F477256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 719 | 342 | 682 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300041512|Ga0451853_2813990|Ga0451853_2813990_989_1639 |
| Length | 216 |
| Sequence | MVTKVFLVDDHEIVRRGIADLLSDESDLVVVGEAASVTEALTMVPATGPDVAVLDIRLPDGNGIELCRELRSRLPDLRCLMLTSFTDDEALFDAIMAGASGFVLKQILGTDLVSAIRTVGEGGSLLDSRATAALMERIRASRNADPLAELSEQERAVFELIGEGMTNREIAERLFLAEKTVKNYVSRLLSKLGMQRRTQAAVLATELRKERGHDNT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 2 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 3 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 6 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 7 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 8 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 9 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 14 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 15 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 16 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 17 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 18 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 19 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 20 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 21 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 22 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 23 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 24 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 25 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 26 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 27 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 28 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 29 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 30 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 31 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 32 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 33 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 34 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 35 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 36 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 37 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 38 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 39 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 40 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 41 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 42 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 63 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 80 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 85 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 97 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 98 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 99 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 100 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 116 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 117 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 154 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 216 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 236 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 342 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.85 |
| Metatranscriptomes | 0 |
| Isolates | 5.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.82 |
| Nodule | 0.28 |
| Rhizoplane | 10.71 |
| Rhizosphere | 66.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1008506 | 3300001977 | Bacteria | 1545 |
| 2 | JGI24739J22299_10040638 | 3300001989 | Bacteria | 1551 |
| 3 | JGI24743J22301_10009379 | 3300001991 | Bacteria | 1733 |
| 4 | JGI24743J22301_10012875 | 3300001991 | Bacteria | 1527 |
| 5 | JGI24750J21931_1005879 | 3300002070 | Bacteria | 1515 |
| 6 | JGI24745J21846_1018384 | 3300002073 | Bacteria | 815 |
| 7 | JGI24748J21848_1004048 | 3300002074 | Bacteria | 1678 |
| 8 | JGI24738J21930_10013664 | 3300002075 | Bacteria | 1752 |
| 9 | JGI24744J21845_10005407 | 3300002077 | Bacteria | 2642 |
| 10 | JGI24744J21845_10015152 | 3300002077 | Bacteria | 1542 |
| 11 | JGI24034J26672_10001864 | 3300002239 | Bacteria | 2844 |
| 12 | JGI24742J22300_10002085 | 3300002244 | Bacteria | 3183 |
| 13 | JGI25406J46586_10004064 | 3300003203 | Bacteria | 6840 |
| 14 | Ga0055540_1000147 | 3300003792 | Bacteria | 70743 |
| 15 | Ga0055540_1000953 | 3300003792 | Bacteria | 18785 |
| 16 | Ga0055540_1004309 | 3300003792 | Bacteria | 6483 |
| 17 | Ga0065704_10206698 | 3300005289 | Bacteria | 1124 |
| 18 | Ga0070676_10010895 | 3300005328 | Bacteria | 4938 |
| 19 | Ga0070690_100001081 | 3300005330 | Bacteria | 13985 |
| 20 | Ga0070690_100063818 | 3300005330 | Bacteria | 2378 |
| 21 | Ga0068869_100028484 | 3300005334 | Bacteria | 3904 |
| 22 | Ga0070666_10032346 | 3300005335 | Bacteria | 3455 |
| 23 | Ga0070666_10053870 | 3300005335 | Bacteria | 2714 |
| 24 | Ga0070682_100006705 | 3300005337 | Bacteria | 6458 |
| 25 | Ga0070682_100128683 | 3300005337 | Bacteria | 1710 |
| 26 | Ga0068868_100002489 | 3300005338 | Bacteria | 12789 |
| 27 | Ga0068868_100068933 | 3300005338 | Bacteria | 2817 |
| 28 | Ga0068868_100288064 | 3300005338 | Bacteria | 1392 |
| 29 | Ga0070660_100109163 | 3300005339 | Bacteria | 2200 |
| 30 | Ga0070660_100673765 | 3300005339 | Bacteria | 867 |
| 31 | Ga0070689_100007750 | 3300005340 | Bacteria | 7524 |
| 32 | Ga0070691_10011741 | 3300005341 | Bacteria | 4006 |
| 33 | Ga0070691_10107500 | 3300005341 | Bacteria | 1392 |
| 34 | Ga0070687_100027796 | 3300005343 | Bacteria | 2737 |
| 35 | Ga0070692_10058134 | 3300005345 | Bacteria | 2030 |
| 36 | Ga0070692_10093407 | 3300005345 | Bacteria | 1638 |
| 37 | Ga0070668_100085784 | 3300005347 | Bacteria | 2475 |
| 38 | Ga0070668_100261860 | 3300005347 | Bacteria | 1438 |
| 39 | Ga0070668_100402416 | 3300005347 | Bacteria | 1169 |
| 40 | Ga0070668_100524146 | 3300005347 | Bacteria | 1028 |
| 41 | Ga0070668_100572743 | 3300005347 | Bacteria | 985 |
| 42 | Ga0070668_100770667 | 3300005347 | Bacteria | 853 |
| 43 | Ga0070669_100001478 | 3300005353 | Bacteria | 17002 |
| 44 | Ga0070669_100006033 | 3300005353 | Bacteria | 8743 |
| 45 | Ga0070675_100118923 | 3300005354 | Bacteria | 2244 |
| 46 | Ga0070671_100096936 | 3300005355 | Bacteria | 2473 |
| 47 | Ga0070671_100375338 | 3300005355 | Bacteria | 1215 |
| 48 | Ga0070674_100001375 | 3300005356 | Bacteria | 12855 |
| 49 | Ga0070674_100008790 | 3300005356 | Bacteria | 6027 |
| 50 | Ga0070674_100085854 | 3300005356 | Bacteria | 2259 |
| 51 | Ga0070673_100238018 | 3300005364 | Bacteria | 1581 |
| 52 | Ga0070688_100006802 | 3300005365 | Bacteria | 6135 |
| 53 | Ga0070688_100039010 | 3300005365 | Bacteria | 2905 |
| 54 | Ga0070659_100081095 | 3300005366 | Bacteria | 2591 |
| 55 | Ga0070659_100196580 | 3300005366 | Bacteria | 1659 |
| 56 | Ga0070659_100280646 | 3300005366 | Bacteria | 1386 |
| 57 | Ga0070667_100000042 | 3300005367 | Bacteria | 168902 |
| 58 | Ga0070667_100002142 | 3300005367 | Bacteria | 17375 |
| 59 | Ga0070667_100002534 | 3300005367 | Bacteria | 15909 |
| 60 | Ga0070667_100003309 | 3300005367 | Bacteria | 13771 |
| 61 | Ga0070667_100553478 | 3300005367 | Bacteria | 1057 |
| 62 | Ga0070703_10125383 | 3300005406 | Bacteria | 937 |
| 63 | Ga0070709_10030195 | 3300005434 | Bacteria | 3250 |
| 64 | Ga0070709_10030246 | 3300005434 | Bacteria | 3247 |
| 65 | Ga0070709_10032912 | 3300005434 | Bacteria | 3131 |
| 66 | Ga0070709_10039422 | 3300005434 | Bacteria | 2898 |
| 67 | Ga0070714_100005869 | 3300005435 | Bacteria | 9418 |
| 68 | Ga0070714_100370711 | 3300005435 | Bacteria | 1348 |
| 69 | Ga0070713_100041193 | 3300005436 | Bacteria | 3761 |
| 70 | Ga0070713_100679440 | 3300005436 | Bacteria | 982 |
| 71 | Ga0070713_100780554 | 3300005436 | Bacteria | 915 |
| 72 | Ga0070710_10001686 | 3300005437 | Bacteria | 10415 |
| 73 | Ga0070710_10090134 | 3300005437 | Bacteria | 1807 |
| 74 | Ga0070701_10036841 | 3300005438 | Bacteria | 2466 |
| 75 | Ga0070701_10054527 | 3300005438 | Bacteria | 2085 |
| 76 | Ga0070711_100000565 | 3300005439 | Bacteria | 19359 |
| 77 | Ga0070711_100067070 | 3300005439 | Bacteria | 2516 |
| 78 | Ga0070705_100005383 | 3300005440 | Bacteria | 6237 |
| 79 | Ga0070700_100001381 | 3300005441 | Bacteria | 12051 |
| 80 | Ga0070700_100075184 | 3300005441 | Bacteria | 2166 |
| 81 | Ga0070700_100083552 | 3300005441 | Bacteria | 2067 |
| 82 | Ga0070694_100007860 | 3300005444 | Bacteria | 6509 |
| 83 | Ga0070694_100227795 | 3300005444 | Bacteria | 1401 |
| 84 | Ga0070663_100003370 | 3300005455 | Bacteria | 9222 |
| 85 | Ga0070663_100072165 | 3300005455 | Bacteria | 2514 |
| 86 | Ga0070663_100529679 | 3300005455 | Bacteria | 982 |
| 87 | Ga0070678_100001483 | 3300005456 | Bacteria | 12531 |
| 88 | Ga0070678_100062648 | 3300005456 | Bacteria | 2747 |
| 89 | Ga0070678_100209014 | 3300005456 | Bacteria | 1616 |
| 90 | Ga0070678_100450981 | 3300005456 | Bacteria | 1127 |
| 91 | Ga0070678_100484260 | 3300005456 | Bacteria | 1089 |
| 92 | Ga0070678_100732809 | 3300005456 | Bacteria | 893 |
| 93 | Ga0070662_100004641 | 3300005457 | Bacteria | 8710 |
| 94 | Ga0070662_100218076 | 3300005457 | Bacteria | 1521 |
| 95 | Ga0070681_10382029 | 3300005458 | Bacteria | 1319 |
| 96 | Ga0068867_100002757 | 3300005459 | Bacteria | 12382 |
| 97 | Ga0068867_100197911 | 3300005459 | Bacteria | 1607 |
| 98 | Ga0068867_100215438 | 3300005459 | Bacteria | 1545 |
| 99 | Ga0070685_10016055 | 3300005466 | Bacteria | 3983 |
| 100 | Ga0070707_100003248 | 3300005468 | Bacteria | 15405 |
| 101 | Ga0070698_100726653 | 3300005471 | Bacteria | 936 |
| 102 | Ga0070684_100132819 | 3300005535 | Bacteria | 2246 |
| 103 | Ga0068853_100003295 | 3300005539 | Bacteria | 12353 |
| 104 | Ga0068853_100043268 | 3300005539 | Bacteria | 3853 |
| 105 | Ga0068853_100075480 | 3300005539 | Bacteria | 2942 |
| 106 | Ga0068853_100545944 | 3300005539 | Bacteria | 1097 |
| 107 | Ga0070672_100037774 | 3300005543 | Bacteria | 3686 |
| 108 | Ga0070672_100278060 | 3300005543 | Bacteria | 1415 |
| 109 | Ga0070686_100028611 | 3300005544 | Bacteria | 3381 |
| 110 | Ga0070686_100070263 | 3300005544 | Bacteria | 2289 |
| 111 | Ga0070695_100008811 | 3300005545 | Bacteria | 5996 |
| 112 | Ga0070695_100074807 | 3300005545 | Bacteria | 2226 |
| 113 | Ga0070696_100013731 | 3300005546 | Bacteria | 5439 |
| 114 | Ga0070696_100048363 | 3300005546 | Bacteria | 2952 |
| 115 | Ga0070696_100180921 | 3300005546 | Bacteria | 1564 |
| 116 | Ga0070693_100028129 | 3300005547 | Bacteria | 3054 |
| 117 | Ga0070665_100002665 | 3300005548 | Bacteria | 19411 |
| 118 | Ga0070665_100047438 | 3300005548 | Bacteria | 4311 |
| 119 | Ga0070665_100958046 | 3300005548 | Bacteria | 868 |
| 120 | Ga0070704_100001549 | 3300005549 | Bacteria | 12412 |
| 121 | Ga0070704_100294060 | 3300005549 | Bacteria | 1350 |
| 122 | Ga0068854_100002581 | 3300005578 | Bacteria | 11222 |
| 123 | Ga0068854_100130145 | 3300005578 | Bacteria | 1921 |
| 124 | Ga0068854_100132508 | 3300005578 | Bacteria | 1904 |
| 125 | Ga0068854_100301191 | 3300005578 | Bacteria | 1297 |
