclassified
160 2857558681 Duganella sp. R-74565 Isolate Unclassified
161 2857564685 Duganella sp. R-74599 Isolate Unclassified
162 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
163 2904424332 Duganella sp. 1411 Isolate Rhizosphere
164 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
165 2919476304 Duganella sp. 3397 Isolate Unclassified
166 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
167 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
168 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
169 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
170 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
171 2933599457 Rhizobium phaseoli M3 Isolate Nodule
172 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
173 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
174 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
175 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
176 2936381700 Rhizobium chutanense C16 Isolate Unclassified
177 2996887358 Rhizobium sp. R711 Isolate Nodule
178 2996893221 Rhizobium sp. R635 Isolate Nodule
179 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
180 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
181 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
182 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
183 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
184 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
185 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
188 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
189 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
190 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
191 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
192 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
193 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
194 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
195 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
196 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
197 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
198 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
199 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
200 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
201 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
202 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
203 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
204 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
205 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
206 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
207 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
208 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
209 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
210 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
211 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
212 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
213 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
214 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
215 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
216 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
217 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
218 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
219 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
220 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
222 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
223 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
225 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
226 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
228 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
229 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
230 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
231 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
239 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
240 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
241 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
242 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
243 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
251 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
252 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
253 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
254 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
255 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
256 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
276 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
277 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
282 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
283 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
284 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
285 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
293 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
294 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
295 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
296 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
297 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
298 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
299 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
300 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
303 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
306 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
307 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
319 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
322 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
323 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
324 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
325 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
326 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
327 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
328 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
338 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
345 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
351 8005258706 Rhizobium sp. R693 Isolate Nodule
352 8005275841 Rhizobium sp. N4311 Isolate Nodule
353 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
354 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
355 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
356 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
357 8005321885 Rhizobium sp. R72 Isolate Nodule
358 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
359 8005382845 Rhizobium sp. R634 Isolate Nodule
360 8005395548 Rhizobium sp. R339 Isolate Nodule
361 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
362 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
363 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
364 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
365 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
366 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
367 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
368 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
369 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
370 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
371 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
372 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
373 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
374 8018176218 Rhizobium sp. N122 Isolate Nodule
375 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
376 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
377 8024501048 Rhizobium sp. H4 Isolate Nodule
378 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
379 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
380 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
381 8056382006 Rhizobium croatiense 13T Isolate Nodule
382 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.33
Metatranscriptomes 0
Isolates 31.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.39
Nodule 23.61
Rhizoplane 0.97
Rhizosphere 39.72
Stem 0
Stem Tuber 0
Unclassified 14.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000129 3300002739 Bacteria 17721
2 JGI25158J39367_1000221 3300002739 Bacteria 13394
3 JGI25158J39367_1000877 3300002739 Bacteria 5705
4 JGI25152J39213_1002299 3300002773 Bacteria 7368
5 JGI25152J39213_1002640 3300002773 Bacteria 6651
6 JGI25150J39212_1000165 3300002774 Bacteria 37364
7 JGI25150J39212_1005368 3300002774 Bacteria 2741
8 JGI25150J39212_1009032 3300002774 Bacteria 1919
9 JGI25150J39212_1011152 3300002774 Bacteria 1640
10 JGI25159J45721_1000914 3300002987 Bacteria 12835
11 JGI25159J45721_1006700 3300002987 Bacteria 3404
12 JGI25151J46595_10000329 3300003187 Bacteria 51364
13 JGI25151J46595_10001052 3300003187 Bacteria 20592
14 JGI25151J46595_10027272 3300003187 Bacteria 2292
15 JGI25153J46596_10003106 3300003215 Bacteria 9362
16 JGI25153J46596_10009303 3300003215 Bacteria 4588
17 rootL2_10021691 3300003322 Bacteria 3599
18 rootL2_10021692 3300003322 Bacteria 3691
19 rootL2_10042496 3300003322 Bacteria 3522
20 rootL2_10094471 3300003322 Bacteria 4352
21 rootL2_10144624 3300003322 Bacteria 4952
22 JGI25161J50226_1000099 3300003374 Bacteria 70186
23 JGI25161J50226_1000140 3300003374 Bacteria 50175
24 JGI25161J50226_1000162 3300003374 Bacteria 46749