| 126 | Ga0068856_100715258 | 3300005614 | Bacteria | 1022 |
| 127 | Ga0070702_100000718 | 3300005615 | Bacteria | 12552 |
| 128 | Ga0070702_100241439 | 3300005615 | Bacteria | 1219 |
| 129 | Ga0068852_100058714 | 3300005616 | Bacteria | 3334 |
| 130 | Ga0068852_100093560 | 3300005616 | Bacteria | 2694 |
| 131 | Ga0068859_100014976 | 3300005617 | Bacteria | 7785 |
| 132 | Ga0068859_100059900 | 3300005617 | Bacteria | 3836 |
| 133 | Ga0068864_100180114 | 3300005618 | Bacteria | 1932 |
| 134 | Ga0068864_100185266 | 3300005618 | Bacteria | 1905 |
| 135 | Ga0068866_10002610 | 3300005718 | Bacteria | 7447 |
| 136 | Ga0068861_100002207 | 3300005719 | Bacteria | 12627 |
| 137 | Ga0068861_100112024 | 3300005719 | Bacteria | 2187 |
| 138 | Ga0068851_10377681 | 3300005834 | Bacteria | 830 |
| 139 | Ga0068863_100000621 | 3300005841 | Bacteria | 35949 |
| 140 | Ga0068863_100017418 | 3300005841 | Bacteria | 6888 |
| 141 | Ga0068863_100407907 | 3300005841 | Bacteria | 1330 |
| 142 | Ga0068858_100010321 | 3300005842 | Bacteria | 8851 |
| 143 | Ga0068858_100013740 | 3300005842 | Bacteria | 7643 |
| 144 | Ga0068858_100015049 | 3300005842 | Bacteria | 7276 |
| 145 | Ga0068860_100000020 | 3300005843 | Bacteria | 283324 |
| 146 | Ga0068860_100007201 | 3300005843 | Bacteria | 11122 |
| 147 | Ga0068862_100000013 | 3300005844 | Bacteria | 263115 |
| 148 | Ga0068862_100004925 | 3300005844 | Bacteria | 11244 |
| 149 | Ga0068862_100124656 | 3300005844 | Bacteria | 2273 |
| 150 | Ga0068862_100228862 | 3300005844 | Bacteria | 1686 |
| 151 | Ga0068862_100544952 | 3300005844 | Bacteria | 1107 |
| 152 | Ga0081455_10000667 | 3300005937 | Bacteria | 44477 |
| 153 | Ga0081455_10041106 | 3300005937 | Bacteria | 4071 |
| 154 | Ga0081455_10093898 | 3300005937 | Bacteria | 2424 |
| 155 | Ga0081455_10144366 | 3300005937 | Bacteria | 1843 |
| 156 | Ga0081538_10057642 | 3300005981 | Bacteria | 2260 |
| 157 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 158 | Ga0070717_10055988 | 3300006028 | Bacteria | 3256 |
| 159 | Ga0070717_10102191 | 3300006028 | Bacteria | 2435 |
| 160 | Ga0070717_10265505 | 3300006028 | Bacteria | 1519 |
| 161 | Ga0075365_10007302 | 3300006038 | Bacteria | 6176 |
| 162 | Ga0075365_10020404 | 3300006038 | Bacteria | 4108 |
| 163 | Ga0075363_100000818 | 3300006048 | Bacteria | 10776 |
| 164 | Ga0075363_100036777 | 3300006048 | Bacteria | 2569 |
| 165 | Ga0075363_100065254 | 3300006048 | Bacteria | 1968 |
| 166 | Ga0075363_100106936 | 3300006048 | Bacteria | 1552 |
| 167 | Ga0075364_10007304 | 3300006051 | Bacteria | 6557 |
| 168 | Ga0075364_10007949 | 3300006051 | Bacteria | 6319 |
| 169 | Ga0075364_10027223 | 3300006051 | Bacteria | 3651 |
| 170 | Ga0075364_10073739 | 3300006051 | Bacteria | 2250 |
| 171 | Ga0075364_10183317 | 3300006051 | Bacteria | 1417 |
| 172 | Ga0070715_10001443 | 3300006163 | Bacteria | 6889 |
| 173 | Ga0070715_10024140 | 3300006163 | Bacteria | 2391 |
| 174 | Ga0070716_100002440 | 3300006173 | Bacteria | 8568 |
| 175 | Ga0070712_100001326 | 3300006175 | Bacteria | 15008 |
| 176 | Ga0075362_10168498 | 3300006177 | Bacteria | 1057 |
| 177 | Ga0075367_10033423 | 3300006178 | Bacteria | 2964 |
| 178 | Ga0075367_10199756 | 3300006178 | Bacteria | 1249 |
| 179 | Ga0075367_10286453 | 3300006178 | Bacteria | 1036 |
| 180 | Ga0075369_10001462 | 3300006186 | Bacteria | 8060 |
| 181 | Ga0075369_10002699 | 3300006186 | Bacteria | 6363 |
| 182 | Ga0075369_10003020 | 3300006186 | Bacteria | 6086 |
| 183 | Ga0075369_10009883 | 3300006186 | Bacteria | 3721 |
| 184 | Ga0075369_10014091 | 3300006186 | Bacteria | 3188 |
| 185 | Ga0075369_10021331 | 3300006186 | Bacteria | 2661 |
| 186 | Ga0075369_10023389 | 3300006186 | Bacteria | 2554 |
| 187 | Ga0075369_10063762 | 3300006186 | Bacteria | 1613 |
| 188 | Ga0075369_10103156 | 3300006186 | Bacteria | 1281 |
| 189 | Ga0097621_100175782 | 3300006237 | Bacteria | 1848 |
| 190 | Ga0075370_10009696 | 3300006353 | Bacteria | 5013 |
| 191 | Ga0075370_10131799 | 3300006353 | Bacteria | 1459 |
| 192 | Ga0075370_10186266 | 3300006353 | Bacteria | 1222 |
| 193 | Ga0068871_100160944 | 3300006358 | Bacteria | 1920 |
| 194 | Ga0075428_100010758 | 3300006844 | Bacteria | 10170 |
| 195 | Ga0075430_100103300 | 3300006846 | Bacteria | 2379 |
| 196 | Ga0075431_100045559 | 3300006847 | Bacteria | 4522 |
| 197 | Ga0068865_100001748 | 3300006881 | Bacteria | 12748 |
| 198 | Ga0068865_100492297 | 3300006881 | Bacteria | 1021 |
| 199 | Ga0097620_100014976 | 3300006931 | Bacteria | 7785 |
| 200 | Ga0097620_100059895 | 3300006931 | Bacteria | 3836 |
| 201 | Ga0097620_100515530 | 3300006931 | Bacteria | 1291 |
| 202 | Ga0105244_10192652 | 3300009036 | Bacteria | 963 |
| 203 | Ga0105250_10012038 | 3300009092 | Bacteria | 3582 |
| 204 | Ga0105250_10099289 | 3300009092 | Bacteria | 1187 |
| 205 | Ga0105240_10512553 | 3300009093 | Bacteria | 1332 |
| 206 | Ga0105240_10532185 | 3300009093 | Bacteria | 1303 |
| 207 | Ga0111539_10233122 | 3300009094 | Bacteria | 2143 |
| 208 | Ga0105245_10004631 | 3300009098 | Bacteria | 12148 |
| 209 | Ga0105245_10151001 | 3300009098 | Bacteria | 2197 |
| 210 | Ga0105245_10176031 | 3300009098 | Bacteria | 2041 |
| 211 | Ga0105245_10993997 | 3300009098 | Bacteria | 883 |
| 212 | Ga0105247_10000009 | 3300009101 | Bacteria | 385991 |
| 213 | Ga0105247_10001964 | 3300009101 | Bacteria | 14281 |
| 214 | Ga0105247_10054015 | 3300009101 | Bacteria | 2479 |
| 215 | Ga0105247_10109332 | 3300009101 | Bacteria | 1777 |
| 216 | Ga0114129_10008093 | 3300009147 | Bacteria | 14981 |
| 217 | Ga0105243_10003417 | 3300009148 | Bacteria | 12868 |
| 218 | Ga0105243_10013745 | 3300009148 | Bacteria | 6125 |
| 219 | Ga0105243_10190098 | 3300009148 | Bacteria | 1793 |
| 220 | Ga0105243_10238929 | 3300009148 | Bacteria | 1615 |
| 221 | Ga0105243_10286244 | 3300009148 | Bacteria | 1487 |
| 222 | Ga0105243_10509579 | 3300009148 | Bacteria | 1142 |
| 223 | Ga0105243_10790841 | 3300009148 | Bacteria | 934 |
| 224 | Ga0105241_10381362 | 3300009174 | Bacteria | 1232 |
| 225 | Ga0105242_10003784 | 3300009176 | Bacteria | 11765 |
| 226 | Ga0105248_10000109 | 3300009177 | Bacteria | 93114 |
| 227 | Ga0105248_10032558 | 3300009177 | Bacteria | 5826 |
| 228 | Ga0105248_10048242 | 3300009177 | Bacteria | 4777 |
| 229 | Ga0105237_10000587 | 3300009545 | Bacteria | 50736 |
| 230 | Ga0105237_10015861 | 3300009545 | Bacteria | 7834 |
| 231 | Ga0105237_10016819 | 3300009545 | Bacteria | 7593 |
| 232 | Ga0105238_10117062 | 3300009551 | Bacteria | 2645 |
| 233 | Ga0105249_10000011 | 3300009553 | Bacteria | 292812 |
| 234 | Ga0105249_10004295 | 3300009553 | Bacteria | 12319 |
| 235 | Ga0105249_10009857 | 3300009553 | Bacteria | 8374 |
| 236 | Ga0105249_10750533 | 3300009553 | Bacteria | 1038 |
| 237 | Ga0105249_10880063 | 3300009553 | Bacteria | 962 |
| 238 | Ga0105239_10011860 | 3300010375 | Bacteria | 9724 |
| 239 | Ga0105239_10014224 | 3300010375 | Bacteria | 8832 |
| 240 | Ga0105239_10017470 | 3300010375 | Bacteria | 7933 |
| 241 | Ga0105239_10276114 | 3300010375 | Bacteria | 1891 |
| 242 | Ga0105246_10028692 | 3300011119 | Bacteria | 3658 |
| 243 | Ga0105246_10273986 | 3300011119 | Bacteria | 1350 |
| 244 | Ga0157369_10124593 | 3300013105 | Bacteria | 2733 |
| 245 | Ga0157378_10007770 | 3300013297 | Bacteria | 9363 |
| 246 | Ga0157378_10101206 | 3300013297 | Bacteria | 2632 |
| 247 | Ga0163162_10006354 | 3300013306 | Bacteria | 11437 |
| 248 | Ga0163162_10036414 | 3300013306 | Bacteria | 4904 |
| 249 | Ga0163162_10086089 | 3300013306 | Bacteria | 3220 |
| 250 | Ga0163162_10116251 | 3300013306 | Bacteria | 2776 |
| 251 | Ga0157372_10014607 | 3300013307 | Bacteria | 8400 |
| 252 | Ga0157372_10459439 | 3300013307 | Bacteria | 1484 |
| 253 | Ga0157375_10004095 | 3300013308 | Bacteria | 12638 |
| 254 | Ga0157375_10089136 | 3300013308 | Bacteria | 3140 |
| 255 | Ga0157375_10136305 | 3300013308 | Bacteria | 2579 |
| 256 | Ga0163163_10006691 | 3300014325 | Bacteria | 10099 |
| 257 | Ga0163163_10072929 | 3300014325 | Bacteria | 3423 |
| 258 | Ga0163163_10079613 | 3300014325 | Bacteria | 3275 |
| 259 | Ga0163163_10742761 | 3300014325 | Bacteria | 1045 |
| 260 | Ga0157380_10006086 | 3300014326 | Bacteria | 8459 |
| 261 | Ga0157380_10121602 | 3300014326 | Bacteria | 2212 |
| 262 | Ga0157377_10052204 | 3300014745 | Bacteria | 2308 |
| 263 | Ga0157377_10052590 | 3300014745 | Bacteria | 2300 |
| 264 | Ga0157379_10003994 | 3300014968 | Bacteria | 12576 |
| 265 | Ga0157379_10122984 | 3300014968 | Bacteria | 2335 |
| 266 | Ga0157379_10587575 | 3300014968 | Bacteria | 1038 |
| 267 | Ga0157376_10303248 | 3300014969 | Bacteria | 1513 |
| 268 | Ga0163161_10002738 | 3300017792 | Bacteria | 12540 |
| 269 | Ga0163161_10091399 | 3300017792 | Bacteria | 2253 |
| 270 | Ga0213876_10040018 | 3300021384 | Bacteria | 2476 |
| 271 | Ga0213876_10177785 | 3300021384 | Bacteria | 1132 |
| 272 | Ga0213875_10002710 | 3300021388 | Bacteria | 10464 |
| 273 | Ga0209025_1110762 | 3300025294 | Bacteria | 844 |
| 274 | Ga0209051_1000333 | 3300025303 | Bacteria | 70796 |
| 275 | Ga0209051_1000520 | 3300025303 | Bacteria | 48228 |
| 276 | Ga0209051_1000717 | 3300025303 | Bacteria | 36316 |
| 277 | Ga0209051_1031282 | 3300025303 | Bacteria | 2050 |
| 278 | Ga0209051_1081288 | 3300025303 | Bacteria | 934 |
| 279 | Ga0207656_10258647 | 3300025321 | Bacteria | 854 |
| 280 | Ga0207682_10328334 | 3300025893 | Bacteria | 719 |
| 281 | Ga0207692_10002807 | 3300025898 | Bacteria | 6728 |
| 282 | Ga0207692_10081045 | 3300025898 | Bacteria | 1736 |
| 283 | Ga0207642_10000103 | 3300025899 | Bacteria | 22601 |
| 284 | Ga0207710_10000014 | 3300025900 | Bacteria | 408072 |
| 285 | Ga0207710_10004537 | 3300025900 | Bacteria | 6035 |
| 286 | Ga0207688_10001724 | 3300025901 | Bacteria | 11601 |
| 287 | Ga0207688_10004440 | 3300025901 | Bacteria | 7635 |
| 288 | Ga0207688_10007439 | 3300025901 | Bacteria | 5957 |
| 289 | Ga0207688_10118469 | 3300025901 | Bacteria | 1543 |
| 290 | Ga0207680_10070547 | 3300025903 | Bacteria | 2163 |
| 291 | Ga0207647_10079356 | 3300025904 | Bacteria | 1971 |
| 292 | Ga0207647_10099876 | 3300025904 | Bacteria | 1723 |
| 293 | Ga0207647_10170793 | 3300025904 | Bacteria | 1266 |
| 294 | Ga0207685_10043018 | 3300025905 | Bacteria | 1700 |
| 295 | Ga0207699_10019581 | 3300025906 | Bacteria | 3612 |
| 296 | Ga0207699_10054119 | 3300025906 | Bacteria | 2383 |
| 297 | Ga0207699_10060788 | 3300025906 | Bacteria | 2270 |
| 298 | Ga0207645_10016541 | 3300025907 | Bacteria | 4880 |
| 299 | Ga0207645_10028640 | 3300025907 | Bacteria | 3595 |
| 300 | Ga0207684_10061299 | 3300025910 | Bacteria | 3194 |
| 301 | Ga0207654_10256097 | 3300025911 | Bacteria | 1175 |
| 302 | Ga0207695_10272319 | 3300025913 | Bacteria | 1588 |
| 303 | Ga0207671_10066155 | 3300025914 | Bacteria | 2690 |
| 304 | Ga0207671_10113907 | 3300025914 | Bacteria | 2061 |
| 305 | Ga0207671_10119898 | 3300025914 | Bacteria | 2010 |
| 306 | Ga0207693_10003311 | 3300025915 | Bacteria | 13783 |
| 307 | Ga0207693_10120569 | 3300025915 | Bacteria | 2060 |