25 JGI25161J50226_1000840 3300003374 Bacteria 11442
26 Ga0055529_1000097 3300003763 Bacteria 132109
27 Ga0055526_1000030 3300003771 Bacteria 143833
28 Ga0055526_1000125 3300003771 Bacteria 67941
29 Ga0055526_1000163 3300003771 Bacteria 58968
30 Ga0055526_1000269 3300003771 Bacteria 43927
31 Ga0055526_1000326 3300003771 Bacteria 39597
32 Ga0055526_1000484 3300003771 Bacteria 31547
33 Ga0055526_1003173 3300003771 Bacteria 10646
34 Ga0055526_1006325 3300003771 Bacteria 6465
35 Ga0055537_1000120 3300003773 Bacteria 59665
36 Ga0055537_1000122 3300003773 Bacteria 58918
37 Ga0055537_1004192 3300003773 Bacteria 4188
38 Ga0055524_1000010 3300003775 Bacteria 282893
39 Ga0055524_1000049 3300003775 Bacteria 149383
40 Ga0055524_1003087 3300003775 Bacteria 8223
41 Ga0055524_1008650 3300003775 Bacteria 4213
42 Ga0055534_1000170 3300003784 Bacteria 48165
43 Ga0055534_1000261 3300003784 Bacteria 36634
44 Ga0055534_1004648 3300003784 Bacteria 3901
45 Ga0055528_1000042 3300003790 Bacteria 104874
46 Ga0055528_1000379 3300003790 Bacteria 36239
47 Ga0055528_1000774 3300003790 Bacteria 22251
48 Ga0055528_1013285 3300003790 Bacteria 3129
49 Ga0055530_10000057 3300003791 Bacteria 100782
50 Ga0055530_10006222 3300003791 Bacteria 5392
51 Ga0055530_10009376 3300003791 Bacteria 3770
52 Ga0055540_1000283 3300003792 Bacteria 45546
53 Ga0055540_1005136 3300003792 Bacteria 5627
54 Ga0055531_10015789 3300003794 Bacteria 3302
55 Ga0055531_10027074 3300003794 Bacteria 2023
56 Ga0055543_1000111 3300004625 Bacteria 70136
57 Ga0055543_1000128 3300004625 Bacteria 63029
58 Ga0055543_1002795 3300004625 Bacteria 5522
59 Ga0055543_1003432 3300004625 Bacteria 4683
60 Ga0065165_1000003 3300005262 Bacteria 390701
61 Ga0065165_1000351 3300005262 Bacteria 75383
62 Ga0065165_1000364 3300005262 Bacteria 74307
63 Ga0065165_1017006 3300005262 Bacteria 2698
64 Ga0070665_100157423 3300005548 Bacteria 2273
65 Ga0075365_10003176 3300006038 Bacteria 8390
66 Ga0075367_10008091 3300006178 Bacteria 5428
67 Ga0075369_10000132 3300006186 Bacteria 20799
68 Ga0075370_10012069 3300006353 Bacteria 4556
69 Ga0079104_1006300 3300006946 Bacteria 4526
70 Ga0099826_10000002 3300006948 Bacteria 1125830
71 Ga0099826_10000005 3300006948 Bacteria 465206
72 Ga0105244_10000853 3300009036 Bacteria 25698
73 Ga0105244_10001794 3300009036 Bacteria 16819
74 Ga0123342_1029639 3300009766 Bacteria 2826
75 Ga0123342_1042666 3300009766 Bacteria 1591
76 Ga0182008_10005451 3300014497 Bacteria 7243
77 Ga0182006_1000019 3300015261 Bacteria 294192
78 Ga0182006_1000102 3300015261 Bacteria 94384
79 Ga0182006_1008522 3300015261 Bacteria 4647
80 Ga0182007_10002852 3300015262 Bacteria 8413
81 Ga0182005_1000005 3300015265 Bacteria 537378
82 Ga0182005_1000006 3300015265 Bacteria 515188
83 Ga0182005_1000238 3300015265 Bacteria 35328
84 Ga0213872_10000040 3300021361 Bacteria 122419
85 Ga0213872_10000059 3300021361 Bacteria 100362
86 Ga0209436_100005 3300025208 Bacteria 151087
87 Ga0209436_100029 3300025208 Bacteria 85964
88 Ga0209436_100524 3300025208 Bacteria 16667
89 Ga0209437_108305 3300025233 Bacteria 1663
90 Ga0207425_1000024 3300025245 Bacteria 328978
91 Ga0207425_1000085 3300025245 Bacteria 95577
92 Ga0207425_1000633 3300025245 Bacteria 19975
93 Ga0207425_1001990 3300025245 Bacteria 7641
94 Ga0209646_1000049 3300025246 Bacteria 301924
95 Ga0209646_1000247 3300025246 Bacteria 54824
96 Ga0209129_1000146 3300025258 Bacteria 115180
97 Ga0209129_1000384 3300025258 Bacteria 35556
98 Ga0209129_1000656 3300025258 Bacteria 23090
99 Ga0209129_1001961 3300025258 Bacteria 10721
100 Ga0209129_1002689 3300025258 Bacteria 8365
101 Ga0209129_1004653 3300025258 Bacteria 5251
102 Ga0209565_1000009 3300025263 Bacteria 751701
103 Ga0209565_1000018 3300025263 Bacteria 460940
104 Ga0209565_1001544 3300025263 Bacteria 9891
105 Ga0209565_1006293 3300025263 Bacteria 3347
106 Ga0209455_1000031 3300025272 Bacteria 519952
107 Ga0209673_1000006 3300025273 Bacteria 650600
108 Ga0209673_1000019 3300025273 Bacteria 449094
109 Ga0209673_1000384 3300025273 Bacteria 79540
110 Ga0209673_1000977 3300025273 Bacteria 35281
111 Ga0209673_1002902 3300025273 Bacteria 10856
112 Ga0209673_1005401 3300025273 Bacteria 6439
113 Ga0209130_1000020 3300025284 Bacteria 379297
114 Ga0209130_1000036 3300025284 Bacteria 284111
115 Ga0209130_1000055 3300025284 Bacteria 211696
116 Ga0209130_1000240 3300025284 Bacteria 70293
117 Ga0209130_1001310 3300025284 Bacteria 17027
118 Ga0209130_1003245 3300025284 Bacteria 7130
119 Ga0209675_1000005 3300025291 Bacteria 849192
120 Ga0209675_1000013 3300025291 Bacteria 448220
121 Ga0209675_1000634 3300025291 Bacteria 24993
122 Ga0209675_1014380 3300025291 Bacteria 2413
123 Ga0209676_1021853 3300025292 Bacteria 2135
124 Ga0209025_1000050 3300025294 Bacteria 331531
125 Ga0209025_1000058 3300025294 Bacteria 311398
126 Ga0209025_1001479 3300025294 Bacteria 30558
127 Ga0209564_1000010 3300025295 Bacteria 885399
128 Ga0209564_1000078 3300025295 Bacteria 275766
129 Ga0209564_1000124 3300025295 Bacteria 202046
130 Ga0209564_1000240 3300025295 Bacteria 118922
131 Ga0209564_1000388 3300025295 Bacteria 79331
132 Ga0209564_1000464 3300025295 Bacteria 67994
133 Ga0209564_1000512 3300025295 Bacteria 63708
134 Ga0209564_1001530 3300025295 Bacteria 22948
135 Ga0209564_1007537 3300025295 Bacteria 5604
136 Ga0209564_1012645 3300025295 Bacteria 3659
137 Ga0209564_1022454 3300025295 Bacteria 2230
138 Ga0209758_1000083 3300025297 Bacteria 257283
139 Ga0209758_1000960 3300025297 Bacteria 38911
140 Ga0209758_1001497 3300025297 Bacteria 27181
141 Ga0209758_1003320 3300025297 Bacteria 14817
142 Ga0209758_1011348 3300025297 Bacteria 5174
143 Ga0209050_1000304 3300025298 Bacteria 100918
144 Ga0209050_1000360 3300025298 Bacteria 87458
145 Ga0209050_1001621 3300025298 Bacteria 23090
146 Ga0209050_1003737 3300025298 Bacteria 10929
147 Ga0209050_1004042 3300025298 Bacteria 10298
148 Ga0209256_1000007 3300025299 Bacteria 1136599
149 Ga0209256_1000040 3300025299 Bacteria 366839
150 Ga0209256_1000052 3300025299 Bacteria 299374
151 Ga0209256_1000070 3300025299 Bacteria 245034
152 Ga0209256_1000738 3300025299 Bacteria 42913
153 Ga0209256_1000778 3300025299 Bacteria 41213
154 Ga0209256_1003086 3300025299 Bacteria 12230
155 Ga0209256_1003337 3300025299 Bacteria 11390
156 Ga0209256_1006190 3300025299 Bacteria 6454
157 Ga0209256_1007396 3300025299 Bacteria 5429
158 Ga0209256_1016254 3300025299 Bacteria 2548
159 Ga0207426_1000008 3300025302 Bacteria 848730
160 Ga0207426_1001525 3300025302 Bacteria 18880
161 Ga0209051_1000308 3300025303 Bacteria 76477
162 Ga0209051_1003270 3300025303 Bacteria 10749
163 Ga0209257_1000853 3300025304 Bacteria 43617
164 Ga0209257_1001683 3300025304 Bacteria 24879
165 Ga0209257_1018341 3300025304 Bacteria 2698
166 Ga0207655_1006700 3300025728 Bacteria 7587
167 Ga0207655_1040622 3300025728 Bacteria 2004
168 Ga0207711_10065806 3300025941 Bacteria 3134
169 Ga0209281_1008839 3300027111 Bacteria 2409
170 Ga0209281_1011402 3300027111 Bacteria 1993
171 Ga0209282_1000001 3300027666 Bacteria 2450367
172 Ga0209282_1000003 3300027666 Bacteria 856377
173 Ga0209813_10021420 3300027866 Bacteria 1818
174 Ga0307515_10035804 3300028794 Bacteria 8057
175 Ga0316181_1068628 3300030744 Bacteria 8778
176 Ga0307408_100000022 3300031548 Bacteria 310242
177 Ga0307408_100003823 3300031548 Bacteria 10250
178 Ga0307408_100009899 3300031548 Bacteria 6281
179 Ga0307408_100019273 3300031548 Bacteria 4592
180 Ga0307408_100035811 3300031548 Bacteria 3485
181 Ga0307405_10009630 3300031731 Bacteria 4962
182 Ga0307518_10010757 3300031838 Bacteria 6536
183 Ga0307406_10013649 3300031901 Bacteria 4657
184 Ga0307412_10013523 3300031911 Bacteria 4788
185 Ga0395899_0001133 3300037312 Bacteria 23575
186 Ga0395900_0007781 3300037418 Bacteria 11056
187 Ga0395905_0001288 3300037471 Bacteria 30819
188 Ga0395905_0020053 3300037471 Bacteria 6335
189 Ga0395901_0032091 3300038443 Bacteria 5419
190 Ga0436361_0173203 3300039447 Bacteria 24297
191 Ga0436361_0993359 3300039447 Bacteria 43823
192 Ga0439465_0001522 3300041413 Bacteria 7532
193 Ga0451787_341380 3300041441 Bacteria 2662
194 Ga0451833_1382245 3300041491 Bacteria 2150
195 Ga0451839_0067884 3300041496 Bacteria 1793
196 Ga0451841_0994005 3300041498 Bacteria 1988
197 Ga0451847_0315990 3300041503 Bacteria 2228
198 Ga0451853_2236988 3300041512 Bacteria 3680
199 Ga0466967_0197284 3300045976 Bacteria 1905
200 Ga0495617_000157 3300046452 Bacteria 43264
201 Ga0495617_000223 3300046452 Bacteria 34537
202 Ga0495617_000979 3300046452 Bacteria 13256
203 Ga0495617_010003 3300046452 Bacteria 3251
204 Ga0495627_000004 3300046453 Bacteria 640612
205 Ga0495590_0000014 3300046457 Bacteria 258314
206 Ga0495638_0000064 3300046460 Bacteria 180807
207 Ga0495638_0011865 3300046460 Bacteria 5991
208 Ga0495638_0013142 3300046460 Bacteria 5651
209 Ga0495638_0029176 3300046460 Bacteria 3558
210 Ga0495638_0119192 3300046460 Bacteria 1561
211 Ga0495653_0000056 3300046463 Bacteria 100732
212 Ga0495653_0008446 3300046463 Bacteria 8442
213 Ga0495650_0000317 3300046471 Bacteria 86483
214 Ga0495650_0000328 3300046471 Bacteria 85135
215 Ga0495650_0000368 3300046471 Bacteria 78685
216 Ga0495650_0000918 3300046471 Bacteria 34577
217 Ga0495650_0001126 3300046471 Bacteria 29062
218 Ga0495650_0001529 3300046471 Bacteria 21970
219 Ga0495650_0003117 3300046471 Bacteria 12431
220 Ga0495605_0000267 3300046474 Bacteria 59550
221 Ga0495605_0000906 3300046474 Bacteria 20363
222 Ga0495584_0000026 3300046491 Bacteria 114028
223 Ga0495584_0000683 3300046491 Bacteria 22522
224 Ga0495584_0002580 3300046491 Bacteria 10216
225 Ga0495585_0000352 3300046492 Bacteria 44459
226 Ga0495585_0003835 3300046492 Bacteria 10001
227 Ga0495585_0007906 3300046492 Bacteria 6467
228 Ga0495585_0020995 3300046492 Bacteria 3750
229 Ga0495585_0051231 3300046492 Bacteria 2288
230 Ga0495596_0007147 3300046500 Bacteria 5052
231 Ga0495607_0000295 3300046501 Bacteria 52177
232 Ga0495607_0002318 3300046501 Bacteria 15610
233 Ga0495607_0002600 3300046501 Bacteria 14516
234 Ga0495607_0016919 3300046501 Bacteria 4694
235 Ga0495607_0022274 3300046501 Bacteria 3981
236 Ga0495607_0064155 3300046501 Bacteria 2075
237 Ga0495607_0065930 3300046501 Bacteria 2039
238 Ga0495607_0101034 3300046501 Bacteria 1544
239 Ga0495583_0000014 3300046506 Bacteria 320136
240 Ga0495583_0000108 3300046506 Bacteria 139791
241 Ga0495583_0000287 3300046506 Bacteria 80398
242 Ga0495583_0001630 3300046506 Bacteria 21886
243 Ga0495606_0000757 3300046507 Bacteria 49718
244 Ga0495606_0000880 3300046507 Bacteria 44927
245 Ga0495606_0000897 3300046507 Bacteria 44320
246 Ga0495606_0001004 3300046507 Bacteria 41149
247 Ga0495606_0001694 3300046507 Bacteria 28468
248 Ga0495606_0002140 3300046507 Bacteria 23813
249 Ga0495606_0002897 3300046507 Bacteria 18948
250 Ga0495606_0004118 3300046507 Bacteria 14766
251 Ga0495606_0004694 3300046507 Bacteria 13491
252 Ga0495606_0006620 3300046507 Bacteria 10630
253 Ga0495606_0036949 3300046507 Bacteria 3321
254 Ga0495606_0039895 3300046507 Bacteria 3158
255 Ga0495610_0000027 3300046512 Bacteria 275273
256 Ga0495610_0001253 3300046512 Bacteria 22804
257 Ga0495610_0001490 3300046512 Bacteria 20605
258 Ga0495610_0011927 3300046512 Bacteria 5272
259 Ga0495610_0026583 3300046512 Bacteria 3088
260 Ga0495610_0036071 3300046512 Bacteria 2531
261 Ga0495616_0002237 3300046513 Bacteria 12947
262 Ga0495616_0005272 3300046513 Bacteria 7975
263 Ga0495616_0005336 3300046513 Bacteria 7927
264 Ga0495620_0033526 3300046515 Bacteria 2330
265 Ga0495631_0018007 3300046518 Bacteria 3333
266 Ga0495637_0000240 3300046520 Bacteria 42746
267 Ga0495637_0000634 3300046520 Bacteria 24740
268 Ga0495643_0000108 3300046522 Bacteria 136032
269 Ga0495643_0000153 3300046522 Bacteria 112514
270 Ga0495643_0000471 3300046522 Bacteria 51325
271 Ga0495643_0003818 3300046522 Bacteria 10865
272 Ga0495643_0017752 3300046522 Bacteria 4152
273 Ga0495643_0027141 3300046522 Bacteria 3222
274 Ga0495643_0103953 3300046522 Bacteria 1452
275 Ga0495644_0000244 3300046523 Bacteria 25588
276 Ga0495644_0000399 3300046523 Bacteria 19433
277 Ga0495644_0022630 3300046523 Bacteria 2395
278 Ga0495644_0053451 3300046523 Bacteria 1517
279 Ga0495648_0000006 3300046524 Bacteria 361208
280 Ga0495648_0001600 3300046524 Bacteria 22041
281 Ga0495648_0003425 3300046524 Bacteria 13939
282 Ga0495648_0004553 3300046524 Bacteria 11811
283 Ga0495648_0005550 3300046524 Bacteria 10464
284 Ga0495648_0006664 3300046524 Bacteria 9354
285 Ga0495648_0012448 3300046524 Bacteria 6347
286 Ga0495648_0015110 3300046524 Bacteria 5621
287 Ga0495642_0000740 3300046528 Bacteria 16183
288 Ga0495642_0000946 3300046528 Bacteria 13585
289 Ga0495652_0003647 3300046529 Bacteria 15080
290 Ga0495654_0000131 3300046530 Bacteria 80339
291 Ga0495654_0001470 3300046530 Bacteria 16128
292 Ga0495609_0000207 3300046538 Bacteria 58652
293 Ga0495609_0000464 3300046538 Bacteria 32813
294 Ga0495609_0000876 3300046538 Bacteria 22076
295 Ga0495609_0000944 3300046538 Bacteria 21046
296 Ga0495609_0005406 3300046538 Bacteria 6722
297 Ga0495609_0009785 3300046538 Bacteria 4624
298 Ga0495597_0000043 3300046542 Bacteria 106919
299 Ga0495597_0000648 3300046542 Bacteria 28260
300 Ga0495597_0001867 3300046542 Bacteria 14395
301 Ga0495597_0006327 3300046542 Bacteria 6134
302 Ga0495597_0014350 3300046542 Bacteria 3774
303 Ga0495597_0020464 3300046542 Bacteria 3081
304 Ga0495622_0000061 3300046557 Bacteria 96048
305 Ga0495622_0000155 3300046557 Bacteria 58297
306 Ga0495622_0000208 3300046557 Bacteria 46373
307 Ga0495622_0049391 3300046557 Bacteria 1953
308 Ga0495633_0000132 3300046558 Bacteria 100231
309 Ga0495633_0000469 3300046558 Bacteria 41254
310 Ga0495633_0000535 3300046558 Bacteria 37893
311 Ga0495633_0000693 3300046558 Bacteria 30805
312 Ga0495633_0002795 3300046558 Bacteria 12067
313 Ga0495633_0004214 3300046558 Bacteria 9212
314 Ga0495633_0005638 3300046558 Bacteria 7590
315 Ga0495633_0012668 3300046558 Bacteria 4474
316 Ga0495633_0017351 3300046558 Bacteria 3683
317 Ga0495633_0084719 3300046558 Bacteria 1474
318 Ga0495656_0013284 3300046615 Bacteria 3060
319 Ga0495668_0000046 3300046616 Bacteria 224203
320 Ga0495668_0000063 3300046616 Bacteria 184563
321 Ga0495668_0000209 3300046616 Bacteria 84817
322 Ga0495668_0000911 3300046616 Bacteria 33089
323 Ga0495668_0001057 3300046616 Bacteria 29161
324 Ga0495668_0016872 3300046616 Bacteria 4241
325 Ga0495611_0001871 3300046648 Bacteria 10034
326 Ga0495611_0002677 3300046648 Bacteria 8036
327 Ga0495611_0007893 3300046648 Bacteria 4517
328 Ga0495611_0013478 3300046648 Bacteria 3481
329 Ga0495625_0000780 3300046660 Bacteria 44247
330 Ga0495625_0001523 3300046660 Bacteria 27723
331 Ga0495625_0002153 3300046660 Bacteria 21908
332 Ga0495625_0004626 3300046660 Bacteria 12933
333 Ga0495625_0005455 3300046660 Bacteria 11593
334 Ga0495625_0010304 3300046660 Bacteria 7749
335 Ga0495625_0035514 3300046660 Bacteria 3673
336 Ga0495625_0058504 3300046660 Bacteria 2739
337 Ga0495625_0074345 3300046660 Bacteria 2380
338 Ga0495625_0113987 3300046660 Bacteria 1845
339 Ga0495625_0117376 3300046660 Bacteria 1814
340 Ga0495659_0000043 3300046664 Bacteria 56421
341 Ga0495659_0000398 3300046664 Bacteria 16654
342 Ga0495659_0002842 3300046664 Bacteria 5560
343 Ga0495659_0003193 3300046664 Bacteria 5249
344 Ga0495661_0002960 3300046665 Bacteria 12825
345 Ga0495661_0016467 3300046665 Bacteria 4900
346 Ga0495661_0018493 3300046665 Bacteria 4582
347 Ga0495661_0083396 3300046665 Bacteria 1837
348 Ga0495588_0000062 3300046674 Bacteria 253674
349 Ga0495646_0081763 3300046680 Bacteria 1881
350 Ga0495669_0000224 3300046684 Bacteria 33850
351 Ga0495669_0021410 3300046684 Bacteria 2805
352 Ga0495670_0000177 3300046691 Bacteria 28439
353 Ga0495670_0000447 3300046691 Bacteria 19759
354 Ga0495670_0010900 3300046691 Bacteria 4466
355 Ga0495670_0018740 3300046691 Bacteria 3409
356 Ga0495670_0042648 3300046691 Bacteria 2264
357 Ga0495671_0000106 3300046692 Bacteria 74947
358 Ga0495671_0000251 3300046692 Bacteria 46068
359 Ga0495671_0001329 3300046692 Bacteria 16769
360 Ga0495671_0028514 3300046692 Bacteria 2874
361 Ga0495671_0053799 3300046692 Bacteria 1997
362 Ga0495649_0007163 3300046694 Bacteria 6848
363 Ga0495649_0039513 3300046694 Bacteria 2587
364 Ga0495589_0003437 3300046794 Bacteria 8571
365 Ga0495589_0011802 3300046794 Bacteria 4533
366 Ga0495589_0059732 3300046794 Bacteria 1873
367 Ga0495600_0048506 3300046809 Bacteria 2770
368 Ga0495660_0000057 3300046810 Bacteria 133310
369 Ga0495660_0000791 3300046810 Bacteria 23702
370 Ga0495660_0001583 3300046810 Bacteria 15284
371 Ga0495660_0002052 3300046810 Bacteria 13103
372 Ga0495660_0009640 3300046810 Bacteria 5630
373 Ga0495636_0000858 3300047318 Bacteria 11238
374 Ga0495636_0010416 3300047318 Bacteria 3671
375 Ga0495672_0000023 3300047320 Bacteria 419080
376 Ga0495672_0000161 3300047320 Bacteria 96964
377 Ga0495672_0000399 3300047320 Bacteria 52911
378 Ga0495672_0003147 3300047320 Bacteria 14368
379 Ga0495672_0028406 3300047320 Bacteria 3540
380 Ga0495672_0033209 3300047320 Bacteria 3199
381 Ga0495683_0002452 3300047323 Bacteria 11206
382 Ga0495683_0009295 3300047323 Bacteria 5237
383 Ga0495683_0021122 3300047323 Bacteria 3355
384 Ga0495687_000036 3300047443 Bacteria 255427
385 Ga0495687_000740 3300047443 Bacteria 35582
386 Ga0495687_000904 3300047443 Bacteria 31028
387 Ga0495687_004099 3300047443 Bacteria 10080
388 Ga0495687_004228 3300047443 Bacteria 9843
389 Ga0495687_021336 3300047443 Bacteria 3135
390 Ga0495677_0001180 3300047445 Bacteria 10461
391 Ga0495677_0001797 3300047445 Bacteria 8588
392 Ga0495677_0004812 3300047445 Bacteria 5146
393 Ga0495677_0005292 3300047445 Bacteria 4898
394 Ga0495677_0020255 3300047445 Bacteria 2411
395 Ga0495677_0022924 3300047445 Bacteria 2266
396 Ga0495679_003595 3300047446 Bacteria 7402
397 Ga0495679_018385 3300047446 Bacteria 2482
398 Ga0495685_000020 3300047447 Bacteria 73280
399 Ga0495685_000168 3300047447 Bacteria 22027
400 Ga0495685_011249 3300047447 Bacteria 3015
401 Ga0495673_0000008 3300047469 Bacteria 752462
402 Ga0495673_0000009 3300047469 Bacteria 731993
403 Ga0495673_0000185 3300047469 Bacteria 100703
404 Ga0495673_0008065 3300047469 Bacteria 5967
405 Ga0495673_0066843 3300047469 Bacteria 1523
406 Ga0495681_0004313 3300047470 Bacteria 9731
407 Ga0495681_0006959 3300047470 Bacteria 7327
408 Ga0495681_0017431 3300047470 Bacteria 3987
409 Ga0495686_0000830 3300047472 Bacteria 39724
410 Ga0495686_0001620 3300047472 Bacteria 23577
411 Ga0495686_0016979 3300047472 Bacteria 4915
412 Ga0495686_0048047 3300047472 Bacteria 2692
413 Ga0495686_0067393 3300047472 Bacteria 2209
414 Ga0495626_0000017 3300048091 Bacteria 231648