| 308 | Ga0207693_10328042 | 3300025915 | Bacteria | 1198 |
| 309 | Ga0207693_10457059 | 3300025915 | Bacteria | 998 |
| 310 | Ga0207663_10000981 | 3300025916 | Bacteria | 13071 |
| 311 | Ga0207663_10071733 | 3300025916 | Bacteria | 2236 |
| 312 | Ga0207662_10017713 | 3300025918 | Bacteria | 4032 |
| 313 | Ga0207662_10225409 | 3300025918 | Bacteria | 1222 |
| 314 | Ga0207657_10240840 | 3300025919 | Bacteria | 1444 |
| 315 | Ga0207657_10258820 | 3300025919 | Bacteria | 1385 |
| 316 | Ga0207646_10006610 | 3300025922 | Bacteria | 11970 |
| 317 | Ga0207681_10005669 | 3300025923 | Bacteria | 7664 |
| 318 | Ga0207681_10051810 | 3300025923 | Bacteria | 2781 |
| 319 | Ga0207659_10249947 | 3300025926 | Bacteria | 1438 |
| 320 | Ga0207687_10002874 | 3300025927 | Bacteria | 11689 |
| 321 | Ga0207687_10066920 | 3300025927 | Bacteria | 2554 |
| 322 | Ga0207687_10417739 | 3300025927 | Bacteria | 1106 |
| 323 | Ga0207700_10142567 | 3300025928 | Bacteria | 1971 |
| 324 | Ga0207664_10088780 | 3300025929 | Bacteria | 2530 |
| 325 | Ga0207664_10138195 | 3300025929 | Bacteria | 2058 |
| 326 | Ga0207664_10563152 | 3300025929 | Bacteria | 1023 |
| 327 | Ga0207664_10779292 | 3300025929 | Bacteria | 860 |
| 328 | Ga0207644_10041414 | 3300025931 | Bacteria | 3258 |
| 329 | Ga0207690_10373009 | 3300025932 | Bacteria | 1132 |
| 330 | Ga0207690_10389726 | 3300025932 | Bacteria | 1109 |
| 331 | Ga0207706_10010422 | 3300025933 | Bacteria | 8491 |
| 332 | Ga0207706_10039924 | 3300025933 | Bacteria | 4160 |
| 333 | Ga0207706_10054717 | 3300025933 | Bacteria | 3521 |
| 334 | Ga0207686_10001839 | 3300025934 | Bacteria | 11801 |
| 335 | Ga0207709_10007208 | 3300025935 | Bacteria | 6205 |
| 336 | Ga0207709_10064704 | 3300025935 | Bacteria | 2297 |
| 337 | Ga0207709_10259883 | 3300025935 | Bacteria | 1273 |
| 338 | Ga0207670_10070046 | 3300025936 | Bacteria | 2421 |
| 339 | Ga0207669_10000215 | 3300025937 | Bacteria | 26345 |
| 340 | Ga0207669_10056441 | 3300025937 | Bacteria | 2385 |
| 341 | Ga0207704_10000580 | 3300025938 | Bacteria | 16284 |
| 342 | Ga0207665_10002002 | 3300025939 | Bacteria | 13735 |
| 343 | Ga0207691_10037577 | 3300025940 | Bacteria | 4484 |
| 344 | Ga0207711_10000322 | 3300025941 | Bacteria | 51422 |
| 345 | Ga0207711_10008630 | 3300025941 | Bacteria | 8520 |
| 346 | Ga0207711_10127926 | 3300025941 | Bacteria | 2274 |
| 347 | Ga0207689_10014414 | 3300025942 | Bacteria | 6724 |
| 348 | Ga0207667_10120130 | 3300025949 | Bacteria | 2708 |
| 349 | Ga0207712_10000020 | 3300025961 | Bacteria | 292796 |
| 350 | Ga0207712_10013121 | 3300025961 | Bacteria | 5308 |
| 351 | Ga0207712_10073455 | 3300025961 | Bacteria | 2467 |
| 352 | Ga0207712_10126557 | 3300025961 | Bacteria | 1941 |
| 353 | Ga0207668_10003993 | 3300025972 | Bacteria | 8692 |
| 354 | Ga0207668_10005510 | 3300025972 | Bacteria | 7462 |
| 355 | Ga0207668_10117799 | 3300025972 | Bacteria | 2005 |
| 356 | Ga0207668_10286561 | 3300025972 | Bacteria | 1353 |
| 357 | Ga0207640_10001964 | 3300025981 | Bacteria | 11078 |
| 358 | Ga0207640_10093916 | 3300025981 | Bacteria | 2085 |
| 359 | Ga0207658_10000055 | 3300025986 | Bacteria | 125014 |
| 360 | Ga0207658_10001485 | 3300025986 | Bacteria | 18208 |
| 361 | Ga0207658_10065842 | 3300025986 | Bacteria | 2723 |
| 362 | Ga0207658_10511736 | 3300025986 | Bacteria | 1070 |
| 363 | Ga0207677_10003911 | 3300026023 | Bacteria | 7931 |
| 364 | Ga0207677_10044493 | 3300026023 | Bacteria | 2959 |
| 365 | Ga0207703_10006323 | 3300026035 | Bacteria | 9469 |
| 366 | Ga0207703_10009452 | 3300026035 | Bacteria | 7656 |
| 367 | Ga0207703_10426467 | 3300026035 | Bacteria | 1235 |
| 368 | Ga0207639_10008988 | 3300026041 | Bacteria | 6878 |
| 369 | Ga0207639_10072670 | 3300026041 | Bacteria | 2694 |
| 370 | Ga0207678_10013443 | 3300026067 | Bacteria | 7185 |
| 371 | Ga0207678_10018721 | 3300026067 | Bacteria | 6081 |
| 372 | Ga0207678_10100347 | 3300026067 | Bacteria | 2473 |
| 373 | Ga0207678_10359287 | 3300026067 | Bacteria | 1257 |
| 374 | Ga0207708_10009940 | 3300026075 | Bacteria | 7064 |
| 375 | Ga0207702_10651297 | 3300026078 | Bacteria | 1036 |
| 376 | Ga0207641_10003088 | 3300026088 | Bacteria | 15007 |
| 377 | Ga0207641_10025442 | 3300026088 | Bacteria | 4880 |
| 378 | Ga0207648_10006769 | 3300026089 | Bacteria | 11365 |
| 379 | Ga0207648_10066765 | 3300026089 | Bacteria | 3137 |
| 380 | Ga0207648_10082259 | 3300026089 | Bacteria | 2808 |
| 381 | Ga0207676_10195416 | 3300026095 | Bacteria | 1784 |
| 382 | Ga0207676_10635778 | 3300026095 | Bacteria | 1028 |
| 383 | Ga0207675_100006306 | 3300026118 | Bacteria | 11254 |
| 384 | Ga0207675_100069950 | 3300026118 | Bacteria | 3280 |
| 385 | Ga0207675_100117272 | 3300026118 | Bacteria | 2517 |
| 386 | Ga0207675_100137667 | 3300026118 | Bacteria | 2318 |
| 387 | Ga0207683_10005026 | 3300026121 | Bacteria | 11354 |
| 388 | Ga0207683_10053936 | 3300026121 | Bacteria | 3526 |
| 389 | Ga0207683_10463984 | 3300026121 | Bacteria | 1168 |
| 390 | Ga0207698_10039853 | 3300026142 | Bacteria | 3484 |
| 391 | Ga0207698_10067945 | 3300026142 | Bacteria | 2813 |
| 392 | Ga0207698_11092681 | 3300026142 | Bacteria | 810 |
| 393 | Ga0268266_10081328 | 3300028379 | Bacteria | 2824 |
| 394 | Ga0268266_10220964 | 3300028379 | Bacteria | 1741 |
| 395 | Ga0268266_10692422 | 3300028379 | Bacteria | 982 |
| 396 | Ga0268265_10000004 | 3300028380 | Bacteria | 648376 |
| 397 | Ga0268265_10004893 | 3300028380 | Bacteria | 9225 |
| 398 | Ga0268265_10464529 | 3300028380 | Bacteria | 1185 |
| 399 | Ga0268265_10740188 | 3300028380 | Bacteria | 953 |
| 400 | Ga0268264_10000024 | 3300028381 | Bacteria | 470081 |
| 401 | Ga0268264_10002682 | 3300028381 | Bacteria | 15540 |
| 402 | Ga0307515_10055239 | 3300028794 | Bacteria | 5808 |
| 403 | Ga0307512_10024587 | 3300030522 | Bacteria | 5356 |
| 404 | Ga0265327_10000964 | 3300031251 | Bacteria | 41214 |
| 405 | Ga0265327_10028389 | 3300031251 | Bacteria | 3202 |
| 406 | Ga0307513_10245457 | 3300031456 | Bacteria | 1592 |
| 407 | Ga0307413_10392857 | 3300031824 | Bacteria | 1084 |
| 408 | Ga0307410_10069603 | 3300031852 | Bacteria | 2435 |
| 409 | Ga0307409_100007289 | 3300031995 | Bacteria | 6603 |
| 410 | Ga0307416_100074799 | 3300032002 | Bacteria | 2832 |
| 411 | Ga0307416_100645697 | 3300032002 | Bacteria | 1143 |
| 412 | Ga0307411_10065463 | 3300032005 | Bacteria | 2438 |
| 413 | Ga0373959_0086204 | 3300034820 | Bacteria | 730 |
| 414 | Ga0373960_0172107 | 3300035121 | Bacteria | 751 |
| 415 | Ga0373942_0048997 | 3300035207 | Bacteria | 1179 |
| 416 | Ga0373962_0097281 | 3300035242 | Bacteria | 914 |
| 417 | Ga0373931_0013263 | 3300035691 | Bacteria | 4011 |
| 418 | Ga0373931_0036656 | 3300035691 | Bacteria | 2557 |
| 419 | Ga0316584_0015074 | 3300036712 | Bacteria | 5523 |
| 420 | Ga0316584_0138875 | 3300036712 | Bacteria | 1813 |
| 421 | Ga0436364_0988707 | 3300037853 | Bacteria | 16804 |
| 422 | Ga0436365_0099441 | 3300039437 | Bacteria | 9181 |
| 423 | Ga0436365_0114496 | 3300039437 | Bacteria | 2367 |
| 424 | Ga0436365_1318964 | 3300039437 | Bacteria | 13827 |
| 425 | Ga0436361_0761186 | 3300039447 | Bacteria | 1393 |
| 426 | Ga0436363_0146676 | 3300039450 | Bacteria | 2284 |
| 427 | Ga0436363_1097219 | 3300039450 | Bacteria | 1568 |
| 428 | Ga0451795_1539735 | 3300041456 | Bacteria | 1526 |
| 429 | Ga0451802_1438524 | 3300041460 | Bacteria | 1121 |
| 430 | Ga0451802_1840921 | 3300041460 | Bacteria | 1334 |
| 431 | Ga0451837_1099642 | 3300041494 | Bacteria | 882 |
| 432 | Ga0451853_2813990 | 3300041512 | Bacteria | 1933 |
| 433 | Ga0466972_0016979 | 3300044658 | Bacteria | 3641 |
| 434 | Ga0466972_0036745 | 3300044658 | Bacteria | 2395 |
| 435 | Ga0466965_0043644 | 3300044683 | Bacteria | 2214 |
| 436 | Ga0466965_0217396 | 3300044683 | Bacteria | 1018 |
| 437 | Ga0466963_0117387 | 3300044694 | Bacteria | 1829 |
| 438 | Ga0466971_0025853 | 3300044719 | Bacteria | 2622 |
| 439 | Ga0466968_0001467 | 3300044735 | Bacteria | 8445 |
| 440 | Ga0466970_0197000 | 3300044765 | Bacteria | 1120 |
| 441 | Ga0466957_0006319 | 3300044842 | Bacteria | 6681 |
| 442 | Ga0466957_0286968 | 3300044842 | Bacteria | 1103 |
| 443 | Ga0466960_0000148 | 3300044901 | Bacteria | 24082 |
| 444 | Ga0466960_0000254 | 3300044901 | Bacteria | 18334 |
| 445 | Ga0466959_0097113 | 3300045049 | Bacteria | 2111 |
| 446 | Ga0466958_0132137 | 3300045836 | Bacteria | 1568 |
| 447 | Ga0466958_0485170 | 3300045836 | Bacteria | 801 |
| 448 | Ga0466967_0004060 | 3300045976 | Bacteria | 9768 |
| 449 | Ga0466967_0018811 | 3300045976 | Bacteria | 5535 |
| 450 | Ga0466967_0024904 | 3300045976 | Bacteria | 4927 |
| 451 | Ga0466967_0988248 | 3300045976 | Bacteria | 838 |
| 452 | Ga0495603_0070641 | 3300046455 | Bacteria | 2052 |
| 453 | Ga0495629_0016396 | 3300046459 | Bacteria | 5318 |
| 454 | Ga0495629_0017034 | 3300046459 | Bacteria | 5214 |
| 455 | Ga0495638_0001425 | 3300046460 | Bacteria | 21684 |
| 456 | Ga0495638_0016648 | 3300046460 | Bacteria | 4920 |
| 457 | Ga0495638_0022263 | 3300046460 | Bacteria | 4161 |
| 458 | Ga0495641_0024206 | 3300046461 | Bacteria | 3001 |
| 459 | Ga0495580_0511256 | 3300046472 | Bacteria | 801 |
| 460 | Ga0495582_0024047 | 3300046473 | Bacteria | 3331 |
| 461 | Ga0495582_0030585 | 3300046473 | Bacteria | 2956 |
| 462 | Ga0495662_0130976 | 3300046476 | Bacteria | 1233 |
| 463 | Ga0495607_0006562 | 3300046501 | Bacteria | 8176 |
| 464 | Ga0495606_0012168 | 3300046507 | Bacteria | 6936 |
| 465 | Ga0495648_0006285 | 3300046524 | Bacteria | 9716 |
| 466 | Ga0495665_0037559 | 3300046531 | Bacteria | 2585 |
| 467 | Ga0495665_0188020 | 3300046531 | Bacteria | 1072 |
| 468 | Ga0495640_0048956 | 3300046533 | Bacteria | 2917 |
| 469 | Ga0495645_0164747 | 3300046543 | Bacteria | 1530 |
| 470 | Ga0495668_0030531 | 3300046616 | Bacteria | 3042 |
| 471 | Ga0495611_0030198 | 3300046648 | Bacteria | 2381 |
| 472 | Ga0495625_0086223 | 3300046660 | Bacteria | 2179 |
| 473 | Ga0495625_0512166 | 3300046660 | Bacteria | 732 |
| 474 | Ga0495635_0440364 | 3300046663 | Bacteria | 862 |
| 475 | Ga0495588_0331202 | 3300046674 | Bacteria | 801 |
| 476 | Ga0495657_0155126 | 3300046675 | Bacteria | 1420 |
| 477 | Ga0495647_0092012 | 3300046681 | Bacteria | 1245 |
| 478 | Ga0495647_0112348 | 3300046681 | Bacteria | 1138 |
| 479 | Ga0495658_0029021 | 3300046683 | Bacteria | 2990 |
| 480 | Ga0495581_0006653 | 3300047315 | Bacteria | 6697 |
| 481 | Ga0495581_0043682 | 3300047315 | Bacteria | 2592 |
| 482 | Ga0495604_0271939 | 3300047317 | Bacteria | 1148 |
| 483 | Ga0495674_0031919 | 3300047319 | Bacteria | 4780 |
| 484 | Ga0495674_0476514 | 3300047319 | Bacteria | 1001 |
| 485 | Ga0495672_0009344 | 3300047320 | Bacteria | 7116 |
| 486 | Ga0495676_0101140 | 3300047321 | Bacteria | 2133 |
| 487 | Ga0495676_0178612 | 3300047321 | Bacteria | 1489 |
| 488 | Ga0495683_0000316 | 3300047323 | Bacteria | 40616 |
| 489 | Ga0495683_0002516 | 3300047323 | Bacteria | 11015 |
| 490 | Ga0495673_0007756 | 3300047469 | Bacteria | 6126 |
| 491 | Ga0495686_0000767 | 3300047472 | Bacteria | 42353 |