415 Ga0495626_0002878 3300048091 Bacteria 11475
416 Ga0496102_0105349 3300048905 Bacteria 2623
417 Ga0496103_0003227 3300048906 Bacteria 10008
418 Ga0496103_0006047 3300048906 Bacteria 7232
419 Ga0496103_0107024 3300048906 Bacteria 1774
420 Ga0496105_0159422 3300048908 Bacteria 1852
421 Ga0496116_0002238 3300048919 Bacteria 20578
422 Ga0496116_0014414 3300048919 Bacteria 6314
423 Ga0496116_0024138 3300048919 Bacteria 4504
424 Ga0496116_0030817 3300048919 Bacteria 3848
425 Ga0496116_0033083 3300048919 Bacteria 3674
426 Ga0496117_0006678 3300048920 Bacteria 11554
427 Ga0496117_0021190 3300048920 Bacteria 5269
428 Ga0496118_0006625 3300048921 Bacteria 12647
429 Ga0496118_0016280 3300048921 Bacteria 6828
430 Ga0496118_0033179 3300048921 Bacteria 4241
431 Ga0496119_0013948 3300048922 Bacteria 6339
432 Ga0496119_0019374 3300048922 Bacteria 5015
433 Ga0496120_0005731 3300048923 Bacteria 9782
434 Ga0496120_0032669 3300048923 Bacteria 3135
435 Ga0496121_0018620 3300048924 Bacteria 6992
436 Ga0496121_0018883 3300048924 Bacteria 6920
437 Ga0496121_0022429 3300048924 Bacteria 6128
438 Ga0496121_0024515 3300048924 Bacteria 5765
439 Ga0496122_0016168 3300048925 Bacteria 7086
440 Ga0496122_0017792 3300048925 Bacteria 6610
441 Ga0496122_0030204 3300048925 Bacteria 4549
442 Ga0496122_0031324 3300048925 Bacteria 4429
443 Ga0496122_0037458 3300048925 Bacteria 3903
444 Ga0496122_0037962 3300048925 Bacteria 3867
445 Ga0496122_0048896 3300048925 Bacteria 3247
446 Ga0496123_0001273 3300048926 Bacteria 36130
447 Ga0496123_0007309 3300048926 Bacteria 10471
448 Ga0496123_0017919 3300048926 Bacteria 5669
449 Ga0496123_0026440 3300048926 Bacteria 4346
450 Ga0496124_0018466 3300048927 Bacteria 6529
451 Ga0496124_0020362 3300048927 Bacteria 6133
452 Ga0496124_0031055 3300048927 Bacteria 4732
453 Ga0496124_0271332 3300048927 Bacteria 1242
454 Ga0496125_0007334 3300048928 Bacteria 11742
455 Ga0496125_0015030 3300048928 Bacteria 7517
456 Ga0496125_0110981 3300048928 Bacteria 1986
457 Ga0496126_0021335 3300048929 Bacteria 6326
458 Ga0496126_0130562 3300048929 Bacteria 2171
459 Ga0495678_000001 3300049459 Bacteria 1060340
460 Ga0495678_000149 3300049459 Bacteria 84717
461 Ga0495678_000297 3300049459 Bacteria 54532
462 Ga0495678_003375 3300049459 Bacteria 9937
463 Ga0495678_003562 3300049459 Bacteria 9543
464 Ga0495678_007024 3300049459 Bacteria 5901
465 Ga0495682_0000013 3300049460 Bacteria 259670
466 Ga0495682_0000016 3300049460 Bacteria 233668
467 Ga0495682_0004213 3300049460 Bacteria 6222
468 Ga0495682_0004216 3300049460 Bacteria 6218
469 Ga0501032_0086844 3300049569 Bacteria 2078
470 Ga0501034_0117427 3300049571 Bacteria 2648
471 Ga0501036_0076671 3300049572 Bacteria 2828
472 Ga0501037_0080904 3300049573 Bacteria 2356
473 Ga0501043_0012696 3300049579 Bacteria 6588
474 Ga0501047_0173272 3300049581 Bacteria 2026
475 Ga0501073_0061685 3300049589 Bacteria 2616
476 Ga0501080_0049516 3300049742 Bacteria 3911
477 Ga0501083_0090339 3300049744 Bacteria 2023
478 Ga0501269_000353 3300049766 Bacteria 11518
479 nmdc:mga07m45_94237_c1 3300050496 Bacteria 1717
480 nmdc:mga0sz30_23305_c1 3300050516 Bacteria 2517
481 Ga0500569_023506 3300053109 Bacteria 1657
482 Ga0500595_000960 3300053119 Bacteria 16254
483 Ga0500618_000103 3300053125 Bacteria 69422
484 Ga0500658_0000529 3300053134 Bacteria 16130
485 Ga0500658_0027527 3300053134 Bacteria 2199
486 Ga0500568_0002595 3300053139 Bacteria 10505
487 Ga0500586_000093 3300053145 Bacteria 15423
488 Ga0500586_000535 3300053145 Bacteria 7638
489 Ga0500616_0003835 3300053153 Bacteria 11123
490 Ga0500619_000510 3300053154 Bacteria 6732
491 Ga0500622_0000899 3300053156 Bacteria 25323
492 Ga0501082_0039279 3300060353 Bacteria 4083

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025299 Ga0209256_1007396 Ga0209256_10073963 290
2 3300015265 Ga0182005_1000005 Ga0182005_1000005170 312
3 3300046463 Ga0495653_0008446 Ga0495653_0008446_4773_5951 317
4 3300046529 Ga0495652_0003647 Ga0495652_0003647_5933_7111 317
5 3300046809 Ga0495600_0048506 Ga0495600_0048506_888_2066 317
6 3300053119 Ga0500595_000960 Ga0500595_000960_13042_14220 317
7 3300015261 Ga0182006_1000019 Ga0182006_100001943 321
8 3300046542 Ga0495597_0014350 Ga0495597_0014350_2233_3450 321
9 3300046664 Ga0495659_0000398 Ga0495659_0000398_12400_13617 321
10 3300046692 Ga0495671_0001329 Ga0495671_0001329_12840_14057 321
11 3300047320 Ga0495672_0000023 Ga0495672_0000023_974_2191 321
12 3300014497 Ga0182008_10005451 Ga0182008_100054512 327
13 3300015262 Ga0182007_10002852 Ga0182007_100028526 327
14 3300015261 Ga0182006_1008522 Ga0182006_10085222 328
15 3300015265 Ga0182005_1000238 Ga0182005_100023826 328
16 3300046680 Ga0495646_0081763 Ga0495646_0081763_571_1785 329
17 3300053154 Ga0500619_000510 Ga0500619_000510_4647_5861 329
18 3300027111 Ga0209281_1008839 Ga0209281_10088392 334
19 3300046460 Ga0495638_0013142 Ga0495638_0013142_1738_2937 336
20 3300046501 Ga0495607_0016919 Ga0495607_0016919_2077_3276 336
21 3300046538 Ga0495609_0000207 Ga0495609_0000207_13097_14296 336
22 3300046558 Ga0495633_0000535 Ga0495633_0000535_16804_18015 336
23 3300046660 Ga0495625_0002153 Ga0495625_0002153_15248_16447 336
24 3300046665 Ga0495661_0002960 Ga0495661_0002960_2377_3576 336
25 3300046684 Ga0495669_0000224 Ga0495669_0000224_21511_22710 336
26 3300046692 Ga0495671_0053799 Ga0495671_0053799_83_1282 336
27 3300046694 Ga0495649_0007163 Ga0495649_0007163_1890_3089 336
28 3300047443 Ga0495687_021336 Ga0495687_021336_1853_3052 336
29 3300047445 Ga0495677_0005292 Ga0495677_0005292_1617_2816 336
30 3300047446 Ga0495679_003595 Ga0495679_003595_4330_5529 336
31 3300031548 Ga0307408_100035811 Ga0307408_1000358111 337
32 3300046501 Ga0495607_0002600 Ga0495607_0002600_4608_5828 337
33 3300046507 Ga0495606_0004118 Ga0495606_0004118_5085_6305 337
34 3300046558 Ga0495633_0017351 Ga0495633_0017351_1936_3153 337
35 3300046460 Ga0495638_0011865 Ga0495638_0011865_1009_2211 338
36 3300046501 Ga0495607_0002318 Ga0495607_0002318_13807_15009 338
37 3300046512 Ga0495610_0001490 Ga0495610_0001490_9384_10595 338
38 3300046513 Ga0495616_0005272 Ga0495616_0005272_683_1885 338
39 3300046522 Ga0495643_0000471 Ga0495643_0000471_18184_19395 338
40 3300046524 Ga0495648_0004553 Ga0495648_0004553_8975_10186 338
41 3300046616 Ga0495668_0016872 Ga0495668_0016872_2125_3327 338
42 3300046660 Ga0495625_0005455 Ga0495625_0005455_1011_2213 338
43 3300046664 Ga0495659_0003193 Ga0495659_0003193_1620_2822 338
44 3300046665 Ga0495661_0016467 Ga0495661_0016467_1337_2539 338
45 3300046684 Ga0495669_0021410 Ga0495669_0021410_1011_2213 338
46 3300047320 Ga0495672_0000399 Ga0495672_0000399_18184_19395 338
47 3300047443 Ga0495687_004099 Ga0495687_004099_4393_5595 338
48 3300047445 Ga0495677_0004812 Ga0495677_0004812_1126_2328 338
49 3300047445 Ga0495677_0022924 Ga0495677_0022924_829_2040 338
50 3300047446 Ga0495679_018385 Ga0495679_018385_213_1415 338
51 3300047447 Ga0495685_011249 Ga0495685_011249_1770_2972 338
52 3300047470 Ga0495681_0004313 Ga0495681_0004313_7607_8809 338
53 3300049459 Ga0495678_000297 Ga0495678_000297_46447_47658 338
54 3300003791 Ga0055530_10000057 Ga0055530_1000005747 339
55 3300006948 Ga0099826_10000002 Ga0099826_10000002242 339
56 3300021361 Ga0213872_10000040 Ga0213872_100000408 339
57 3300025298 Ga0209050_1000304 Ga0209050_100030433 339
58 3300027666 Ga0209282_1000001 Ga0209282_1000001905 339
59 3300039447 Ga0436361_0993359 Ga0436361_0993359_26543_27760 339
60 3300047323 Ga0495683_0009295 Ga0495683_0009295_578_1801 341
61 3300049459 Ga0495678_003562 Ga0495678_003562_26_1210 342
62 3300037312 Ga0395899_0001133 Ga0395899_0001133_8096_9325 343
63 3300037418 Ga0395900_0007781 Ga0395900_0007781_6586_7815 343
64 3300037471 Ga0395905_0020053 Ga0395905_0020053_1634_2863 343
65 3300046523 Ga0495644_0022630 Ga0495644_0022630_1185_2369 343
66 3300031838 Ga0307518_10010757 Ga0307518_100107572 344
67 3300046492 Ga0495585_0020995 Ga0495585_0020995_14_1225 344
68 3300046542 Ga0495597_0000648 Ga0495597_0000648_6881_8092 344
69 3300046558 Ga0495633_0002795 Ga0495633_0002795_1278_2489 344
70 3300046471 Ga0495650_0003117 Ga0495650_0003117_5736_7010 345
71 3300046474 Ga0495605_0000267 Ga0495605_0000267_3291_4475 345
72 3300046520 Ga0495637_0000240 Ga0495637_0000240_11438_12712 345
73 3300046530 Ga0495654_0000131 Ga0495654_0000131_16310_17584 345
74 3300046660 Ga0495625_0058504 Ga0495625_0058504_935_2209 345
75 3300031548 Ga0307408_100000022 Ga0307408_100000022133 346
76 3300046507 Ga0495606_0000757 Ga0495606_0000757_20176_21381 346
77 3300048905 Ga0496102_0105349 Ga0496102_0105349_115_1341 348
78 3300046507 Ga0495606_0002897 Ga0495606_0002897_11744_12958 349
79 3300047472 Ga0495686_0001620 Ga0495686_0001620_16983_18182 349
80 3300048921 Ga0496118_0006625 Ga0496118_0006625_2104_3237 349
81 3300002739 JGI25158J39367_1000221 JGI25158J39367_10002215 350
82 3300003374 JGI25161J50226_1000162 JGI25161J50226_100016233 350
83 3300003771 Ga0055526_1000163 Ga0055526_100016336 350
84 3300004625 Ga0055543_1000111 Ga0055543_10001115 350
85 3300005262 Ga0065165_1000351 Ga0065165_100035149 350
86 3300025208 Ga0209436_100005 Ga0209436_10000538 350
87 3300025284 Ga0209130_1000055 Ga0209130_100005588 350
88 3300048919 Ga0496116_0033083 Ga0496116_0033083_2382_3515 350
89 3300004625 Ga0055543_1003432 Ga0055543_10034323 351
90 3300005262 Ga0065165_1000364 Ga0065165_100036422 351
91 3300025284 Ga0209130_1000240 Ga0209130_100024035 351
92 3300025295 Ga0209564_1007537 Ga0209564_10075372 351
93 3300046471 Ga0495650_0001126 Ga0495650_0001126_11990_13192 351
94 3300046522 Ga0495643_0000153 Ga0495643_0000153_28203_29390 351
95 3300046542 Ga0495597_0000043 Ga0495597_0000043_79373_80560 351
96 3300046616 Ga0495668_0000063 Ga0495668_0000063_145744_146943 351
97 3300046660 Ga0495625_0001523 Ga0495625_0001523_9778_10980 351
98 3300003771 Ga0055526_1000269 Ga0055526_100026921 352
99 3300009036 Ga0105244_10000853 Ga0105244_100008535 352
100 3300025263 Ga0209565_1006293 Ga0209565_10062933 352
101 3300025291 Ga0209675_1000634 Ga0209675_100063414 352
102 3300025295 Ga0209564_1000124 Ga0209564_100012446 352
103 3300025299 Ga0209256_1000778 Ga0209256_10007783 352
104 3300025728 Ga0207655_1006700 Ga0207655_10067004 352
105 3300046507 Ga0495606_0001004 Ga0495606_0001004_12674_13885 352
106 3300046665 Ga0495661_0083396 Ga0495661_0083396_265_1482 352
107 3300003771 Ga0055526_1000326 Ga0055526_100032616 353
108 3300003773 Ga0055537_1000120 Ga0055537_100012031 353
109 3300003784 Ga0055534_1000170 Ga0055534_100017024 353
110 3300003790 Ga0055528_1000379 Ga0055528_100037924 353
111 3300005262 Ga0065165_1017006 Ga0065165_10170062 353
112 3300025245 Ga0207425_1001990 Ga0207425_10019902 353
113 3300025263 Ga0209565_1000009 Ga0209565_1000009324 353
114 3300025273 Ga0209673_1000019 Ga0209673_100001958 353
115 3300025291 Ga0209675_1000013 Ga0209675_1000013358 353
116 3300025294 Ga0209025_1001479 Ga0209025_100147912 353
117 3300025295 Ga0209564_1000240 Ga0209564_10002406 353
118 3300025297 Ga0209758_1003320 Ga0209758_10033202 353
119 3300025299 Ga0209256_1000052 Ga0209256_1000052158 353
120 3300030744 Ga0316181_1068628 Ga0316181_10686283 353
121 3300046452 Ga0495617_000223 Ga0495617_000223_5887_7098 353
122 3300046471 Ga0495650_0000317 Ga0495650_0000317_62877_64091 353
123 3300046520 Ga0495637_0000634 Ga0495637_0000634_16057_17268 353
124 3300046616 Ga0495668_0000209 Ga0495668_0000209_72236_73456 353
125 3300046810 Ga0495660_0001583 Ga0495660_0001583_9037_10269 353
126 3300047443 Ga0495687_004228 Ga0495687_004228_5687_6907 353
127 3300025295 Ga0209564_1012645 Ga0209564_10126453 354
128 3300025299 Ga0209256_1016254 Ga0209256_10162543 354
129 3300037471 Ga0395905_0001288 Ga0395905_0001288_6745_7962 354
130 3300046460 Ga0495638_0000064 Ga0495638_0000064_160702_161922 354
131 3300046471 Ga0495650_0001529 Ga0495650_0001529_5126_6346 354
132 3300046506 Ga0495583_0000287 Ga0495583_0000287_5085_6305 354
133 3300046522 Ga0495643_0000108 Ga0495643_0000108_18849_20069 354
134 3300046524 Ga0495648_0000006 Ga0495648_0000006_341139_342359 354
135 3300046528 Ga0495642_0000740 Ga0495642_0000740_482_1702 354
136 3300046542 Ga0495597_0001867 Ga0495597_0001867_9230_10450 354
137 3300046557 Ga0495622_0000208 Ga0495622_0000208_18919_20139 354
138 3300046558 Ga0495633_0000469 Ga0495633_0000469_21226_22446 354
139 3300046660 Ga0495625_0000780 Ga0495625_0000780_27256_28476 354
140 3300046660 Ga0495625_0010304 Ga0495625_0010304_6384_7595 354
141 3300047469 Ga0495673_0000008 Ga0495673_0000008_16535_17743 354
142 3300047472 Ga0495686_0067393 Ga0495686_0067393_912_2138 354
143 3300049766 Ga0501269_000353 Ga0501269_000353_3252_4463 354
144 3300046501 Ga0495607_0000295 Ga0495607_0000295_44436_45623 355
145 3300046512 Ga0495610_0011927 Ga0495610_0011927_1585_2733 355
146 3300046512 Ga0495610_0036071 Ga0495610_0036071_436_1653 355
147 3300003773 Ga0055537_1000122 Ga0055537_100012239 356
148 3300003784 Ga0055534_1000261 Ga0055534_10002612 356
149 3300003790 Ga0055528_1000042 Ga0055528_100004239 356
150 3300025263 Ga0209565_1000018 Ga0209565_1000018213 356
151 3300025273 Ga0209673_1000006 Ga0209673_1000006559 356
152 3300025291 Ga0209675_1000005 Ga0209675_1000005213 356
153 3300025295 Ga0209564_1000078 Ga0209564_100007851 356
154 3300025299 Ga0209256_1000070 Ga0209256_100007072 356
155 3300046452 Ga0495617_000979 Ga0495617_000979_85_1302 356
156 3300046453 Ga0495627_000004 Ga0495627_000004_623601_624830 356
157 3300046491 Ga0495584_0002580 Ga0495584_0002580_1147_2364 356
158 3300046492 Ga0495585_0003835 Ga0495585_0003835_8767_9984 356
159 3300046501 Ga0495607_0065930 Ga0495607_0065930_738_1955 356
160 3300046506 Ga0495583_0000108 Ga0495583_0000108_80011_81228 356
161 3300046523 Ga0495644_0000399 Ga0495644_0000399_18199_19416 356
162 3300046524 Ga0495648_0003425 Ga0495648_0003425_11164_12381 356
163 3300046538 Ga0495609_0000876 Ga0495609_0000876_13037_14254 356
164 3300046538 Ga0495609_0000944 Ga0495609_0000944_15156_16385 356
165 3300046557 Ga0495622_0049391 Ga0495622_0049391_401_1618 356
166 3300046648 Ga0495611_0002677 Ga0495611_0002677_5220_6437 356
167 3300046648 Ga0495611_0013478 Ga0495611_0013478_635_1852 356
168 3300046664 Ga0495659_0002842 Ga0495659_0002842_3642_4859 356
169 3300046691 Ga0495670_0018740 Ga0495670_0018740_962_2179 356
170 3300046794 Ga0495589_0059732 Ga0495589_0059732_260_1477 356
171 3300046810 Ga0495660_0002052 Ga0495660_0002052_4946_6175 356
172 3300047318 Ga0495636_0000858 Ga0495636_0000858_1132_2349 356
173 3300047320 Ga0495672_0033209 Ga0495672_0033209_1295_2512 356
174 3300047445 Ga0495677_0001797 Ga0495677_0001797_3734_4951 356
175 3300047445 Ga0495677_0020255 Ga0495677_0020255_232_1449 356
176 3300047447 Ga0495685_000168 Ga0495685_000168_5635_6852 356
177 3300048927 Ga0496124_0018466 Ga0496124_0018466_4747_5982 356
178 3300049459 Ga0495678_000149 Ga0495678_000149_68303_69538 356
179 3300049459 Ga0495678_003375 Ga0495678_003375_7426_8643 356
180 3300049460 Ga0495682_0000016 Ga0495682_0000016_12458_13675 356
181 3300046558 Ga0495633_0012668 Ga0495633_0012668_1544_2755 357
182 3300046660 Ga0495625_0035514 Ga0495625_0035514_1659_2864 357
183 3300046691 Ga0495670_0042648 Ga0495670_0042648_187_1392 357
184 3300047470 Ga0495681_0006959 Ga0495681_0006959_2827_4062 357
185 3300053145 Ga0500586_000535 Ga0500586_000535_1052_2263 357
186 3300027111 Ga0209281_1011402 Ga0209281_10114022 358
187 3300041496 Ga0451839_0067884 Ga0451839_0067884_106_1302 358
188 3300046471 Ga0495650_0000328 Ga0495650_0000328_20636_21853 358
189 3300046500 Ga0495596_0007147 Ga0495596_0007147_599_1816 358
190 3300046507 Ga0495606_0000897 Ga0495606_0000897_99_1301 358
191 3300046507 Ga0495606_0039895 Ga0495606_0039895_583_1794 358
192 3300046524 Ga0495648_0012448 Ga0495648_0012448_2863_4080 358
193 3300046557 Ga0495622_0000061 Ga0495622_0000061_62874_64025 358
194 3300046794 Ga0495589_0003437 Ga0495589_0003437_4481_5698 358
195 3300047320 Ga0495672_0003147 Ga0495672_0003147_8539_9756 358
196 3300049459 Ga0495678_000001 Ga0495678_000001_286127_287287 358
197 3300003374 JGI25161J50226_1000840 JGI25161J50226_100084010 359
198 3300003771 Ga0055526_1003173 Ga0055526_10031734 359
199 3300003773 Ga0055537_1004192 Ga0055537_10041922 359
200 3300006946 Ga0079104_1006300 Ga0079104_10063001 359
201 3300015265 Ga0182005_1000006 Ga0182005_1000006442 359
202 3300048922 Ga0496119_0019374 Ga0496119_0019374_264_1514 359
203 3300048923 Ga0496120_0005731 Ga0496120_0005731_2257_3507 359
204 3300046457 Ga0495590_0000014 Ga0495590_0000014_238242_239462 360
205 3300046460 Ga0495638_0029176 Ga0495638_0029176_1669_2874 360
206 3300046538 Ga0495609_0000464 Ga0495609_0000464_24886_26103 360
207 3300003775 Ga0055524_1000049 Ga0055524_100004913 361
208 3300006948 Ga0099826_10000005 Ga0099826_10000005323 361
209 3300025299 Ga0209256_1000040 Ga0209256_1000040320 361
210 3300027666 Ga0209282_1000003 Ga0209282_1000003478 361
211 3300046538 Ga0495609_0009785 Ga0495609_0009785_1788_3005 361
212 3300046558 Ga0495633_0000132 Ga0495633_0000132_41558_42772 361
213 3300046558 Ga0495633_0000693 Ga0495633_0000693_7821_9038 361
214 3300049460 Ga0495682_0000013 Ga0495682_0000013_185847_187064 361
215 3300015261 Ga0182006_1000102 Ga0182006_100010275 362
216 3300041441 Ga0451787_341380 Ga0451787_341380_516_1724 362
217 3300041498 Ga0451841_0994005 Ga0451841_0994005_645_1853 362
218 3300041512 Ga0451853_2236988 Ga0451853_2236988_185_1393 362
219 3300046460 Ga0495638_0119192 Ga0495638_0119192_17_1225 362
220 3300046492 Ga0495585_0051231 Ga0495585_0051231_974_2182 362
221 3300046524 Ga0495648_0015110 Ga0495648_0015110_642_1850 362
222 3300046558 Ga0495633_0084719 Ga0495633_0084719_114_1322 362
223 3300003775 Ga0055524_1000010 Ga0055524_1000010179 363
224 3300025299 Ga0209256_1000007 Ga0209256_1000007557 363
225 3300046694 Ga0495649_0039513 Ga0495649_0039513_893_2107 363
226 3300002739 JGI25158J39367_1000877 JGI25158J39367_10008773 364
227 3300003322 rootL2_10042496 rootL2_100424962 364
228 3300003763 Ga0055529_1000097 Ga0055529_1000097112 364
229 3300025246 Ga0209646_1000049 Ga0209646_1000049105 364
230 3300025272 Ga0209455_1000031 Ga0209455_1000031476 364
231 3300031548 Ga0307408_100019273 Ga0307408_1000192733 364
232 3300046491 Ga0495584_0000683 Ga0495584_0000683_15684_16886 364
233 3300046513 Ga0495616_0002237 Ga0495616_0002237_7550_8752 364
234 3300046558 Ga0495633_0005638 Ga0495633_0005638_86_1288 364
235 3300046691 Ga0495670_0010900 Ga0495670_0010900_247_1449 364
236 3300038443 Ga0395901_0032091 Ga0395901_0032091_1661_2953 365
237 3300046452 Ga0495617_010003 Ga0495617_010003_665_1876 366
238 3300046501 Ga0495607_0064155 Ga0495607_0064155_311_1528 366