| 492 | Ga0495686_0158823 | 3300047472 | Bacteria | 1322 |
| 493 | Ga0495593_0006145 | 3300047673 | Bacteria | 7065 |
| 494 | Ga0495593_0011199 | 3300047673 | Bacteria | 5157 |
| 495 | Ga0496100_0000111 | 3300048903 | Bacteria | 47022 |
| 496 | Ga0496100_0000406 | 3300048903 | Bacteria | 20830 |
| 497 | Ga0496100_0003117 | 3300048903 | Bacteria | 8582 |
| 498 | Ga0496100_0024059 | 3300048903 | Bacteria | 3710 |
| 499 | Ga0496100_0024790 | 3300048903 | Bacteria | 3663 |
| 500 | Ga0496101_0000091 | 3300048904 | Bacteria | 97934 |
| 501 | Ga0496101_0000103 | 3300048904 | Bacteria | 88726 |
| 502 | Ga0496101_0002051 | 3300048904 | Bacteria | 12257 |
| 503 | Ga0496101_0007249 | 3300048904 | Bacteria | 7175 |
| 504 | Ga0496101_0010006 | 3300048904 | Bacteria | 6248 |
| 505 | Ga0496101_0099777 | 3300048904 | Bacteria | 2171 |
| 506 | Ga0496101_0214736 | 3300048904 | Bacteria | 1491 |
| 507 | Ga0496102_0000016 | 3300048905 | Bacteria | 286787 |
| 508 | Ga0496102_0000451 | 3300048905 | Bacteria | 46781 |
| 509 | Ga0496102_0000692 | 3300048905 | Bacteria | 33501 |
| 510 | Ga0496102_0005014 | 3300048905 | Bacteria | 11214 |
| 511 | Ga0496102_0025597 | 3300048905 | Bacteria | 5255 |
| 512 | Ga0496102_0078246 | 3300048905 | Bacteria | 3044 |
| 513 | Ga0496102_0082914 | 3300048905 | Bacteria | 2957 |
| 514 | Ga0496102_0095201 | 3300048905 | Bacteria | 2760 |
| 515 | Ga0496102_0307158 | 3300048905 | Bacteria | 1495 |
| 516 | Ga0496102_0436643 | 3300048905 | Bacteria | 1229 |
| 517 | Ga0496102_0671425 | 3300048905 | Bacteria | 959 |
| 518 | Ga0496103_0000015 | 3300048906 | Bacteria | 287966 |
| 519 | Ga0496103_0001793 | 3300048906 | Bacteria | 14014 |
| 520 | Ga0496103_0001954 | 3300048906 | Bacteria | 13333 |
| 521 | Ga0496103_0005966 | 3300048906 | Bacteria | 7286 |
| 522 | Ga0496103_0007217 | 3300048906 | Bacteria | 6627 |
| 523 | Ga0496103_0126052 | 3300048906 | Bacteria | 1633 |
| 524 | Ga0496103_0163072 | 3300048906 | Bacteria | 1430 |
| 525 | Ga0496103_0280237 | 3300048906 | Bacteria | 1072 |
| 526 | Ga0496104_0244496 | 3300048907 | Bacteria | 1707 |
| 527 | Ga0496104_0736661 | 3300048907 | Bacteria | 893 |
| 528 | Ga0496104_0898994 | 3300048907 | Bacteria | 790 |
| 529 | Ga0496105_0003710 | 3300048908 | Bacteria | 11365 |
| 530 | Ga0496105_0078328 | 3300048908 | Bacteria | 2729 |
| 531 | Ga0496105_0138269 | 3300048908 | Bacteria | 2006 |
| 532 | Ga0496106_0000731 | 3300048909 | Bacteria | 23666 |
| 533 | Ga0496106_0005443 | 3300048909 | Bacteria | 9422 |
| 534 | Ga0496106_0021401 | 3300048909 | Bacteria | 4802 |
| 535 | Ga0496106_0052538 | 3300048909 | Bacteria | 3075 |
| 536 | Ga0496106_0631649 | 3300048909 | Bacteria | 856 |
| 537 | Ga0496107_0002328 | 3300048910 | Bacteria | 12263 |
| 538 | Ga0496107_0008519 | 3300048910 | Bacteria | 7098 |
| 539 | Ga0496107_0010233 | 3300048910 | Bacteria | 6509 |
| 540 | Ga0496108_0001277 | 3300048911 | Bacteria | 19717 |
| 541 | Ga0496108_0003194 | 3300048911 | Bacteria | 13188 |
| 542 | Ga0496108_0003852 | 3300048911 | Bacteria | 12042 |
| 543 | Ga0496108_0021900 | 3300048911 | Bacteria | 5254 |
| 544 | Ga0496108_0119564 | 3300048911 | Bacteria | 2259 |
| 545 | Ga0496108_0138114 | 3300048911 | Bacteria | 2099 |
| 546 | Ga0496108_0289633 | 3300048911 | Bacteria | 1426 |
| 547 | Ga0496109_0000562 | 3300048912 | Bacteria | 31022 |
| 548 | Ga0496109_0023877 | 3300048912 | Bacteria | 5429 |
| 549 | Ga0496109_0036402 | 3300048912 | Bacteria | 4442 |
| 550 | Ga0496109_0236078 | 3300048912 | Bacteria | 1720 |
| 551 | Ga0496110_0013540 | 3300048913 | Bacteria | 6749 |
| 552 | Ga0496110_0024078 | 3300048913 | Bacteria | 5187 |
| 553 | Ga0496110_0187131 | 3300048913 | Bacteria | 1880 |
| 554 | Ga0496112_0003021 | 3300048915 | Bacteria | 13753 |
| 555 | Ga0496112_0099487 | 3300048915 | Bacteria | 2878 |
| 556 | Ga0496112_0139323 | 3300048915 | Bacteria | 2395 |
| 557 | Ga0496112_0253530 | 3300048915 | Bacteria | 1710 |
| 558 | Ga0496112_0424970 | 3300048915 | Bacteria | 1267 |
| 559 | Ga0496113_0002057 | 3300048916 | Bacteria | 11559 |
| 560 | Ga0496113_0075998 | 3300048916 | Bacteria | 2565 |
| 561 | Ga0496114_0003175 | 3300048917 | Bacteria | 12602 |
| 562 | Ga0496114_0005368 | 3300048917 | Bacteria | 10019 |
| 563 | Ga0496114_0276246 | 3300048917 | Bacteria | 1481 |
| 564 | Ga0496115_0004547 | 3300048918 | Bacteria | 10039 |
| 565 | Ga0496115_0045816 | 3300048918 | Bacteria | 3493 |
| 566 | Ga0496115_0051265 | 3300048918 | Bacteria | 3309 |
| 567 | Ga0496115_0214433 | 3300048918 | Bacteria | 1590 |
| 568 | Ga0496115_0238309 | 3300048918 | Bacteria | 1500 |
| 569 | Ga0496116_0000055 | 3300048919 | Bacteria | 286923 |
| 570 | Ga0496116_0017473 | 3300048919 | Bacteria | 5564 |
| 571 | Ga0496116_0018185 | 3300048919 | Bacteria | 5428 |
| 572 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 573 | Ga0496117_0000280 | 3300048920 | Bacteria | 95337 |
| 574 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 575 | Ga0496118_0000505 | 3300048921 | Bacteria | 64638 |
| 576 | Ga0496118_0010921 | 3300048921 | Bacteria | 8929 |
| 577 | Ga0496119_0004681 | 3300048922 | Bacteria | 13481 |
| 578 | Ga0496119_0016780 | 3300048922 | Bacteria | 5546 |
| 579 | Ga0496119_0060206 | 3300048922 | Bacteria | 2275 |
| 580 | Ga0496119_0077816 | 3300048922 | Bacteria | 1920 |
| 581 | Ga0496120_0000272 | 3300048923 | Bacteria | 86274 |
| 582 | Ga0496120_0003889 | 3300048923 | Bacteria | 13079 |
| 583 | Ga0496120_0015574 | 3300048923 | Bacteria | 5009 |
| 584 | Ga0496120_0166763 | 3300048923 | Bacteria | 1093 |
| 585 | Ga0496121_0000134 | 3300048924 | Bacteria | 165728 |
| 586 | Ga0496121_0000331 | 3300048924 | Bacteria | 98656 |
| 587 | Ga0496121_0001052 | 3300048924 | Bacteria | 48971 |
| 588 | Ga0496121_0375458 | 3300048924 | Bacteria | 939 |
| 589 | Ga0496122_0000453 | 3300048925 | Bacteria | 85486 |
| 590 | Ga0496122_0011900 | 3300048925 | Bacteria | 8741 |
| 591 | Ga0496122_0287503 | 3300048925 | Bacteria | 895 |
| 592 | Ga0496123_0011572 | 3300048926 | Bacteria | 7630 |
| 593 | Ga0496123_0025319 | 3300048926 | Bacteria | 4477 |
| 594 | Ga0496124_0000113 | 3300048927 | Bacteria | 165710 |
| 595 | Ga0496124_0007312 | 3300048927 | Bacteria | 11777 |
| 596 | Ga0496124_0019870 | 3300048927 | Bacteria | 6231 |
| 597 | Ga0496125_0000127 | 3300048928 | Bacteria | 165710 |
| 598 | Ga0496125_0082997 | 3300048928 | Bacteria | 2440 |
| 599 | Ga0496125_0269324 | 3300048928 | Bacteria | 1062 |
| 600 | Ga0496125_0351198 | 3300048928 | Bacteria | 881 |
| 601 | Ga0496126_0000140 | 3300048929 | Bacteria | 165728 |
| 602 | Ga0496126_0000675 | 3300048929 | Bacteria | 62838 |
| 603 | Ga0496126_0004884 | 3300048929 | Bacteria | 15679 |
| 604 | Ga0496126_0016629 | 3300048929 | Bacteria | 7351 |
| 605 | Ga0496126_0023986 | 3300048929 | Bacteria | 5898 |
| 606 | Ga0496126_0037423 | 3300048929 | Bacteria | 4528 |
| 607 | Ga0496126_0467960 | 3300048929 | Bacteria | 1012 |
| 608 | Ga0501031_0468258 | 3300049568 | Bacteria | 814 |
| 609 | Ga0501032_0000802 | 3300049569 | Bacteria | 25536 |
| 610 | Ga0501033_0051666 | 3300049570 | Bacteria | 3047 |
| 611 | Ga0501034_0010251 | 3300049571 | Bacteria | 9776 |
| 612 | Ga0501034_0122633 | 3300049571 | Bacteria | 2585 |
| 613 | Ga0501037_0001268 | 3300049573 | Bacteria | 18615 |
| 614 | Ga0501038_0001207 | 3300049574 | Bacteria | 23435 |
| 615 | Ga0501039_0001670 | 3300049575 | Bacteria | 16354 |
| 616 | Ga0501040_0242101 | 3300049576 | Bacteria | 1286 |
| 617 | Ga0501043_0002613 | 3300049579 | Bacteria | 15190 |
| 618 | Ga0501046_0177183 | 3300049580 | Bacteria | 1596 |
| 619 | Ga0501047_0029682 | 3300049581 | Bacteria | 5272 |
| 620 | Ga0501047_0261489 | 3300049581 | Bacteria | 1578 |
| 621 | Ga0501047_0298684 | 3300049581 | Bacteria | 1453 |
| 622 | Ga0501069_0044707 | 3300049585 | Bacteria | 2452 |
| 623 | Ga0501070_0786090 | 3300049586 | Bacteria | 748 |
| 624 | Ga0501035_0005039 | 3300049822 | Bacteria | 12510 |
| 625 | Ga0501044_0000150 | 3300049823 | Bacteria | 85886 |
| 626 | Ga0501044_0044651 | 3300049823 | Bacteria | 4598 |
| 627 | Ga0501044_0205321 | 3300049823 | Bacteria | 1927 |
| 628 | Ga0501044_0271268 | 3300049823 | Bacteria | 1632 |
| 629 | nmdc:mga03n38_18459_c1 | 3300050490 | Bacteria | 2754 |
| 630 | nmdc:mga03n38_20052_c1 | 3300050490 | Bacteria | 2668 |
| 631 | nmdc:mga03n38_21497_c1 | 3300050490 | Bacteria | 2597 |
| 632 | nmdc:mga03n38_2985_c1 | 3300050490 | Bacteria | 5352 |
| 633 | nmdc:mga03n38_3516_c1 | 3300050490 | Bacteria | 5049 |
| 634 | nmdc:mga00v17_105056_c1 | 3300050491 | Bacteria | 1786 |
| 635 | nmdc:mga00v17_167213_c1 | 3300050491 | Bacteria | 1417 |
| 636 | nmdc:mga00v17_189928_c1 | 3300050491 | Bacteria | 1326 |
| 637 | nmdc:mga00v17_4304_c1 | 3300050491 | Bacteria | 7393 |
| 638 | nmdc:mga00v17_5980_c1 | 3300050491 | Bacteria | 6438 |
| 639 | nmdc:mga00v17_76422_c1 | 3300050491 | Bacteria | 2083 |
| 640 | nmdc:mga0yw44_11615_c1 | 3300050492 | Bacteria | 4557 |
| 641 | nmdc:mga0yw44_127509_c2 | 3300050492 | Bacteria | 1026 |
| 642 | nmdc:mga0yw44_3661_c2 | 3300050492 | Bacteria | 4387 |
| 643 | nmdc:mga06z11_48663_c1 | 3300050494 | Bacteria | 2159 |
| 644 | nmdc:mga04h51_145009_c1 | 3300050495 | Bacteria | 903 |
| 645 | nmdc:mga07m45_110204_c1 | 3300050496 | Bacteria | 966 |
| 646 | nmdc:mga07m45_147162_c1 | 3300050496 | Bacteria | 1365 |
| 647 | nmdc:mga07m45_46592_c2 | 3300050496 | Bacteria | 1219 |
| 648 | nmdc:mga05p37_9376_c1 | 3300050507 | Bacteria | 11585 |
| 649 | nmdc:mga0qj67_173006_c1 | 3300050509 | Bacteria | 1754 |
| 650 | nmdc:mga06r32_76788_c1 | 3300050510 | Bacteria | 3244 |
| 651 | nmdc:mga08y16_550944_c1 | 3300050511 | Bacteria | 1167 |
| 652 | nmdc:mga08y16_913761_c1 | 3300050511 | Bacteria | 863 |
| 653 | nmdc:mga0sz30_11783_c1 | 3300050516 | Bacteria | 3386 |
| 654 | nmdc:mga0sz30_14241_c1 | 3300050516 | Bacteria | 3126 |
| 655 | nmdc:mga0sz30_2129_c1 | 3300050516 | Bacteria | 7075 |
| 656 | nmdc:mga0sz30_22661_c1 | 3300050516 | Bacteria | 2551 |
| 657 | nmdc:mga0sz30_232075_c1 | 3300050516 | Bacteria | 821 |
| 658 | nmdc:mga0sz30_34722_c1 | 3300050516 | Bacteria | 2101 |
| 659 | nmdc:mga0sz30_39939_c1 | 3300050516 | Bacteria | 918 |
| 660 | nmdc:mga0sz30_7123_c1 | 3300050516 | Bacteria | 4183 |
| 661 | nmdc:mga0sz30_8334_c1 | 3300050516 | Bacteria | 3910 |
| 662 | Ga0500610_0009568 | 3300053079 | Bacteria | 4307 |
| 663 | Ga0500635_0001998 | 3300053080 | Bacteria | 4977 |
| 664 | Ga0500643_000986 | 3300053087 | Bacteria | 17489 |
| 665 | Ga0500643_005407 | 3300053087 | Bacteria | 5509 |
| 666 | Ga0500562_054533 | 3300053108 | Bacteria | 1071 |
| 667 | Ga0500642_0067593 | 3300053130 | Bacteria | 1620 |
| 668 | Ga0500652_001168 | 3300053131 | Bacteria | 8385 |
| 669 | Ga0500652_001181 | 3300053131 | Bacteria | 8340 |
| 670 | Ga0500652_036148 | 3300053131 | Bacteria | 1965 |
| 671 | Ga0500559_0004792 | 3300053136 | Bacteria | 6335 |
| 672 | Ga0500559_0008521 | 3300053136 | Bacteria | 4488 |
| 673 | Ga0500559_0177783 | 3300053136 | Bacteria | 1002 |
| 674 | Ga0500577_0004330 | 3300053142 | Bacteria | 3747 |