239 3300046506 Ga0495583_0000014 Ga0495583_0000014_54637_55848 366
240 3300046513 Ga0495616_0005336 Ga0495616_0005336_5482_6699 366
241 3300046523 Ga0495644_0000244 Ga0495644_0000244_7173_8384 366
242 3300046524 Ga0495648_0001600 Ga0495648_0001600_2915_4126 366
243 3300046538 Ga0495609_0005406 Ga0495609_0005406_2970_4181 366
244 3300046557 Ga0495622_0000155 Ga0495622_0000155_55164_56387 366
245 3300046615 Ga0495656_0013284 Ga0495656_0013284_880_2091 366
246 3300046648 Ga0495611_0007893 Ga0495611_0007893_1813_3024 366
247 3300046660 Ga0495625_0074345 Ga0495625_0074345_147_1358 366
248 3300046691 Ga0495670_0000177 Ga0495670_0000177_659_1876 366
249 3300046691 Ga0495670_0000447 Ga0495670_0000447_17285_18496 366
250 3300046692 Ga0495671_0028514 Ga0495671_0028514_1191_2402 366
251 3300047318 Ga0495636_0010416 Ga0495636_0010416_1211_2422 366
252 3300047320 Ga0495672_0028406 Ga0495672_0028406_2273_3484 366
253 3300047323 Ga0495683_0021122 Ga0495683_0021122_1660_2871 366
254 3300047443 Ga0495687_000904 Ga0495687_000904_19606_20817 366
255 3300047447 Ga0495685_000020 Ga0495685_000020_38598_39809 366
256 3300047469 Ga0495673_0008065 Ga0495673_0008065_3365_4576 366
257 3300048906 Ga0496103_0006047 Ga0496103_0006047_4895_6106 366
258 3300049459 Ga0495678_007024 Ga0495678_007024_3843_5054 366
259 3300049460 Ga0495682_0004216 Ga0495682_0004216_2148_3359 366
260 3300025297 Ga0209758_1011348 Ga0209758_10113484 367
261 3300041491 Ga0451833_1382245 Ga0451833_1382245_826_2034 367
262 3300041503 Ga0451847_0315990 Ga0451847_0315990_645_1853 367
263 3300046501 Ga0495607_0101034 Ga0495607_0101034_159_1367 367
264 3300046507 Ga0495606_0004694 Ga0495606_0004694_3238_4446 367
265 3300046512 Ga0495610_0026583 Ga0495610_0026583_360_1568 367
266 3300046518 Ga0495631_0018007 Ga0495631_0018007_1242_2450 367
267 3300046522 Ga0495643_0103953 Ga0495643_0103953_226_1404 367
268 3300046523 Ga0495644_0053451 Ga0495644_0053451_199_1407 367
269 3300046660 Ga0495625_0113987 Ga0495625_0113987_293_1501 367
270 3300047472 Ga0495686_0048047 Ga0495686_0048047_21_1247 367
271 3300053109 Ga0500569_023506 Ga0500569_023506_291_1499 367
272 3300053125 Ga0500618_000103 Ga0500618_000103_55407_56621 367
273 3300053134 Ga0500658_0000529 Ga0500658_0000529_7019_8227 367
274 3300053153 Ga0500616_0003835 Ga0500616_0003835_7219_8427 367
275 3300046616 Ga0495668_0000046 Ga0495668_0000046_163192_164391 369
276 3300003771 Ga0055526_1000125 Ga0055526_100012548 370
277 3300003794 Ga0055531_10015789 Ga0055531_100157894 370
278 3300009036 Ga0105244_10001794 Ga0105244_1000179419 370
279 3300025295 Ga0209564_1000464 Ga0209564_100046426 370
280 3300025728 Ga0207655_1040622 Ga0207655_10406222 370
281 3300041413 Ga0439465_0001522 Ga0439465_0001522_2000_3151 370
282 3300046471 Ga0495650_0000368 Ga0495650_0000368_27754_28926 370
283 3300046471 Ga0495650_0000918 Ga0495650_0000918_28099_29298 370
284 3300046474 Ga0495605_0000906 Ga0495605_0000906_3077_4303 370
285 3300046507 Ga0495606_0001694 Ga0495606_0001694_9851_11062 370
286 3300046522 Ga0495643_0003818 Ga0495643_0003818_558_1772 370
287 3300046616 Ga0495668_0001057 Ga0495668_0001057_27932_29104 370
288 3300046794 Ga0495589_0011802 Ga0495589_0011802_1485_2699 370
289 3300046810 Ga0495660_0000057 Ga0495660_0000057_8640_9854 370
290 3300047443 Ga0495687_000740 Ga0495687_000740_13685_14899 370
291 3300047445 Ga0495677_0001180 Ga0495677_0001180_440_1654 370
292 3300048091 Ga0495626_0000017 Ga0495626_0000017_99395_100627 370
293 3300048091 Ga0495626_0002878 Ga0495626_0002878_1384_2598 370
294 3300048927 Ga0496124_0271332 Ga0496124_0271332_40_1212 370
295 3300048929 Ga0496126_0130562 Ga0496126_0130562_994_2148 370
296 3300028794 Ga0307515_10035804 Ga0307515_100358043 372
297 3300048925 Ga0496122_0048896 Ga0496122_0048896_1111_2343 372
298 3300003791 Ga0055530_10006222 Ga0055530_100062223 373
299 3300025298 Ga0209050_1000360 Ga0209050_100036041 373
300 3300031548 Ga0307408_100003823 Ga0307408_1000038238 373
301 3300046492 Ga0495585_0007906 Ga0495585_0007906_1912_3129 373
302 3300046542 Ga0495597_0020464 Ga0495597_0020464_776_1993 373
303 3300046648 Ga0495611_0001871 Ga0495611_0001871_7543_8760 373
304 3300047470 Ga0495681_0017431 Ga0495681_0017431_2267_3484 373
305 3300048925 Ga0496122_0030204 Ga0496122_0030204_681_1859 373
306 3300048926 Ga0496123_0001273 Ga0496123_0001273_7369_8547 373
307 3300049460 Ga0495682_0004213 Ga0495682_0004213_3828_5045 373
308 3300002774 JGI25150J39212_1009032 JGI25150J39212_10090322 374
309 3300002987 JGI25159J45721_1006700 JGI25159J45721_10067004 374
310 3300003771 Ga0055526_1000030 Ga0055526_1000030114 374
311 3300003784 Ga0055534_1004648 Ga0055534_10046483 374
312 3300003790 Ga0055528_1013285 Ga0055528_10132853 374
313 3300003791 Ga0055530_10009376 Ga0055530_100093762 374
314 3300003794 Ga0055531_10027074 Ga0055531_100270741 374
315 3300004625 Ga0055543_1002795 Ga0055543_10027952 374
316 3300005262 Ga0065165_1000003 Ga0065165_1000003176 374
317 3300025284 Ga0209130_1000036 Ga0209130_1000036157 374
318 3300025291 Ga0209675_1014380 Ga0209675_10143803 374
319 3300025295 Ga0209564_1000010 Ga0209564_100001023 374
320 3300025295 Ga0209564_1022454 Ga0209564_10224542 374
321 3300025299 Ga0209256_1003086 Ga0209256_10030864 374
322 3300025299 Ga0209256_1003337 Ga0209256_10033374 374
323 3300025304 Ga0209257_1018341 Ga0209257_10183411 374
324 3300047472 Ga0495686_0000830 Ga0495686_0000830_31254_32462 374
325 3300046506 Ga0495583_0001630 Ga0495583_0001630_11480_12688 375
326 3300046660 Ga0495625_0117376 Ga0495625_0117376_440_1648 375
327 3300048908 Ga0496105_0159422 Ga0496105_0159422_636_1808 375
328 3300048929 Ga0496126_0021335 Ga0496126_0021335_4364_5569 375
329 iso_pu_bacteria 2671180139 2671692584 375
330 3300025298 Ga0209050_1001621 Ga0209050_100162114 376
331 3300025304 Ga0209257_1001683 Ga0209257_100168314 376
332 3300047469 Ga0495673_0000185 Ga0495673_0000185_24708_25916 376
333 iso_pu_bacteria 2738541280 2738737544 376
334 iso_pu_bacteria 2738541300 2738841736 376
335 iso_pu_bacteria 2738543018 2739272608 376
336 iso_pu_bacteria 2738543030 2739341652 376
337 3300025246 Ga0209646_1000247 Ga0209646_10002474 377
338 3300046528 Ga0495642_0000946 Ga0495642_0000946_10916_12139 377
339 iso_pu_bacteria 2643221554 2643786889 377
340 iso_pu_bacteria 2643221638 2644212638 377
341 iso_pu_bacteria 2857564685 2857569037 377
342 3300046522 Ga0495643_0017752 Ga0495643_0017752_1807_3027 378
343 3300046524 Ga0495648_0006664 Ga0495648_0006664_436_1656 378
344 iso_pu_bacteria 2738541297 2738826668 378
345 iso_pu_bacteria 2738541357 2739150465 378
346 iso_pu_bacteria 2738543003 2739192384 378
347 iso_pu_bacteria 2738543026 2739318861 378
348 iso_pu_bacteria 2738543029 2739337102 378
349 iso_pu_bacteria 2821131069 2821135385 378
350 iso_pu_bacteria 2857564685 2857567890 378
351 iso_pu_bacteria 2738541357 2739151154 379
352 iso_pu_bacteria 2738543003 2739193073 379
353 iso_pu_bacteria 2738543026 2739319550 379
354 iso_pu_bacteria 2738543029 2739337791 379
355 3300003322 rootL2_10094471 rootL2_100944713 380
356 3300025208 Ga0209436_100524 Ga0209436_1005248 380
357 3300025245 Ga0207425_1000085 Ga0207425_100008562 380
358 3300025258 Ga0209129_1000656 Ga0209129_100065612 380
359 3300025263 Ga0209565_1001544 Ga0209565_10015443 380
360 3300025284 Ga0209130_1001310 Ga0209130_100131010 380
361 3300025298 Ga0209050_1003737 Ga0209050_10037375 380
362 3300025302 Ga0207426_1001525 Ga0207426_100152519 380
363 3300031548 Ga0307408_100009899 Ga0307408_1000098993 380
364 3300045976 Ga0466967_0197284 Ga0466967_0197284_296_1516 380
365 3300046507 Ga0495606_0036949 Ga0495606_0036949_2078_3295 380
366 3300046674 Ga0495588_0000062 Ga0495588_0000062_234471_235688 380
367 3300047443 Ga0495687_000036 Ga0495687_000036_97684_98901 380
368 iso_pu_bacteria 2821131069 2821134715 380
369 iso_pu_bacteria 2842711865 2842715259 380
370 iso_pu_bacteria 2857553236 2857557935 380
371 iso_pu_bacteria 2857558681 2857564074 380
372 iso_pu_bacteria 2919476304 2919479551 380
373 3300046491 Ga0495584_0000026 Ga0495584_0000026_109972_111192 381
374 3300046501 Ga0495607_0022274 Ga0495607_0022274_1191_2381 381
375 3300046810 Ga0495660_0000791 Ga0495660_0000791_10189_11379 381
376 iso_pu_bacteria 2511231221 2512037795 381
377 iso_pu_bacteria 2818991436 2819541712 381
378 iso_pu_bacteria 2842711865 2842717441 381
379 iso_pu_bacteria 2857558681 2857562103 381
380 iso_pu_bacteria 2904424332 2904427850 381
381 3300003775 Ga0055524_1008650 Ga0055524_10086504 382
382 3300006353 Ga0075370_10012069 Ga0075370_100120695 382
383 3300046452 Ga0495617_000157 Ga0495617_000157_15868_17067 382
384 3300046507 Ga0495606_0002140 Ga0495606_0002140_20692_21906 382
385 3300046512 Ga0495610_0000027 Ga0495610_0000027_258162_259367 382
386 3300046524 Ga0495648_0005550 Ga0495648_0005550_9166_10371 382
387 3300046530 Ga0495654_0001470 Ga0495654_0001470_5712_6911 382
388 3300046558 Ga0495633_0004214 Ga0495633_0004214_1350_2549 382
389 3300046616 Ga0495668_0000911 Ga0495668_0000911_26158_27357 382
390 3300046665 Ga0495661_0018493 Ga0495661_0018493_1609_2808 382
391 3300046692 Ga0495671_0000106 Ga0495671_0000106_67260_68465 382
392 3300046810 Ga0495660_0009640 Ga0495660_0009640_4024_5223 382
393 3300047469 Ga0495673_0000009 Ga0495673_0000009_16075_17274 382
394 3300053145 Ga0500586_000093 Ga0500586_000093_10768_11967 382
395 iso_pu_bacteria 2643221664 2644360019 382
396 3300003322 rootL2_10021691 rootL2_100216911 383
397 3300003322 rootL2_10021692 rootL2_100216921 383
398 3300021361 Ga0213872_10000059 Ga0213872_1000005954 383
399 3300039447 Ga0436361_0173203 Ga0436361_0173203_13500_14684 383
400 3300046492 Ga0495585_0000352 Ga0495585_0000352_15279_16481 383
401 3300047323 Ga0495683_0002452 Ga0495683_0002452_4048_5250 383
402 iso_pu_bacteria 2643221556 2643798779 383
403 iso_pu_bacteria 2643221645 2644250113 383
404 iso_pu_bacteria 2643221684 2644471126 383
405 iso_pu_bacteria 2738541280 2738742847 383
406 iso_pu_bacteria 2738541300 2738846829 383
407 iso_pu_bacteria 2738543018 2739277717 383
408 iso_pu_bacteria 2738543030 2739346760 383
409 iso_pu_bacteria 8047673197 8047678335 383
410 3300046463 Ga0495653_0000056 Ga0495653_0000056_16836_18041 384
411 3300046507 Ga0495606_0000880 Ga0495606_0000880_27481_28686 384
412 3300048923 Ga0496120_0032669 Ga0496120_0032669_1522_2730 384
413 3300048924 Ga0496121_0018620 Ga0496121_0018620_1562_2767 384
414 3300048925 Ga0496122_0037458 Ga0496122_0037458_1168_2376 384
415 3300048926 Ga0496123_0017919 Ga0496123_0017919_1505_2713 384
416 iso_pu_bacteria 2600255292 2601667956 384
417 iso_pu_bacteria 2857547612 2857550007 384
418 iso_pu_bacteria 2932410948 2932411657 384
419 iso_pu_bacteria 2932416698 2932418776 384
420 3300003322 rootL2_10144624 rootL2_101446242 385
421 3300025233 Ga0209437_108305 Ga0209437_1083051 385
422 iso_pu_bacteria 2857553236 2857556383 386
423 3300025284 Ga0209130_1003245 Ga0209130_10032453 387
424 3300046507 Ga0495606_0006620 Ga0495606_0006620_2858_4057 387
425 3300046542 Ga0495597_0006327 Ga0495597_0006327_3510_4709 387
426 3300046660 Ga0495625_0004626 Ga0495625_0004626_1982_3181 387
427 3300046664 Ga0495659_0000043 Ga0495659_0000043_13328_14527 387
428 3300046692 Ga0495671_0000251 Ga0495671_0000251_36248_37447 387
429 3300047320 Ga0495672_0000161 Ga0495672_0000161_73471_74670 387
430 3300048906 Ga0496103_0003227 Ga0496103_0003227_189_1409 387
431 iso_pu_bacteria 2885080285 2885081642 387
432 iso_pu_bacteria 2919476304 2919476853 387
433 iso_pu_bacteria 8054002106 8054007057 387
434 3300002773 JGI25152J39213_1002299 JGI25152J39213_10022994 389
435 3300002774 JGI25150J39212_1000165 JGI25150J39212_100016516 389
436 3300003187 JGI25151J46595_10000329 JGI25151J46595_1000032930 389
437 3300003215 JGI25153J46596_10003106 JGI25153J46596_100031064 389
438 3300025245 Ga0207425_1000024 Ga0207425_1000024274 389
439 3300025258 Ga0209129_1000146 Ga0209129_100014670 389
440 3300025273 Ga0209673_1005401 Ga0209673_10054015 389
441 3300025294 Ga0209025_1000050 Ga0209025_100005053 389
442 3300025297 Ga0209758_1000083 Ga0209758_1000083204 389
443 3300031901 Ga0307406_10013649 Ga0307406_100136493 389
444 3300031911 Ga0307412_10013523 Ga0307412_100135234 389
445 3300046512 Ga0495610_0001253 Ga0495610_0001253_6994_8205 389
446 3300046515 Ga0495620_0033526 Ga0495620_0033526_19_1230 389
447 3300046522 Ga0495643_0027141 Ga0495643_0027141_747_1958 389
448 3300047469 Ga0495673_0066843 Ga0495673_0066843_104_1315 389
449 3300047472 Ga0495686_0016979 Ga0495686_0016979_301_1512 389
450 3300048919 Ga0496116_0002238 Ga0496116_0002238_2313_3524 389
451 3300048919 Ga0496116_0014414 Ga0496116_0014414_230_1513 389
452 3300048919 Ga0496116_0024138 Ga0496116_0024138_2314_3525 389
453 3300048920 Ga0496117_0006678 Ga0496117_0006678_4129_5340 389
454 3300048921 Ga0496118_0016280 Ga0496118_0016280_4752_6035 389
455 3300048924 Ga0496121_0018883 Ga0496121_0018883_570_1781 389
456 3300048924 Ga0496121_0022429 Ga0496121_0022429_570_1781 389
457 3300048925 Ga0496122_0016168 Ga0496122_0016168_5306_6517 389
458 3300048925 Ga0496122_0017792 Ga0496122_0017792_2885_4168 389
459 3300048925 Ga0496122_0031324 Ga0496122_0031324_2649_3860 389
460 3300048926 Ga0496123_0007309 Ga0496123_0007309_4913_6124 389
461 3300048926 Ga0496123_0026440 Ga0496123_0026440_2684_3895 389
462 3300048927 Ga0496124_0020362 Ga0496124_0020362_638_1849 389
463 3300048927 Ga0496124_0031055 Ga0496124_0031055_2935_4218 389
464 3300048928 Ga0496125_0007334 Ga0496125_0007334_2660_3871 389
465 iso_pu_bacteria 2509276021 2509392155 390
466 iso_pu_bacteria 2509276033 2509445798 390
467 iso_pu_bacteria 2509276033 2509446900 390
468 iso_pu_bacteria 2510065019 2510133854 390
469 iso_pu_bacteria 2510461076 2510895274 390
470 iso_pu_bacteria 2513237084 2513573671 390
471 iso_pu_bacteria 2513237085 2513576845 390
472 iso_pu_bacteria 2513237093 2513629500 390
473 iso_pu_bacteria 2513237103 2513708148 390
474 iso_pu_bacteria 2513237144 2513909202 390
475 iso_pu_bacteria 2513237146 2513925471 390
476 iso_pu_bacteria 2513237162 2514020107 390
477 iso_pu_bacteria 2515075009 2515112899 390
478 iso_pu_bacteria 2515154113 2515636423 390
479 iso_pu_bacteria 2515154114 2515640861 390
480 iso_pu_bacteria 2515154116 2515655455 390
481 iso_pu_bacteria 2515154134 2515739384 390
482 iso_pu_bacteria 2516653077 2517036601 390
483 iso_pu_bacteria 2516653085 2517076964 390
484 iso_pu_bacteria 2517093000 2517095732 390
485 iso_pu_bacteria 2517287029 2517407301 390
486 iso_pu_bacteria 2529292951 2530646054 390
487 iso_pu_bacteria 2534681796 2535516784 390
488 iso_pu_bacteria 2582581294 2585200521 390
489 iso_pu_bacteria 2582581298 2585222731 390
490 iso_pu_bacteria 2582581304 2585254998 390
491 iso_pu_bacteria 2585427526 2585527344 390
492 iso_pu_bacteria 2585427529 2585545314 390
493 iso_pu_bacteria 2585427590 2585822827 390
494 iso_pu_bacteria 2585427594 2585843083 390
495 iso_pu_bacteria 2599185170 2599417386 390
496 iso_pu_bacteria 2615840624 2616293455 390
497 iso_pu_bacteria 2718217882 2719181716 390
498 iso_pu_bacteria 2718217927 2719386238 390
499 iso_pu_bacteria 2718217997 2719666059 390
500 iso_pu_bacteria 2718218009 2719732380 390
501 iso_pu_bacteria 2718218199 2720492479 390
502 iso_pu_bacteria 2718218232 2720613917 390
503 iso_pu_bacteria 2718218233 2720620721 390
504 iso_pu_bacteria 2718218235 2720632044 390
505 iso_pu_bacteria 2718218269 2720775772 390
506 iso_pu_bacteria 2718218363 2721147807 390
507 iso_pu_bacteria 2718218365 2721159256 390
508 iso_pu_bacteria 2718218366 2721164643 390
509 iso_pu_bacteria 2718218423 2721400020 390
510 iso_pu_bacteria 2721755514 2722840813 390
511 iso_pu_bacteria 2721755556 2723027379 390
512 iso_pu_bacteria 2721755684 2723560998 390
513 iso_pu_bacteria 2721755685 2723567591 390
514 iso_pu_bacteria 2721755809 2724038833 390
515 iso_pu_bacteria 2721755810 2724045136 390
516 iso_pu_bacteria 2721755819 2724090379 390
517 iso_pu_bacteria 2721755822 2724104856 390
518 iso_pu_bacteria 2721755823 2724110661 390
519 iso_pu_bacteria 2724679232 2725952660 390
520 iso_pu_bacteria 2728369352 2730108315 390
521 iso_pu_bacteria 2728369365 2730164951 390
522 iso_pu_bacteria 2728369397 2730298888 390
523 iso_pu_bacteria 2738541293 2738799994 390
524 iso_pu_bacteria 2738541333 2739032743 390
525 iso_pu_bacteria 2765235942 2766065767 390
526 iso_pu_bacteria 2791355256 2793294532 390
527 iso_pu_bacteria 2791355259 2793314634 390
528 iso_pu_bacteria 2791355260 2793320460 390
529 iso_pu_bacteria 2791355261 2793330536 390
530 iso_pu_bacteria 2791355262 2793336815 390
531 iso_pu_bacteria 2791355263 2793339106 390
532 iso_pu_bacteria 2791355264 2793348790 390
533 iso_pu_bacteria 2791355265 2793351928 390
534 iso_pu_bacteria 2791355266 2793363601 390
535 iso_pu_bacteria 2791355267 2793370273 390
536 iso_pu_bacteria 2802429605 2805931398 390
537 iso_pu_bacteria 2802429606 2805937405 390
538 iso_pu_bacteria 2802429633 2806043723 390
539 iso_pu_bacteria 2802429636 2806064544 390
540 iso_pu_bacteria 2802429637 2806071811 390
541 iso_pu_bacteria 2838016132 2838017750 390
542 iso_pu_bacteria 2838022645 2838028377 390
543 iso_pu_bacteria 2838035591 2838038410 390
544 iso_pu_bacteria 2838042994 2838043870 390
545 iso_pu_bacteria 2838048938 2838051958 390
546 iso_pu_bacteria 2838061910 2838067425 390
547 iso_pu_bacteria 2838068647 2838070243 390
548 iso_pu_bacteria 2838661181 2838661680 390
549 iso_pu_bacteria 2838668709 2838670263 390
550 iso_pu_bacteria 2838680041 2838681708 390
551 iso_pu_bacteria 2838686498 2838687155 390
552 iso_pu_bacteria 2838694306 2838696280 390
553 iso_pu_bacteria 2838701080 2838702634 390
554 iso_pu_bacteria 2838707686 2838710481 390
555 iso_pu_bacteria 2838729681 2838729873 390
556 iso_pu_bacteria 2838742623 2838743112 390
557 iso_pu_bacteria 2841851746 2841852598 390
558 iso_pu_bacteria 2841864319 2841869895 390
559 iso_pu_bacteria 2842077413 2842078655 390
560 iso_pu_bacteria 2842110456 2842114880 390
561 iso_pu_bacteria 2842118031 2842118836 390
562 iso_pu_bacteria 2842146304 2842148108 390
563 iso_pu_bacteria 2842156927 2842157942 390
564 iso_pu_bacteria 2842163707 2842167508 390
565 iso_pu_bacteria 2842180545 2842181561 390
566 iso_pu_bacteria 2842192696 2842198563 390
567 iso_pu_bacteria 2842198810 2842204492 390
568 iso_pu_bacteria 2842205361 2842205575 390
569 iso_pu_bacteria 2842217011 2842217832 390
570 iso_pu_bacteria 2842229732 2842230388 390
571 iso_pu_bacteria 2842237096 2842239893 390
572 iso_pu_bacteria 2842243621 2842244290 390
573 iso_pu_bacteria 2842250916 2842253174 390
574 iso_pu_bacteria 2842257432 2842257624 390
575 iso_pu_bacteria 2842264693 2842266167 390