| 675 | Ga0500588_0045998 | 3300053146 | Bacteria | 1340 |
| 676 | Ga0500616_0007595 | 3300053153 | Bacteria | 6855 |
| 677 | Ga0500616_0035258 | 3300053153 | Bacteria | 2721 |
| 678 | Ga0500627_0010274 | 3300053158 | Bacteria | 3408 |
| 679 | Ga0500627_0010700 | 3300053158 | Bacteria | 3355 |
| 680 | Ga0500645_000007 | 3300053730 | Bacteria | 233700 |
| 681 | Ga0500645_000025 | 3300053730 | Bacteria | 125835 |
| 682 | Ga0500645_059016 | 3300053730 | Bacteria | 1111 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0188020 | Ga0495665_0188020_496_1059 | 186 |
| 2 | 3300025893 | Ga0207682_10328334 | Ga0207682_103283341 | 188 |
| 3 | 3300039447 | Ga0436361_0761186 | Ga0436361_0761186_586_1299 | 190 |
| 4 | 3300006028 | Ga0070717_10055988 | Ga0070717_100559882 | 196 |
| 5 | 3300048905 | Ga0496102_0078246 | Ga0496102_0078246_127_798 | 198 |
| 6 | 3300048906 | Ga0496103_0163072 | Ga0496103_0163072_430_1101 | 198 |
| 7 | 3300048921 | Ga0496118_0000505 | Ga0496118_0000505_24737_25408 | 198 |
| 8 | 3300044719 | Ga0466971_0025853 | Ga0466971_0025853_874_1545 | 199 |
| 9 | 3300044842 | Ga0466957_0286968 | Ga0466957_0286968_350_1021 | 199 |
| 10 | 3300041456 | Ga0451795_1539735 | Ga0451795_1539735_517_1212 | 201 |
| 11 | 3300041460 | Ga0451802_1840921 | Ga0451802_1840921_352_1047 | 201 |
| 12 | 3300003203 | JGI25406J46586_10004064 | JGI25406J46586_100040645 | 205 |
| 13 | 3300005985 | Ga0081539_10000027 | Ga0081539_10000027130 | 205 |
| 14 | iso_pu_bacteria | 2738543034 | 2739363284 | 205 |
| 15 | 3300005356 | Ga0070674_100085854 | Ga0070674_1000858543 | 206 |
| 16 | iso_pu_bacteria | 2551306166 | 2552107360 | 206 |
| 17 | iso_pu_bacteria | 2643221692 | 2644518199 | 206 |
| 18 | iso_pu_bacteria | 2904765812 | 2904767097 | 206 |
| 19 | iso_pu_bacteria | 2904770941 | 2904773858 | 206 |
| 20 | iso_pu_bacteria | 2908811453 | 2908814742 | 206 |
| 21 | iso_pu_bacteria | 2919420072 | 2919420455 | 206 |
| 22 | iso_pu_bacteria | 2919432681 | 2919433787 | 206 |
| 23 | 3300047315 | Ga0495581_0006653 | Ga0495581_0006653_2813_3448 | 207 |
| 24 | 3300028380 | Ga0268265_10740188 | Ga0268265_107401882 | 208 |
| 25 | 3300045976 | Ga0466967_0004060 | Ga0466967_0004060_8866_9498 | 208 |
| 26 | 3300005436 | Ga0070713_100780554 | Ga0070713_1007805541 | 209 |
| 27 | 3300006051 | Ga0075364_10183317 | Ga0075364_101833172 | 209 |
| 28 | 3300006177 | Ga0075362_10168498 | Ga0075362_101684981 | 209 |
| 29 | 3300006178 | Ga0075367_10286453 | Ga0075367_102864532 | 209 |
| 30 | 3300028794 | Ga0307515_10055239 | Ga0307515_100552395 | 209 |
| 31 | 3300050491 | nmdc:mga00v17_167213_c1 | nmdc:mga00v17_167213_c1_294_929 | 209 |
| 32 | iso_pu_bacteria | 2738543028 | 2739328628 | 209 |
| 33 | iso_pu_bacteria | 2870782633 | 2870790440 | 209 |
| 34 | iso_pu_bacteria | 2956939328 | 2956941146 | 209 |
| 35 | iso_pu_bacteria | 3001119090 | 3001120834 | 209 |
| 36 | 3300005468 | Ga0070707_100003248 | Ga0070707_1000032485 | 210 |
| 37 | 3300006178 | Ga0075367_10199756 | Ga0075367_101997562 | 210 |
| 38 | 3300009092 | Ga0105250_10099289 | Ga0105250_100992892 | 210 |
| 39 | 3300025910 | Ga0207684_10061299 | Ga0207684_100612992 | 210 |
| 40 | 3300025922 | Ga0207646_10006610 | Ga0207646_100066108 | 210 |
| 41 | 3300046663 | Ga0495635_0440364 | Ga0495635_0440364_214_849 | 210 |
| 42 | 3300048907 | Ga0496104_0736661 | Ga0496104_0736661_30_677 | 210 |
| 43 | 3300049586 | Ga0501070_0786090 | Ga0501070_0786090_82_714 | 210 |
| 44 | 3300053136 | Ga0500559_0008521 | Ga0500559_0008521_490_1125 | 210 |
| 45 | iso_pu_bacteria | 2558860112 | 2558909644 | 210 |
| 46 | iso_pu_bacteria | 2899359706 | 2899363265 | 210 |
| 47 | iso_pu_bacteria | 2919713450 | 2919713561 | 210 |
| 48 | 3300005436 | Ga0070713_100679440 | Ga0070713_1006794401 | 211 |
| 49 | 3300005456 | Ga0070678_100484260 | Ga0070678_1004842601 | 211 |
| 50 | 3300025929 | Ga0207664_10563152 | Ga0207664_105631522 | 211 |
| 51 | 3300044683 | Ga0466965_0217396 | Ga0466965_0217396_166_810 | 211 |
| 52 | 3300044694 | Ga0466963_0117387 | Ga0466963_0117387_963_1607 | 211 |
| 53 | 3300045836 | Ga0466958_0485170 | Ga0466958_0485170_49_693 | 211 |
| 54 | 3300048922 | Ga0496119_0060206 | Ga0496119_0060206_1356_2015 | 211 |
| 55 | 3300049569 | Ga0501032_0000802 | Ga0501032_0000802_2027_2662 | 211 |
| 56 | 3300049571 | Ga0501034_0010251 | Ga0501034_0010251_1840_2475 | 211 |
| 57 | 3300049573 | Ga0501037_0001268 | Ga0501037_0001268_8640_9275 | 211 |
| 58 | 3300049574 | Ga0501038_0001207 | Ga0501038_0001207_14612_15247 | 211 |
| 59 | 3300049575 | Ga0501039_0001670 | Ga0501039_0001670_14293_14928 | 211 |
| 60 | 3300049576 | Ga0501040_0242101 | Ga0501040_0242101_162_797 | 211 |
| 61 | 3300049579 | Ga0501043_0002613 | Ga0501043_0002613_8212_8847 | 211 |
| 62 | iso_pu_bacteria | 2558860112 | 2558913793 | 211 |
| 63 | iso_pu_bacteria | 2643221687 | 2644489026 | 211 |
| 64 | iso_pu_bacteria | 2738541264 | 2738667697 | 211 |
| 65 | iso_pu_bacteria | 2738541274 | 2738705796 | 211 |
| 66 | iso_pu_bacteria | 2738541356 | 2739146767 | 211 |
| 67 | iso_pu_bacteria | 2738543011 | 2739240143 | 211 |
| 68 | iso_pu_bacteria | 2738543028 | 2739330286 | 211 |
| 69 | iso_pu_bacteria | 2842134933 | 2842139391 | 211 |
| 70 | iso_pu_bacteria | 2870782633 | 2870790394 | 211 |
| 71 | iso_pu_bacteria | 2889300758 | 2889303371 | 211 |
| 72 | iso_pu_bacteria | 2902792274 | 2902792611 | 211 |
| 73 | iso_pu_bacteria | 2902799365 | 2902800141 | 211 |
| 74 | iso_pu_bacteria | 2939582691 | 2939587618 | 211 |
| 75 | iso_pu_bacteria | 2939743619 | 2939748565 | 211 |
| 76 | 3300005434 | Ga0070709_10030246 | Ga0070709_100302464 | 212 |
| 77 | 3300005436 | Ga0070713_100041193 | Ga0070713_1000411931 | 212 |
| 78 | 3300006028 | Ga0070717_10265505 | Ga0070717_102655051 | 212 |
| 79 | 3300006048 | Ga0075363_100106936 | Ga0075363_1001069362 | 212 |
| 80 | 3300009148 | Ga0105243_10013745 | Ga0105243_100137452 | 212 |
| 81 | 3300025294 | Ga0209025_1110762 | Ga0209025_11107621 | 212 |
| 82 | 3300025906 | Ga0207699_10019581 | Ga0207699_100195812 | 212 |
| 83 | 3300025929 | Ga0207664_10088780 | Ga0207664_100887802 | 212 |
| 84 | 3300025935 | Ga0207709_10259883 | Ga0207709_102598831 | 212 |
| 85 | 3300041512 | Ga0451853_2813990 | Ga0451853_2813990_989_1639 | 212 |
| 86 | 3300044765 | Ga0466970_0197000 | Ga0466970_0197000_98_739 | 212 |
| 87 | 3300047321 | Ga0495676_0178612 | Ga0495676_0178612_110_787 | 212 |
| 88 | 3300047472 | Ga0495686_0158823 | Ga0495686_0158823_508_1146 | 212 |
| 89 | 3300048905 | Ga0496102_0436643 | Ga0496102_0436643_409_1083 | 212 |
| 90 | 3300050491 | nmdc:mga00v17_189928_c1 | nmdc:mga00v17_189928_c1_557_1198 | 212 |
| 91 | iso_pu_bacteria | 2643221715 | 2644634805 | 212 |
| 92 | iso_pu_bacteria | 2791354901 | 2791916558 | 212 |
| 93 | iso_pu_bacteria | 2795385470 | 2795781939 | 212 |
| 94 | 3300005356 | Ga0070674_100008790 | Ga0070674_1000087902 | 213 |
| 95 | 3300006931 | Ga0097620_100515530 | Ga0097620_1005155302 | 213 |
| 96 | 3300025937 | Ga0207669_10056441 | Ga0207669_100564413 | 213 |
| 97 | 3300036712 | Ga0316584_0015074 | Ga0316584_0015074_1344_1985 | 213 |
| 98 | 3300045976 | Ga0466967_0988248 | Ga0466967_0988248_40_681 | 213 |
| 99 | 3300046501 | Ga0495607_0006562 | Ga0495607_0006562_80_721 | 213 |
| 100 | 3300046675 | Ga0495657_0155126 | Ga0495657_0155126_709_1368 | 213 |
| 101 | 3300047323 | Ga0495683_0000316 | Ga0495683_0000316_32608_33249 | 213 |
| 102 | 3300048904 | Ga0496101_0099777 | Ga0496101_0099777_461_1114 | 213 |
| 103 | 3300048905 | Ga0496102_0025597 | Ga0496102_0025597_1899_2552 | 213 |
| 104 | 3300048909 | Ga0496106_0052538 | Ga0496106_0052538_1606_2259 | 213 |
| 105 | 3300048928 | Ga0496125_0351198 | Ga0496125_0351198_85_726 | 213 |
| 106 | 3300048929 | Ga0496126_0037423 | Ga0496126_0037423_1219_1860 | 213 |
| 107 | 3300049581 | Ga0501047_0298684 | Ga0501047_0298684_644_1312 | 213 |
| 108 | 3300049585 | Ga0501069_0044707 | Ga0501069_0044707_1345_2013 | 213 |
| 109 | 3300049823 | Ga0501044_0044651 | Ga0501044_0044651_488_1129 | 213 |
| 110 | 3300053080 | Ga0500635_0001998 | Ga0500635_0001998_3173_3826 | 213 |
| 111 | 3300053087 | Ga0500643_005407 | Ga0500643_005407_106_747 | 213 |
| 112 | 3300053131 | Ga0500652_001181 | Ga0500652_001181_4019_4672 | 213 |
| 113 | 3300053131 | Ga0500652_036148 | Ga0500652_036148_931_1572 | 213 |
| 114 | 3300053136 | Ga0500559_0004792 | Ga0500559_0004792_2919_3560 | 213 |
| 115 | 3300053158 | Ga0500627_0010274 | Ga0500627_0010274_1256_1897 | 213 |
| 116 | 3300053730 | Ga0500645_000025 | Ga0500645_000025_47043_47684 | 213 |
| 117 | 3300005435 | Ga0070714_100370711 | Ga0070714_1003707111 | 214 |
| 118 | 3300005535 | Ga0070684_100132819 | Ga0070684_1001328193 | 214 |
| 119 | 3300005937 | Ga0081455_10000667 | Ga0081455_1000066716 | 214 |
| 120 | 3300009094 | Ga0111539_10233122 | Ga0111539_102331222 | 214 |
| 121 | 3300009148 | Ga0105243_10790841 | Ga0105243_107908411 | 214 |
| 122 | 3300030522 | Ga0307512_10024587 | Ga0307512_100245873 | 214 |
| 123 | 3300031456 | Ga0307513_10245457 | Ga0307513_102454572 | 214 |
| 124 | 3300045836 | Ga0466958_0132137 | Ga0466958_0132137_878_1522 | 214 |
| 125 | 3300046543 | Ga0495645_0164747 | Ga0495645_0164747_783_1430 | 214 |
| 126 | 3300047323 | Ga0495683_0002516 | Ga0495683_0002516_4438_5082 | 214 |
| 127 | 3300047472 | Ga0495686_0000767 | Ga0495686_0000767_17091_17741 | 214 |
| 128 | 3300048904 | Ga0496101_0214736 | Ga0496101_0214736_46_693 | 214 |
| 129 | 3300048906 | Ga0496103_0280237 | Ga0496103_0280237_366_1013 | 214 |
| 130 | 3300048907 | Ga0496104_0244496 | Ga0496104_0244496_565_1212 | 214 |
| 131 | 3300048915 | Ga0496112_0424970 | Ga0496112_0424970_527_1174 | 214 |
| 132 | 3300048916 | Ga0496113_0002057 | Ga0496113_0002057_5006_5653 | 214 |
| 133 | 3300048925 | Ga0496122_0011900 | Ga0496122_0011900_6856_7503 | 214 |
| 134 | 3300048926 | Ga0496123_0025319 | Ga0496123_0025319_1367_2014 | 214 |
| 135 | 3300048928 | Ga0496125_0082997 | Ga0496125_0082997_1654_2301 | 214 |
| 136 | 3300048929 | Ga0496126_0004884 | Ga0496126_0004884_5751_6398 | 214 |
| 137 | 3300049581 | Ga0501047_0261489 | Ga0501047_0261489_869_1537 | 214 |
| 138 | 3300049823 | Ga0501044_0271268 | Ga0501044_0271268_85_753 | 214 |
| 139 | 3300050511 | nmdc:mga08y16_550944_c1 | nmdc:mga08y16_550944_c1_111_755 | 214 |
| 140 | iso_pu_bacteria | 2547132424 | 2548697148 | 214 |
| 141 | 3300003792 | Ga0055540_1000147 | Ga0055540_100014721 | 215 |
| 142 | 3300003792 | Ga0055540_1000953 | Ga0055540_10009535 | 215 |
| 143 | 3300003792 | Ga0055540_1004309 | Ga0055540_10043092 | 215 |
| 144 | 3300005289 | Ga0065704_10206698 | Ga0065704_102066982 | 215 |
| 145 | 3300005330 | Ga0070690_100063818 | Ga0070690_1000638183 | 215 |
| 146 | 3300005335 | Ga0070666_10032346 | Ga0070666_100323462 | 215 |
| 147 | 3300005347 | Ga0070668_100402416 | Ga0070668_1004024162 | 215 |
| 148 | 3300005347 | Ga0070668_100524146 | Ga0070668_1005241462 | 215 |
| 149 | 3300005353 | Ga0070669_100001478 | Ga0070669_10000147815 | 215 |
| 150 | 3300005355 | Ga0070671_100375338 | Ga0070671_1003753381 | 215 |