576 iso_pu_bacteria 2842271015 2842271307 390
577 iso_pu_bacteria 2842278818 2842279032 390
578 iso_pu_bacteria 2842285085 2842285696 390
579 iso_pu_bacteria 2842291075 2842292317 390
580 iso_pu_bacteria 2842304105 2842304938 390
581 iso_pu_bacteria 2842311132 2842315010 390
582 iso_pu_bacteria 2842317721 2842320612 390
583 iso_pu_bacteria 2842341865 2842346359 390
584 iso_pu_bacteria 2842363717 2842369062 390
585 iso_pu_bacteria 2842370503 2842372275 390
586 iso_pu_bacteria 2842377471 2842378714 390
587 iso_pu_bacteria 2842384541 2842385346 390
588 iso_pu_bacteria 2842395702 2842399980 390
589 iso_pu_bacteria 2842402390 2842403055 390
590 iso_pu_bacteria 2842409023 2842409572 390
591 iso_pu_bacteria 2842415677 2842416224 390
592 iso_pu_bacteria 2842422224 2842423857 390
593 iso_pu_bacteria 2842428310 2842430630 390
594 iso_pu_bacteria 2842434925 2842437383 390
595 iso_pu_bacteria 2842441272 2842443753 390
596 iso_pu_bacteria 2842447887 2842453121 390
597 iso_pu_bacteria 2842462802 2842464773 390
598 iso_pu_bacteria 2842469257 2842472001 390
599 iso_pu_bacteria 2842495871 2842496924 390
600 iso_pu_bacteria 2844454524 2844458521 390
601 iso_pu_bacteria 2857516855 2857517538 390
602 iso_pu_bacteria 2919100787 2919106616 390
603 iso_pu_bacteria 2933016740 2933017490 390
604 iso_pu_bacteria 2933570622 2933570746 390
605 iso_pu_bacteria 2933586486 2933591252 390
606 iso_pu_bacteria 2933599457 2933601049 390
607 iso_pu_bacteria 2935894831 2935900714 390
608 iso_pu_bacteria 2935901341 2935902058 390
609 iso_pu_bacteria 2936367885 2936372144 390
610 iso_pu_bacteria 2936375103 2936381052 390
611 iso_pu_bacteria 2936381700 2936382991 390
612 iso_pu_bacteria 2996887358 2996889125 390
613 iso_pu_bacteria 2996893221 2996896453 390
614 iso_pu_bacteria 3005409236 3005414716 390
615 iso_pu_bacteria 3005445848 3005448341 390
616 iso_pu_bacteria 639633055 639649093 390
617 iso_pu_bacteria 8005258706 8005262278 390
618 iso_pu_bacteria 8005275841 8005281029 390
619 iso_pu_bacteria 8005282627 8005283359 390
620 iso_pu_bacteria 8005289223 8005293540 390
621 iso_pu_bacteria 8005301065 8005303024 390
622 iso_pu_bacteria 8005307578 8005312731 390
623 iso_pu_bacteria 8005321885 8005323652 390
624 iso_pu_bacteria 8005376324 8005380826 390
625 iso_pu_bacteria 8005382845 8005385304 390
626 iso_pu_bacteria 8005395548 8005396222 390
627 iso_pu_bacteria 8005430974 8005435055 390
628 iso_pu_bacteria 8005460587 8005463576 390
629 iso_pu_bacteria 8005542996 8005545510 390
630 iso_pu_bacteria 8005556819 8005557116 390
631 iso_pu_bacteria 8005563573 8005567888 390
632 iso_pu_bacteria 8005570704 8005573565 390
633 iso_pu_bacteria 8005619151 8005622170 390
634 iso_pu_bacteria 8005626139 8005632353 390
635 iso_pu_bacteria 8005658619 8005659122 390
636 iso_pu_bacteria 8005688590 8005692206 390
637 iso_pu_bacteria 8005695170 8005697299 390
638 iso_pu_bacteria 8018127388 8018133995 390
639 iso_pu_bacteria 8018163183 8018166195 390
640 iso_pu_bacteria 8018176218 8018181422 390
641 iso_pu_bacteria 8023680758 8023683270 390
642 iso_pu_bacteria 8024479707 8024482968 390
643 iso_pu_bacteria 8024501048 8024504260 390
644 iso_pu_bacteria 8056375014 8056378428 390
645 iso_pu_bacteria 8056382006 8056386626 390
646 iso_pu_bacteria 8057874678 8057877342 390
647 3300006038 Ga0075365_10003176 Ga0075365_100031766 393
648 3300006186 Ga0075369_10000132 Ga0075369_1000013218 393
649 3300009766 Ga0123342_1029639 Ga0123342_10296392 393
650 3300031731 Ga0307405_10009630 Ga0307405_100096304 393
651 3300002739 JGI25158J39367_1000129 JGI25158J39367_100012915 394
652 3300002773 JGI25152J39213_1002640 JGI25152J39213_10026404 394
653 3300002774 JGI25150J39212_1005368 JGI25150J39212_10053682 394
654 3300002774 JGI25150J39212_1011152 JGI25150J39212_10111522 394
655 3300002987 JGI25159J45721_1000914 JGI25159J45721_10009142 394
656 3300003187 JGI25151J46595_10001052 JGI25151J46595_1000105210 394
657 3300003187 JGI25151J46595_10027272 JGI25151J46595_100272723 394
658 3300003215 JGI25153J46596_10009303 JGI25153J46596_100093034 394
659 3300003374 JGI25161J50226_1000099 JGI25161J50226_100009910 394
660 3300003374 JGI25161J50226_1000140 JGI25161J50226_100014033 394
661 3300003771 Ga0055526_1000484 Ga0055526_100048425 394
662 3300003771 Ga0055526_1006325 Ga0055526_10063256 394
663 3300003775 Ga0055524_1003087 Ga0055524_10030873 394
664 3300003790 Ga0055528_1000774 Ga0055528_100077418 394
665 3300003792 Ga0055540_1000283 Ga0055540_100028324 394
666 3300003792 Ga0055540_1005136 Ga0055540_10051364 394
667 3300004625 Ga0055543_1000128 Ga0055543_100012830 394
668 3300005548 Ga0070665_100157423 Ga0070665_1001574231 394
669 3300006178 Ga0075367_10008091 Ga0075367_100080914 394
670 3300009766 Ga0123342_1042666 Ga0123342_10426662 394
671 3300025208 Ga0209436_100029 Ga0209436_10002973 394
672 3300025245 Ga0207425_1000633 Ga0207425_10006335 394
673 3300025258 Ga0209129_1000384 Ga0209129_100038418 394
674 3300025258 Ga0209129_1001961 Ga0209129_100196111 394
675 3300025258 Ga0209129_1002689 Ga0209129_10026895 394
676 3300025258 Ga0209129_1004653 Ga0209129_10046533 394
677 3300025273 Ga0209673_1000384 Ga0209673_100038461 394
678 3300025273 Ga0209673_1000977 Ga0209673_10009778 394
679 3300025273 Ga0209673_1002902 Ga0209673_10029026 394
680 3300025284 Ga0209130_1000020 Ga0209130_1000020351 394
681 3300025292 Ga0209676_1021853 Ga0209676_10218532 394
682 3300025294 Ga0209025_1000058 Ga0209025_1000058241 394
683 3300025295 Ga0209564_1000388 Ga0209564_100038861 394
684 3300025295 Ga0209564_1000512 Ga0209564_100051258 394
685 3300025295 Ga0209564_1001530 Ga0209564_100153027 394
686 3300025297 Ga0209758_1000960 Ga0209758_10009605 394
687 3300025297 Ga0209758_1001497 Ga0209758_10014974 394
688 3300025298 Ga0209050_1004042 Ga0209050_100404210 394
689 3300025299 Ga0209256_1000738 Ga0209256_100073836 394
690 3300025299 Ga0209256_1006190 Ga0209256_10061902 394
691 3300025302 Ga0207426_1000008 Ga0207426_1000008418 394
692 3300025303 Ga0209051_1000308 Ga0209051_100030843 394
693 3300025303 Ga0209051_1003270 Ga0209051_100327011 394
694 3300025304 Ga0209257_1000853 Ga0209257_100085340 394
695 3300025941 Ga0207711_10065806 Ga0207711_100658063 394
696 3300027866 Ga0209813_10021420 Ga0209813_100214202 394
697 3300048906 Ga0496103_0107024 Ga0496103_0107024_412_1641 394
698 3300048919 Ga0496116_0030817 Ga0496116_0030817_1987_3216 394
699 3300048920 Ga0496117_0021190 Ga0496117_0021190_426_1634 394
700 3300048921 Ga0496118_0033179 Ga0496118_0033179_1438_2646 394
701 3300048922 Ga0496119_0013948 Ga0496119_0013948_3024_4253 394
702 3300048924 Ga0496121_0024515 Ga0496121_0024515_717_1925 394
703 3300048925 Ga0496122_0037962 Ga0496122_0037962_1932_3140 394
704 3300048928 Ga0496125_0015030 Ga0496125_0015030_3860_5089 394
705 3300048928 Ga0496125_0110981 Ga0496125_0110981_598_1818 394
706 3300049569 Ga0501032_0086844 Ga0501032_0086844_314_1522 394
707 3300049571 Ga0501034_0117427 Ga0501034_0117427_1381_2589 394
708 3300049572 Ga0501036_0076671 Ga0501036_0076671_109_1317 394
709 3300049573 Ga0501037_0080904 Ga0501037_0080904_207_1475 394
710 3300049579 Ga0501043_0012696 Ga0501043_0012696_1606_2814 394
711 3300049581 Ga0501047_0173272 Ga0501047_0173272_494_1702 394
712 3300049589 Ga0501073_0061685 Ga0501073_0061685_1093_2301 394
713 3300049742 Ga0501080_0049516 Ga0501080_0049516_1413_2621 394
714 3300049744 Ga0501083_0090339 Ga0501083_0090339_47_1255 394
715 3300050496 nmdc:mga07m45_94237_c1 nmdc:mga07m45_94237_c1_330_1538 394
716 3300050516 nmdc:mga0sz30_23305_c1 nmdc:mga0sz30_23305_c1_759_1967 394
717 3300053134 Ga0500658_0027527 Ga0500658_0027527_657_1877 394
718 3300053139 Ga0500568_0002595 Ga0500568_0002595_3698_4918 394
719 3300053156 Ga0500622_0000899 Ga0500622_0000899_18282_19493 394
720 3300060353 Ga0501082_0039279 Ga0501082_0039279_564_1772 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

19

188

0.86

PF07690

MFS_1

Major Facilitator Superfamily

15

331

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8929 19 388
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.876 19 388
4zow-assembly1.cif.gz_A crystal structure of e. coli multidrug transporter mdfa in complex with chloramphenicol 0.8564 21 389
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8543 19 388
6oom-assembly2.cif.gz_A-2 protein a 0.8534 18 389
ID Description Score Start End Superfamily
af_P76628_9_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9469 17 388 1.20.1250.20
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9344 21 201 1.20.1250.20
af_P76628_9_385_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9322 17 388 1.20.1250.20
af_Q59WF2_48_242_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9214 19 197 1.20.1250.20
af_Q54LA4_481_867_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9174 16 388 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2E9XNC2-F1-model_v4 MFS transporter 0.9354 21 195 GO:0005886
GO:0046943
AF-A0A6N3RVD1-F1-model_v4 deleted 0.9136 19 203
AF-A0A5M9N164-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9106 19 389 GO:0016020
GO:0022857
AF-A0A7J6JC68-F1-model_v4 Efflux pump radE 0.8997 21 332 GO:0005886
GO:0022857
AF-A0A2V9RJV5-F1-model_v4 MFS transporter 0.8859 28 187 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
90.65 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map