| 151 | 3300005367 | Ga0070667_100000042 | Ga0070667_100000042113 | 215 |
| 152 | 3300005367 | Ga0070667_100002534 | Ga0070667_1000025349 | 215 |
| 153 | 3300005434 | Ga0070709_10032912 | Ga0070709_100329124 | 215 |
| 154 | 3300005435 | Ga0070714_100005869 | Ga0070714_1000058695 | 215 |
| 155 | 3300005437 | Ga0070710_10090134 | Ga0070710_100901342 | 215 |
| 156 | 3300005455 | Ga0070663_100529679 | Ga0070663_1005296791 | 215 |
| 157 | 3300005456 | Ga0070678_100209014 | Ga0070678_1002090142 | 215 |
| 158 | 3300005456 | Ga0070678_100732809 | Ga0070678_1007328091 | 215 |
| 159 | 3300005539 | Ga0068853_100043268 | Ga0068853_1000432684 | 215 |
| 160 | 3300005548 | Ga0070665_100002665 | Ga0070665_10000266518 | 215 |
| 161 | 3300005617 | Ga0068859_100059900 | Ga0068859_1000599002 | 215 |
| 162 | 3300005841 | Ga0068863_100000621 | Ga0068863_1000006215 | 215 |
| 163 | 3300005841 | Ga0068863_100407907 | Ga0068863_1004079073 | 215 |
| 164 | 3300005842 | Ga0068858_100013740 | Ga0068858_1000137404 | 215 |
| 165 | 3300005843 | Ga0068860_100000020 | Ga0068860_10000002046 | 215 |
| 166 | 3300005844 | Ga0068862_100000013 | Ga0068862_10000001328 | 215 |
| 167 | 3300005981 | Ga0081538_10057642 | Ga0081538_100576422 | 215 |
| 168 | 3300006028 | Ga0070717_10102191 | Ga0070717_101021913 | 215 |
| 169 | 3300006038 | Ga0075365_10007302 | Ga0075365_100073024 | 215 |
| 170 | 3300006051 | Ga0075364_10073739 | Ga0075364_100737392 | 215 |
| 171 | 3300006178 | Ga0075367_10033423 | Ga0075367_100334232 | 215 |
| 172 | 3300006186 | Ga0075369_10009883 | Ga0075369_100098832 | 215 |
| 173 | 3300006186 | Ga0075369_10014091 | Ga0075369_100140912 | 215 |
| 174 | 3300006186 | Ga0075369_10021331 | Ga0075369_100213314 | 215 |
| 175 | 3300006931 | Ga0097620_100059895 | Ga0097620_1000598952 | 215 |
| 176 | 3300009098 | Ga0105245_10993997 | Ga0105245_109939971 | 215 |
| 177 | 3300009101 | Ga0105247_10000009 | Ga0105247_10000009145 | 215 |
| 178 | 3300009148 | Ga0105243_10509579 | Ga0105243_105095791 | 215 |
| 179 | 3300009177 | Ga0105248_10000109 | Ga0105248_1000010928 | 215 |
| 180 | 3300009177 | Ga0105248_10048242 | Ga0105248_100482422 | 215 |
| 181 | 3300009545 | Ga0105237_10000587 | Ga0105237_1000058743 | 215 |
| 182 | 3300009545 | Ga0105237_10016819 | Ga0105237_100168192 | 215 |
| 183 | 3300009553 | Ga0105249_10000011 | Ga0105249_1000001170 | 215 |
| 184 | 3300009553 | Ga0105249_10750533 | Ga0105249_107505332 | 215 |
| 185 | 3300010375 | Ga0105239_10011860 | Ga0105239_100118608 | 215 |
| 186 | 3300010375 | Ga0105239_10017470 | Ga0105239_100174707 | 215 |
| 187 | 3300011119 | Ga0105246_10273986 | Ga0105246_102739862 | 215 |
| 188 | 3300013306 | Ga0163162_10086089 | Ga0163162_100860893 | 215 |
| 189 | 3300013308 | Ga0157375_10136305 | Ga0157375_101363054 | 215 |
| 190 | 3300014325 | Ga0163163_10006691 | Ga0163163_100066912 | 215 |
| 191 | 3300014968 | Ga0157379_10122984 | Ga0157379_101229842 | 215 |
| 192 | 3300014969 | Ga0157376_10303248 | Ga0157376_103032483 | 215 |
| 193 | 3300025303 | Ga0209051_1000333 | Ga0209051_100033321 | 215 |
| 194 | 3300025303 | Ga0209051_1000520 | Ga0209051_100052041 | 215 |
| 195 | 3300025303 | Ga0209051_1000717 | Ga0209051_100071735 | 215 |
| 196 | 3300025303 | Ga0209051_1031282 | Ga0209051_10312822 | 215 |
| 197 | 3300025303 | Ga0209051_1081288 | Ga0209051_10812881 | 215 |
| 198 | 3300025898 | Ga0207692_10081045 | Ga0207692_100810452 | 215 |
| 199 | 3300025900 | Ga0207710_10000014 | Ga0207710_10000014162 | 215 |
| 200 | 3300025903 | Ga0207680_10070547 | Ga0207680_100705472 | 215 |
| 201 | 3300025904 | Ga0207647_10170793 | Ga0207647_101707932 | 215 |
| 202 | 3300025906 | Ga0207699_10054119 | Ga0207699_100541192 | 215 |
| 203 | 3300025914 | Ga0207671_10066155 | Ga0207671_100661554 | 215 |
| 204 | 3300025914 | Ga0207671_10113907 | Ga0207671_101139072 | 215 |
| 205 | 3300025923 | Ga0207681_10051810 | Ga0207681_100518102 | 215 |
| 206 | 3300025928 | Ga0207700_10142567 | Ga0207700_101425672 | 215 |
| 207 | 3300025929 | Ga0207664_10779292 | Ga0207664_107792921 | 215 |
| 208 | 3300025941 | Ga0207711_10000322 | Ga0207711_1000032228 | 215 |
| 209 | 3300025941 | Ga0207711_10127926 | Ga0207711_101279263 | 215 |
| 210 | 3300025961 | Ga0207712_10000020 | Ga0207712_10000020209 | 215 |
| 211 | 3300025972 | Ga0207668_10003993 | Ga0207668_100039936 | 215 |
| 212 | 3300025972 | Ga0207668_10286561 | Ga0207668_102865611 | 215 |
| 213 | 3300025986 | Ga0207658_10000055 | Ga0207658_1000005546 | 215 |
| 214 | 3300025986 | Ga0207658_10001485 | Ga0207658_100014859 | 215 |
| 215 | 3300026035 | Ga0207703_10009452 | Ga0207703_100094525 | 215 |
| 216 | 3300026041 | Ga0207639_10072670 | Ga0207639_100726702 | 215 |
| 217 | 3300026067 | Ga0207678_10359287 | Ga0207678_103592872 | 215 |
| 218 | 3300026088 | Ga0207641_10003088 | Ga0207641_100030885 | 215 |
| 219 | 3300028379 | Ga0268266_10081328 | Ga0268266_100813282 | 215 |
| 220 | 3300028380 | Ga0268265_10000004 | Ga0268265_10000004224 | 215 |
| 221 | 3300028381 | Ga0268264_10000024 | Ga0268264_10000024226 | 215 |
| 222 | 3300031251 | Ga0265327_10000964 | Ga0265327_1000096416 | 215 |
| 223 | 3300031251 | Ga0265327_10028389 | Ga0265327_100283892 | 215 |
| 224 | 3300031824 | Ga0307413_10392857 | Ga0307413_103928572 | 215 |
| 225 | 3300031852 | Ga0307410_10069603 | Ga0307410_100696032 | 215 |
| 226 | 3300032002 | Ga0307416_100074799 | Ga0307416_1000747992 | 215 |
| 227 | 3300032002 | Ga0307416_100645697 | Ga0307416_1006456972 | 215 |
| 228 | 3300036712 | Ga0316584_0138875 | Ga0316584_0138875_1016_1663 | 215 |
| 229 | 3300039450 | Ga0436363_0146676 | Ga0436363_0146676_559_1275 | 215 |
| 230 | 3300041494 | Ga0451837_1099642 | Ga0451837_1099642_153_800 | 215 |
| 231 | 3300044658 | Ga0466972_0016979 | Ga0466972_0016979_2089_2736 | 215 |
| 232 | 3300044735 | Ga0466968_0001467 | Ga0466968_0001467_4539_5186 | 215 |
| 233 | 3300044842 | Ga0466957_0006319 | Ga0466957_0006319_2331_2978 | 215 |
| 234 | 3300044901 | Ga0466960_0000254 | Ga0466960_0000254_336_983 | 215 |
| 235 | 3300045049 | Ga0466959_0097113 | Ga0466959_0097113_150_797 | 215 |
| 236 | 3300045976 | Ga0466967_0018811 | Ga0466967_0018811_3616_4263 | 215 |
| 237 | 3300046460 | Ga0495638_0001425 | Ga0495638_0001425_6778_7530 | 215 |
| 238 | 3300046460 | Ga0495638_0016648 | Ga0495638_0016648_2135_2887 | 215 |
| 239 | 3300046460 | Ga0495638_0022263 | Ga0495638_0022263_555_1202 | 215 |
| 240 | 3300046507 | Ga0495606_0012168 | Ga0495606_0012168_2397_3044 | 215 |
| 241 | 3300046524 | Ga0495648_0006285 | Ga0495648_0006285_1710_2357 | 215 |
| 242 | 3300046616 | Ga0495668_0030531 | Ga0495668_0030531_1957_2604 | 215 |
| 243 | 3300046648 | Ga0495611_0030198 | Ga0495611_0030198_64_711 | 215 |
| 244 | 3300046660 | Ga0495625_0086223 | Ga0495625_0086223_444_1196 | 215 |
| 245 | 3300046660 | Ga0495625_0512166 | Ga0495625_0512166_55_702 | 215 |
| 246 | 3300047320 | Ga0495672_0009344 | Ga0495672_0009344_2681_3328 | 215 |
| 247 | 3300047469 | Ga0495673_0007756 | Ga0495673_0007756_2143_2790 | 215 |
| 248 | 3300048903 | Ga0496100_0000111 | Ga0496100_0000111_33891_34538 | 215 |
| 249 | 3300048903 | Ga0496100_0000406 | Ga0496100_0000406_19612_20364 | 215 |
| 250 | 3300048903 | Ga0496100_0024790 | Ga0496100_0024790_2766_3413 | 215 |
| 251 | 3300048904 | Ga0496101_0000091 | Ga0496101_0000091_29571_30323 | 215 |
| 252 | 3300048904 | Ga0496101_0000103 | Ga0496101_0000103_36796_37443 | 215 |
| 253 | 3300048904 | Ga0496101_0007249 | Ga0496101_0007249_211_858 | 215 |
| 254 | 3300048904 | Ga0496101_0010006 | Ga0496101_0010006_4896_5648 | 215 |
| 255 | 3300048905 | Ga0496102_0000016 | Ga0496102_0000016_225262_226014 | 215 |
| 256 | 3300048905 | Ga0496102_0000451 | Ga0496102_0000451_7500_8147 | 215 |
| 257 | 3300048905 | Ga0496102_0082914 | Ga0496102_0082914_1269_1916 | 215 |
| 258 | 3300048906 | Ga0496103_0000015 | Ga0496103_0000015_60761_61513 | 215 |
| 259 | 3300048906 | Ga0496103_0001793 | Ga0496103_0001793_7596_8243 | 215 |
| 260 | 3300048906 | Ga0496103_0007217 | Ga0496103_0007217_3269_3916 | 215 |
| 261 | 3300048907 | Ga0496104_0898994 | Ga0496104_0898994_98_745 | 215 |
| 262 | 3300048908 | Ga0496105_0078328 | Ga0496105_0078328_1427_2179 | 215 |
| 263 | 3300048908 | Ga0496105_0138269 | Ga0496105_0138269_944_1696 | 215 |
| 264 | 3300048909 | Ga0496106_0005443 | Ga0496106_0005443_1014_1661 | 215 |
| 265 | 3300048909 | Ga0496106_0021401 | Ga0496106_0021401_3653_4405 | 215 |
| 266 | 3300048910 | Ga0496107_0008519 | Ga0496107_0008519_2662_3309 | 215 |
| 267 | 3300048910 | Ga0496107_0010233 | Ga0496107_0010233_5199_5951 | 215 |
| 268 | 3300048911 | Ga0496108_0003194 | Ga0496108_0003194_7274_7921 | 215 |
| 269 | 3300048911 | Ga0496108_0289633 | Ga0496108_0289633_268_1020 | 215 |
| 270 | 3300048912 | Ga0496109_0000562 | Ga0496109_0000562_10528_11175 | 215 |
| 271 | 3300048913 | Ga0496110_0024078 | Ga0496110_0024078_3666_4313 | 215 |
| 272 | 3300048916 | Ga0496113_0075998 | Ga0496113_0075998_35_682 | 215 |
| 273 | 3300048917 | Ga0496114_0005368 | Ga0496114_0005368_7603_8355 | 215 |
| 274 | 3300048917 | Ga0496114_0276246 | Ga0496114_0276246_35_682 | 215 |
| 275 | 3300048918 | Ga0496115_0045816 | Ga0496115_0045816_492_1244 | 215 |
| 276 | 3300048918 | Ga0496115_0051265 | Ga0496115_0051265_1780_2427 | 215 |
| 277 | 3300048918 | Ga0496115_0238309 | Ga0496115_0238309_578_1225 | 215 |
| 278 | 3300048919 | Ga0496116_0000055 | Ga0496116_0000055_60948_61700 | 215 |
| 279 | 3300048919 | Ga0496116_0017473 | Ga0496116_0017473_24_671 | 215 |
| 280 | 3300048919 | Ga0496116_0018185 | Ga0496116_0018185_2679_3326 | 215 |
| 281 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_696895_697647 | 215 |
| 282 | 3300048920 | Ga0496117_0000280 | Ga0496117_0000280_11875_12522 | 215 |
| 283 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_696895_697647 | 215 |
| 284 | 3300048921 | Ga0496118_0010921 | Ga0496118_0010921_889_1536 | 215 |
| 285 | 3300048922 | Ga0496119_0004681 | Ga0496119_0004681_11698_12345 | 215 |
| 286 | 3300048922 | Ga0496119_0016780 | Ga0496119_0016780_3819_4571 | 215 |
| 287 | 3300048922 | Ga0496119_0077816 | Ga0496119_0077816_806_1453 | 215 |
| 288 | 3300048923 | Ga0496120_0000272 | Ga0496120_0000272_29896_30648 | 215 |
| 289 | 3300048923 | Ga0496120_0003889 | Ga0496120_0003889_6407_7054 | 215 |
| 290 | 3300048923 | Ga0496120_0015574 | Ga0496120_0015574_2044_2691 | 215 |
| 291 | 3300048923 | Ga0496120_0166763 | Ga0496120_0166763_270_923 | 215 |
| 292 | 3300048924 | Ga0496121_0000134 | Ga0496121_0000134_113891_114538 | 215 |
| 293 | 3300048924 | Ga0496121_0000331 | Ga0496121_0000331_72966_73718 | 215 |
| 294 | 3300048924 | Ga0496121_0001052 | Ga0496121_0001052_37001_37648 | 215 |
| 295 | 3300048924 | Ga0496121_0375458 | Ga0496121_0375458_208_855 | 215 |
| 296 | 3300048925 | Ga0496122_0000453 | Ga0496122_0000453_33261_33908 | 215 |
| 297 | 3300048925 | Ga0496122_0287503 | Ga0496122_0287503_200_847 | 215 |
| 298 | 3300048926 | Ga0496123_0011572 | Ga0496123_0011572_4724_5371 | 215 |
| 299 | 3300048927 | Ga0496124_0000113 | Ga0496124_0000113_51191_51838 | 215 |
| 300 | 3300048927 | Ga0496124_0007312 | Ga0496124_0007312_2074_2721 | 215 |
| 301 | 3300048927 | Ga0496124_0019870 | Ga0496124_0019870_470_1117 | 215 |
| 302 | 3300048928 | Ga0496125_0000127 | Ga0496125_0000127_113873_114520 | 215 |
| 303 | 3300048928 | Ga0496125_0269324 | Ga0496125_0269324_22_669 | 215 |
| 304 | 3300048929 | Ga0496126_0000140 | Ga0496126_0000140_51191_51838 | 215 |
| 305 | 3300048929 | Ga0496126_0000675 | Ga0496126_0000675_28455_29207 | 215 |
| 306 | 3300048929 | Ga0496126_0016629 | Ga0496126_0016629_1193_1840 | 215 |
| 307 | 3300048929 | Ga0496126_0467960 | Ga0496126_0467960_221_868 | 215 |
| 308 | 3300049568 | Ga0501031_0468258 | Ga0501031_0468258_67_774 | 215 |
| 309 | 3300049570 | Ga0501033_0051666 | Ga0501033_0051666_875_1582 | 215 |
| 310 | 3300049571 | Ga0501034_0122633 | Ga0501034_0122633_139_846 | 215 |
| 311 | 3300049580 | Ga0501046_0177183 | Ga0501046_0177183_661_1368 | 215 |
| 312 | 3300049581 | Ga0501047_0029682 | Ga0501047_0029682_3880_4587 | 215 |
| 313 | 3300049822 | Ga0501035_0005039 | Ga0501035_0005039_2444_3151 | 215 |
| 314 | 3300049823 | Ga0501044_0000150 | Ga0501044_0000150_76160_76867 | 215 |
| 315 | 3300049823 | Ga0501044_0205321 | Ga0501044_0205321_39_866 | 215 |
| 316 | 3300050490 | nmdc:mga03n38_18459_c1 | nmdc:mga03n38_18459_c1_2081_2728 | 215 |
| 317 | 3300050491 | nmdc:mga00v17_105056_c1 | nmdc:mga00v17_105056_c1_785_1522 | 215 |
| 318 | 3300050492 | nmdc:mga0yw44_11615_c1 | nmdc:mga0yw44_11615_c1_3753_4400 | 215 |
| 319 | 3300050494 | nmdc:mga06z11_48663_c1 | nmdc:mga06z11_48663_c1_916_1563 | 215 |
| 320 | 3300050496 | nmdc:mga07m45_110204_c1 | nmdc:mga07m45_110204_c1_67_714 | 215 |
| 321 | 3300050496 | nmdc:mga07m45_147162_c1 | nmdc:mga07m45_147162_c1_248_898 | 215 |
| 322 | 3300050511 | nmdc:mga08y16_913761_c1 | nmdc:mga08y16_913761_c1_73_720 | 215 |
| 323 | 3300050516 | nmdc:mga0sz30_14241_c1 | nmdc:mga0sz30_14241_c1_2330_2977 | 215 |
| 324 | 3300050516 | nmdc:mga0sz30_39939_c1 | nmdc:mga0sz30_39939_c1_202_873 | 215 |
| 325 | 3300053079 | Ga0500610_0009568 | Ga0500610_0009568_531_1283 | 215 |
| 326 | 3300053087 | Ga0500643_000986 | Ga0500643_000986_13491_14138 | 215 |
| 327 | 3300053131 | Ga0500652_001168 | Ga0500652_001168_5045_5692 | 215 |
| 328 | 3300053136 | Ga0500559_0177783 | Ga0500559_0177783_68_715 | 215 |
| 329 | 3300053142 | Ga0500577_0004330 | Ga0500577_0004330_677_1327 | 215 |
| 330 | 3300053146 | Ga0500588_0045998 | Ga0500588_0045998_102_749 | 215 |
| 331 | 3300053153 | Ga0500616_0007595 | Ga0500616_0007595_328_975 | 215 |
| 332 | 3300053153 | Ga0500616_0035258 | Ga0500616_0035258_179_931 | 215 |
| 333 | 3300053158 | Ga0500627_0010700 | Ga0500627_0010700_2421_3068 | 215 |
| 334 | 3300053730 | Ga0500645_000007 | Ga0500645_000007_77925_78572 | 215 |
| 335 | 3300053730 | Ga0500645_059016 | Ga0500645_059016_223_870 | 215 |
| 336 | iso_pu_bacteria | 2902810491 | 2902813654 | 215 |
| 337 | iso_pu_bacteria | 8056060235 | 8056064116 | 215 |
| 338 | 3300001977 | JGI24746J21847_1008506 | JGI24746J21847_10085062 | 216 |
| 339 | 3300001989 | JGI24739J22299_10040638 | JGI24739J22299_100406382 | 216 |
| 340 | 3300001991 | JGI24743J22301_10009379 | JGI24743J22301_100093792 | 216 |
| 341 | 3300001991 | JGI24743J22301_10012875 | JGI24743J22301_100128752 | 216 |
| 342 | 3300002070 | JGI24750J21931_1005879 | JGI24750J21931_10058792 | 216 |
| 343 | 3300002073 | JGI24745J21846_1018384 | JGI24745J21846_10183841 | 216 |
| 344 | 3300002074 | JGI24748J21848_1004048 | JGI24748J21848_10040481 | 216 |
| 345 | 3300002075 | JGI24738J21930_10013664 | JGI24738J21930_100136642 | 216 |
| 346 | 3300002077 | JGI24744J21845_10005407 | JGI24744J21845_100054073 | 216 |
| 347 | 3300002077 | JGI24744J21845_10015152 | JGI24744J21845_100151522 | 216 |
| 348 | 3300002239 | JGI24034J26672_10001864 | JGI24034J26672_100018642 | 216 |
| 349 | 3300002244 | JGI24742J22300_10002085 | JGI24742J22300_100020853 | 216 |
| 350 | 3300005328 | Ga0070676_10010895 | Ga0070676_100108952 | 216 |
| 351 | 3300005330 | Ga0070690_100001081 | Ga0070690_10000108118 | 216 |
| 352 | 3300005334 | Ga0068869_100028484 | Ga0068869_1000284843 | 216 |
| 353 | 3300005335 | Ga0070666_10053870 | Ga0070666_100538702 | 216 |
| 354 | 3300005337 | Ga0070682_100006705 | Ga0070682_1000067052 | 216 |
| 355 | 3300005337 | Ga0070682_100128683 | Ga0070682_1001286832 | 216 |
| 356 | 3300005338 | Ga0068868_100002489 | Ga0068868_1000024894 | 216 |
| 357 | 3300005338 | Ga0068868_100068933 | Ga0068868_1000689333 | 216 |
| 358 | 3300005338 | Ga0068868_100288064 | Ga0068868_1002880641 | 216 |
| 359 | 3300005339 | Ga0070660_100109163 | Ga0070660_1001091632 | 216 |
| 360 | 3300005339 | Ga0070660_100673765 | Ga0070660_1006737651 | 216 |
| 361 | 3300005340 | Ga0070689_100007750 | Ga0070689_1000077504 | 216 |
| 362 | 3300005341 | Ga0070691_10011741 | Ga0070691_100117412 | 216 |
| 363 | 3300005341 | Ga0070691_10107500 | Ga0070691_101075002 | 216 |
| 364 | 3300005343 | Ga0070687_100027796 | Ga0070687_1000277963 | 216 |
| 365 | 3300005345 | Ga0070692_10058134 | Ga0070692_100581341 | 216 |
| 366 | 3300005345 | Ga0070692_10093407 | Ga0070692_100934072 | 216 |
| 367 | 3300005347 | Ga0070668_100085784 | Ga0070668_1000857842 | 216 |
| 368 | 3300005347 | Ga0070668_100261860 | Ga0070668_1002618602 | 216 |
| 369 | 3300005347 | Ga0070668_100572743 | Ga0070668_1005727432 | 216 |
| 370 | 3300005347 | Ga0070668_100770667 | Ga0070668_1007706671 | 216 |
| 371 | 3300005353 | Ga0070669_100006033 | Ga0070669_1000060334 | 216 |
| 372 | 3300005354 | Ga0070675_100118923 | Ga0070675_1001189233 | 216 |
| 373 | 3300005355 | Ga0070671_100096936 | Ga0070671_1000969363 | 216 |
| 374 | 3300005356 | Ga0070674_100001375 | Ga0070674_1000013757 | 216 |
| 375 | 3300005364 | Ga0070673_100238018 | Ga0070673_1002380182 | 216 |
| 376 | 3300005365 | Ga0070688_100006802 | Ga0070688_1000068023 | 216 |
| 377 | 3300005365 | Ga0070688_100039010 | Ga0070688_1000390103 | 216 |
| 378 | 3300005366 | Ga0070659_100081095 | Ga0070659_1000810953 | 216 |
| 379 | 3300005366 | Ga0070659_100196580 | Ga0070659_1001965802 | 216 |
| 380 | 3300005366 | Ga0070659_100280646 | Ga0070659_1002806461 | 216 |
| 381 | 3300005367 | Ga0070667_100002142 | Ga0070667_1000021422 | 216 |
| 382 | 3300005367 | Ga0070667_100003309 | Ga0070667_1000033097 | 216 |
| 383 | 3300005367 | Ga0070667_100553478 | Ga0070667_1005534782 | 216 |
| 384 | 3300005406 | Ga0070703_10125383 | Ga0070703_101253832 | 216 |
| 385 | 3300005434 | Ga0070709_10030195 | Ga0070709_100301953 | 216 |
| 386 | 3300005434 | Ga0070709_10039422 | Ga0070709_100394222 | 216 |
| 387 | 3300005437 | Ga0070710_10001686 | Ga0070710_100016863 | 216 |
| 388 | 3300005438 | Ga0070701_10036841 | Ga0070701_100368412 | 216 |
| 389 | 3300005438 | Ga0070701_10054527 | Ga0070701_100545272 | 216 |
| 390 | 3300005439 | Ga0070711_100000565 | Ga0070711_10000056517 | 216 |
| 391 | 3300005439 | Ga0070711_100067070 | Ga0070711_1000670702 | 216 |
| 392 | 3300005440 | Ga0070705_100005383 | Ga0070705_1000053833 | 216 |
| 393 | 3300005441 | Ga0070700_100001381 | Ga0070700_1000013817 | 216 |
| 394 | 3300005441 | Ga0070700_100075184 | Ga0070700_1000751843 | 216 |
| 395 | 3300005441 | Ga0070700_100083552 | Ga0070700_1000835522 | 216 |
| 396 | 3300005444 | Ga0070694_100007860 | Ga0070694_1000078604 | 216 |
| 397 | 3300005444 | Ga0070694_100227795 | Ga0070694_1002277951 | 216 |
| 398 | 3300005455 | Ga0070663_100003370 | Ga0070663_1000033707 | 216 |
| 399 | 3300005455 | Ga0070663_100072165 | Ga0070663_1000721653 | 216 |
| 400 | 3300005456 | Ga0070678_100001483 | Ga0070678_1000014833 | 216 |
| 401 | 3300005456 | Ga0070678_100062648 | Ga0070678_1000626482 | 216 |
| 402 | 3300005456 | Ga0070678_100450981 | Ga0070678_1004509811 | 216 |
| 403 | 3300005457 | Ga0070662_100004641 | Ga0070662_1000046413 | 216 |
| 404 | 3300005457 | Ga0070662_100218076 | Ga0070662_1002180762 | 216 |
| 405 | 3300005458 | Ga0070681_10382029 | Ga0070681_103820292 | 216 |
| 406 | 3300005459 | Ga0068867_100002757 | Ga0068867_10000275712 | 216 |
| 407 | 3300005459 | Ga0068867_100197911 | Ga0068867_1001979112 | 216 |
| 408 | 3300005459 | Ga0068867_100215438 | Ga0068867_1002154382 | 216 |
| 409 | 3300005466 | Ga0070685_10016055 | Ga0070685_100160554 | 216 |
| 410 | 3300005471 | Ga0070698_100726653 | Ga0070698_1007266531 | 216 |
| 411 | 3300005539 | Ga0068853_100003295 | Ga0068853_1000032955 | 216 |
| 412 | 3300005539 | Ga0068853_100075480 | Ga0068853_1000754802 | 216 |
| 413 | 3300005539 | Ga0068853_100545944 | Ga0068853_1005459442 | 216 |
| 414 | 3300005543 | Ga0070672_100037774 | Ga0070672_1000377743 | 216 |
| 415 | 3300005543 | Ga0070672_100278060 | Ga0070672_1002780602 | 216 |
| 416 | 3300005544 | Ga0070686_100028611 | Ga0070686_1000286112 | 216 |
| 417 | 3300005544 | Ga0070686_100070263 | Ga0070686_1000702632 | 216 |
| 418 | 3300005545 | Ga0070695_100008811 | Ga0070695_1000088112 | 216 |
| 419 | 3300005545 | Ga0070695_100074807 | Ga0070695_1000748072 | 216 |
| 420 | 3300005546 | Ga0070696_100013731 | Ga0070696_1000137313 | 216 |
| 421 | 3300005546 | Ga0070696_100048363 | Ga0070696_1000483631 | 216 |
| 422 | 3300005546 | Ga0070696_100180921 | Ga0070696_1001809212 | 216 |
| 423 | 3300005547 | Ga0070693_100028129 | Ga0070693_1000281292 | 216 |
| 424 | 3300005548 | Ga0070665_100047438 | Ga0070665_1000474383 | 216 |
| 425 | 3300005548 | Ga0070665_100958046 | Ga0070665_1009580461 | 216 |
| 426 | 3300005549 | Ga0070704_100001549 | Ga0070704_1000015495 | 216 |
| 427 | 3300005549 | Ga0070704_100294060 | Ga0070704_1002940602 | 216 |
| 428 | 3300005578 | Ga0068854_100002581 | Ga0068854_1000025813 | 216 |
| 429 | 3300005578 | Ga0068854_100130145 | Ga0068854_1001301452 | 216 |
| 430 | 3300005578 | Ga0068854_100132508 | Ga0068854_1001325082 | 216 |
| 431 | 3300005578 | Ga0068854_100301191 | Ga0068854_1003011912 | 216 |
| 432 | 3300005614 | Ga0068856_100715258 | Ga0068856_1007152582 | 216 |
| 433 | 3300005615 | Ga0070702_100000718 | Ga0070702_1000007187 | 216 |
| 434 | 3300005615 | Ga0070702_100241439 | Ga0070702_1002414391 | 216 |
| 435 | 3300005616 | Ga0068852_100058714 | Ga0068852_1000587144 | 216 |
| 436 | 3300005616 | Ga0068852_100093560 | Ga0068852_1000935602 | 216 |
| 437 | 3300005617 | Ga0068859_100014976 | Ga0068859_1000149768 | 216 |
| 438 | 3300005618 | Ga0068864_100180114 | Ga0068864_1001801142 | 216 |
| 439 | 3300005618 | Ga0068864_100185266 | Ga0068864_1001852662 | 216 |
| 440 | 3300005718 | Ga0068866_10002610 | Ga0068866_100026104 | 216 |
| 441 | 3300005719 | Ga0068861_100002207 | Ga0068861_1000022076 | 216 |
| 442 | 3300005719 | Ga0068861_100112024 | Ga0068861_1001120242 | 216 |
| 443 | 3300005834 | Ga0068851_10377681 | Ga0068851_103776811 | 216 |
| 444 | 3300005841 | Ga0068863_100017418 | Ga0068863_1000174182 | 216 |
| 445 | 3300005842 | Ga0068858_100010321 | Ga0068858_1000103216 | 216 |
| 446 | 3300005842 | Ga0068858_100015049 | Ga0068858_1000150499 | 216 |
| 447 | 3300005843 | Ga0068860_100007201 | Ga0068860_1000072018 | 216 |
| 448 | 3300005844 | Ga0068862_100004925 | Ga0068862_1000049258 | 216 |
| 449 | 3300005844 | Ga0068862_100124656 | Ga0068862_1001246563 | 216 |
| 450 | 3300005844 | Ga0068862_100228862 | Ga0068862_1002288622 | 216 |
| 451 | 3300005844 | Ga0068862_100544952 | Ga0068862_1005449521 | 216 |
| 452 | 3300005937 | Ga0081455_10041106 | Ga0081455_100411063 | 216 |
| 453 | 3300005937 | Ga0081455_10093898 | Ga0081455_100938982 | 216 |
| 454 | 3300005937 | Ga0081455_10144366 | Ga0081455_101443662 | 216 |
| 455 | 3300006038 | Ga0075365_10020404 | Ga0075365_100204042 | 216 |
| 456 | 3300006048 | Ga0075363_100000818 | Ga0075363_1000008184 | 216 |
| 457 | 3300006048 | Ga0075363_100036777 | Ga0075363_1000367773 | 216 |
| 458 | 3300006048 | Ga0075363_100065254 | Ga0075363_1000652543 | 216 |
| 459 | 3300006051 | Ga0075364_10007304 | Ga0075364_100073044 | 216 |
| 460 | 3300006051 | Ga0075364_10007949 | Ga0075364_100079494 | 216 |
| 461 | 3300006051 | Ga0075364_10027223 | Ga0075364_100272234 | 216 |
| 462 | 3300006163 | Ga0070715_10001443 | Ga0070715_100014432 | 216 |
| 463 | 3300006163 | Ga0070715_10024140 | Ga0070715_100241402 | 216 |
| 464 | 3300006173 | Ga0070716_100002440 | Ga0070716_1000024406 | 216 |
| 465 | 3300006175 | Ga0070712_100001326 | Ga0070712_10000132619 | 216 |
| 466 | 3300006186 | Ga0075369_10001462 | Ga0075369_100014627 | 216 |
| 467 | 3300006186 | Ga0075369_10002699 | Ga0075369_100026997 | 216 |
| 468 | 3300006186 | Ga0075369_10003020 | Ga0075369_100030206 | 216 |
| 469 | 3300006186 | Ga0075369_10023389 | Ga0075369_100233891 | 216 |
| 470 | 3300006186 | Ga0075369_10063762 | Ga0075369_100637622 | 216 |
| 471 | 3300006186 | Ga0075369_10103156 | Ga0075369_101031561 | 216 |
| 472 | 3300006237 | Ga0097621_100175782 | Ga0097621_1001757822 | 216 |
| 473 | 3300006353 | Ga0075370_10009696 | Ga0075370_100096962 | 216 |
| 474 | 3300006353 | Ga0075370_10131799 | Ga0075370_101317992 | 216 |
| 475 | 3300006353 | Ga0075370_10186266 | Ga0075370_101862662 | 216 |
| 476 | 3300006358 | Ga0068871_100160944 | Ga0068871_1001609442 | 216 |
| 477 | 3300006844 | Ga0075428_100010758 | Ga0075428_1000107586 | 216 |
| 478 | 3300006846 | Ga0075430_100103300 | Ga0075430_1001033003 | 216 |
| 479 | 3300006847 | Ga0075431_100045559 | Ga0075431_1000455594 | 216 |
| 480 | 3300006881 | Ga0068865_100001748 | Ga0068865_1000017486 | 216 |
| 481 | 3300006881 | Ga0068865_100492297 | Ga0068865_1004922972 | 216 |
| 482 | 3300006931 | Ga0097620_100014976 | Ga0097620_1000149762 | 216 |
| 483 | 3300009036 | Ga0105244_10192652 | Ga0105244_101926521 | 216 |
| 484 | 3300009092 | Ga0105250_10012038 | Ga0105250_100120382 | 216 |
| 485 | 3300009093 | Ga0105240_10512553 | Ga0105240_105125532 | 216 |
| 486 | 3300009093 | Ga0105240_10532185 | Ga0105240_105321852 | 216 |
| 487 | 3300009098 | Ga0105245_10004631 | Ga0105245_100046318 | 216 |
| 488 | 3300009098 | Ga0105245_10151001 | Ga0105245_101510012 | 216 |
| 489 | 3300009098 | Ga0105245_10176031 | Ga0105245_101760311 | 216 |
| 490 | 3300009101 | Ga0105247_10001964 | Ga0105247_100019646 | 216 |
| 491 | 3300009101 | Ga0105247_10054015 | Ga0105247_100540152 | 216 |
| 492 | 3300009101 | Ga0105247_10109332 | Ga0105247_101093323 | 216 |
| 493 | 3300009147 | Ga0114129_10008093 | Ga0114129_100080936 | 216 |
| 494 | 3300009148 | Ga0105243_10003417 | Ga0105243_100034177 | 216 |
| 495 | 3300009148 | Ga0105243_10190098 | Ga0105243_101900982 | 216 |
| 496 | 3300009148 | Ga0105243_10238929 | Ga0105243_102389292 | 216 |
| 497 | 3300009148 | Ga0105243_10286244 | Ga0105243_102862441 | 216 |
| 498 | 3300009174 | Ga0105241_10381362 | Ga0105241_103813622 | 216 |
| 499 | 3300009176 | Ga0105242_10003784 | Ga0105242_100037847 | 216 |
| 500 | 3300009177 | Ga0105248_10032558 | Ga0105248_100325583 | 216 |
| 501 | 3300009545 | Ga0105237_10015861 | Ga0105237_100158616 | 216 |
| 502 | 3300009551 | Ga0105238_10117062 | Ga0105238_101170621 | 216 |
| 503 | 3300009553 | Ga0105249_10004295 | Ga0105249_100042956 | 216 |
| 504 | 3300009553 | Ga0105249_10009857 | Ga0105249_100098577 | 216 |
| 505 | 3300009553 | Ga0105249_10880063 | Ga0105249_108800632 | 216 |
| 506 | 3300010375 | Ga0105239_10014224 | Ga0105239_100142248 | 216 |
| 507 | 3300010375 | Ga0105239_10276114 | Ga0105239_102761142 | 216 |
| 508 | 3300011119 | Ga0105246_10028692 | Ga0105246_100286922 | 216 |
| 509 | 3300013105 | Ga0157369_10124593 | Ga0157369_101245933 | 216 |
| 510 | 3300013297 | Ga0157378_10007770 | Ga0157378_100077707 | 216 |
| 511 | 3300013297 | Ga0157378_10101206 | Ga0157378_101012062 | 216 |
| 512 | 3300013306 | Ga0163162_10006354 | Ga0163162_100063546 | 216 |
| 513 | 3300013306 | Ga0163162_10036414 | Ga0163162_100364142 | 216 |
| 514 | 3300013306 | Ga0163162_10116251 | Ga0163162_101162513 | 216 |
| 515 | 3300013307 | Ga0157372_10014607 | Ga0157372_100146073 | 216 |
| 516 | 3300013307 | Ga0157372_10459439 | Ga0157372_104594391 | 216 |
| 517 | 3300013308 | Ga0157375_10004095 | Ga0157375_100040956 | 216 |
| 518 | 3300013308 | Ga0157375_10089136 | Ga0157375_100891361 | 216 |
| 519 | 3300014325 | Ga0163163_10072929 | Ga0163163_100729292 | 216 |
| 520 | 3300014325 | Ga0163163_10079613 | Ga0163163_100796132 | 216 |
| 521 | 3300014325 | Ga0163163_10742761 | Ga0163163_107427612 | 216 |
| 522 | 3300014326 | Ga0157380_10006086 | Ga0157380_100060864 | 216 |
| 523 | 3300014326 | Ga0157380_10121602 | Ga0157380_101216022 | 216 |
| 524 | 3300014745 | Ga0157377_10052204 | Ga0157377_100522042 | 216 |
| 525 | 3300014745 | Ga0157377_10052590 | Ga0157377_100525902 | 216 |
| 526 | 3300014968 | Ga0157379_10003994 | Ga0157379_100039947 | 216 |
| 527 | 3300014968 | Ga0157379_10587575 | Ga0157379_105875752 | 216 |
| 528 | 3300017792 | Ga0163161_10002738 | Ga0163161_100027388 | 216 |
| 529 | 3300017792 | Ga0163161_10091399 | Ga0163161_100913992 | 216 |
| 530 | 3300021384 | Ga0213876_10040018 | Ga0213876_100400181 | 216 |
| 531 | 3300021384 | Ga0213876_10177785 | Ga0213876_101777851 | 216 |
| 532 | 3300021388 | Ga0213875_10002710 | Ga0213875_100027104 | 216 |
| 533 | 3300025321 | Ga0207656_10258647 | Ga0207656_102586472 | 216 |
| 534 | 3300025898 | Ga0207692_10002807 | Ga0207692_100028075 | 216 |
| 535 | 3300025899 | Ga0207642_10000103 | Ga0207642_1000010313 | 216 |
| 536 | 3300025900 | Ga0207710_10004537 | Ga0207710_100045372 | 216 |
| 537 | 3300025901 | Ga0207688_10001724 | Ga0207688_100017247 | 216 |
| 538 | 3300025901 | Ga0207688_10004440 | Ga0207688_100044408 | 216 |
| 539 | 3300025901 | Ga0207688_10007439 | Ga0207688_100074394 | 216 |
| 540 | 3300025901 | Ga0207688_10118469 | Ga0207688_101184692 | 216 |
| 541 | 3300025904 | Ga0207647_10079356 | Ga0207647_100793563 | 216 |
| 542 | 3300025904 | Ga0207647_10099876 | Ga0207647_100998762 | 216 |
| 543 | 3300025905 | Ga0207685_10043018 | Ga0207685_100430182 | 216 |
| 544 | 3300025906 | Ga0207699_10060788 | Ga0207699_100607882 | 216 |
| 545 | 3300025907 | Ga0207645_10016541 | Ga0207645_100165413 | 216 |
| 546 | 3300025907 | Ga0207645_10028640 | Ga0207645_100286402 | 216 |
| 547 | 3300025911 | Ga0207654_10256097 | Ga0207654_102560972 | 216 |
| 548 | 3300025913 | Ga0207695_10272319 | Ga0207695_102723193 | 216 |
| 549 | 3300025914 | Ga0207671_10119898 | Ga0207671_101198982 | 216 |
| 550 | 3300025915 | Ga0207693_10003311 | Ga0207693_100033114 | 216 |
| 551 | 3300025915 | Ga0207693_10120569 | Ga0207693_101205691 | 216 |
| 552 | 3300025915 | Ga0207693_10328042 | Ga0207693_103280421 | 216 |
| 553 | 3300025915 | Ga0207693_10457059 | Ga0207693_104570591 | 216 |
| 554 | 3300025916 | Ga0207663_10000981 | Ga0207663_1000098113 | 216 |
| 555 | 3300025916 | Ga0207663_10071733 | Ga0207663_100717333 | 216 |
| 556 | 3300025918 | Ga0207662_10017713 | Ga0207662_100177134 | 216 |
| 557 | 3300025918 | Ga0207662_10225409 | Ga0207662_102254092 | 216 |
| 558 | 3300025919 | Ga0207657_10240840 | Ga0207657_102408402 | 216 |
| 559 | 3300025919 | Ga0207657_10258820 | Ga0207657_102588202 | 216 |
| 560 | 3300025923 | Ga0207681_10005669 | Ga0207681_100056696 | 216 |
| 561 | 3300025926 | Ga0207659_10249947 | Ga0207659_102499472 | 216 |
| 562 | 3300025927 | Ga0207687_10002874 | Ga0207687_100028744 | 216 |
| 563 | 3300025927 | Ga0207687_10066920 | Ga0207687_100669203 | 216 |
| 564 | 3300025927 | Ga0207687_10417739 | Ga0207687_104177391 | 216 |
| 565 | 3300025929 | Ga0207664_10138195 | Ga0207664_101381953 | 216 |
| 566 | 3300025931 | Ga0207644_10041414 | Ga0207644_100414143 | 216 |
| 567 | 3300025932 | Ga0207690_10373009 | Ga0207690_103730092 | 216 |
| 568 | 3300025932 | Ga0207690_10389726 | Ga0207690_103897262 | 216 |
| 569 | 3300025933 | Ga0207706_10010422 | Ga0207706_100104225 | 216 |
| 570 | 3300025933 | Ga0207706_10039924 | Ga0207706_100399244 | 216 |
| 571 | 3300025933 | Ga0207706_10054717 | Ga0207706_100547173 | 216 |
| 572 | 3300025934 | Ga0207686_10001839 | Ga0207686_100018394 | 216 |
| 573 | 3300025935 | Ga0207709_10007208 | Ga0207709_100072084 | 216 |
| 574 | 3300025935 | Ga0207709_10064704 | Ga0207709_100647042 | 216 |
| 575 | 3300025936 | Ga0207670_10070046 | Ga0207670_100700462 | 216 |
| 576 | 3300025937 | Ga0207669_10000215 | Ga0207669_100002154 | 216 |
| 577 | 3300025938 | Ga0207704_10000580 | Ga0207704_100005803 | 216 |
| 578 | 3300025939 | Ga0207665_10002002 | Ga0207665_1000200213 | 216 |
| 579 | 3300025940 | Ga0207691_10037577 | Ga0207691_100375774 | 216 |
| 580 | 3300025941 | Ga0207711_10008630 | Ga0207711_100086305 | 216 |
| 581 | 3300025942 | Ga0207689_10014414 | Ga0207689_100144142 | 216 |
| 582 | 3300025949 | Ga0207667_10120130 | Ga0207667_101201302 | 216 |
| 583 | 3300025961 | Ga0207712_10013121 | Ga0207712_100131213 | 216 |
| 584 | 3300025961 | Ga0207712_10073455 | Ga0207712_100734552 | 216 |
| 585 | 3300025961 | Ga0207712_10126557 | Ga0207712_101265572 | 216 |
| 586 | 3300025972 | Ga0207668_10005510 | Ga0207668_100055102 | 216 |
| 587 | 3300025972 | Ga0207668_10117799 | Ga0207668_101177992 | 216 |
| 588 | 3300025981 | Ga0207640_10001964 | Ga0207640_100019643 | 216 |
| 589 | 3300025981 | Ga0207640_10093916 | Ga0207640_100939163 | 216 |
| 590 | 3300025986 | Ga0207658_10065842 | Ga0207658_100658423 | 216 |
| 591 | 3300025986 | Ga0207658_10511736 | Ga0207658_105117361 | 216 |
| 592 | 3300026023 | Ga0207677_10003911 | Ga0207677_100039116 | 216 |
| 593 | 3300026023 | Ga0207677_10044493 | Ga0207677_100444935 | 216 |
| 594 | 3300026035 | Ga0207703_10006323 | Ga0207703_100063233 | 216 |
| 595 | 3300026035 | Ga0207703_10426467 | Ga0207703_104264672 | 216 |
| 596 | 3300026041 | Ga0207639_10008988 | Ga0207639_100089884 | 216 |
| 597 | 3300026067 | Ga0207678_10013443 | Ga0207678_100134436 | 216 |
| 598 | 3300026067 | Ga0207678_10018721 | Ga0207678_100187214 | 216 |
| 599 | 3300026067 | Ga0207678_10100347 | Ga0207678_101003473 | 216 |
| 600 | 3300026075 | Ga0207708_10009940 | Ga0207708_100099403 | 216 |
| 601 | 3300026078 | Ga0207702_10651297 | Ga0207702_106512972 | 216 |
| 602 | 3300026088 | Ga0207641_10025442 | Ga0207641_100254425 | 216 |
| 603 | 3300026089 | Ga0207648_10006769 | Ga0207648_100067694 | 216 |
| 604 | 3300026089 | Ga0207648_10066765 | Ga0207648_100667653 | 216 |
| 605 | 3300026089 | Ga0207648_10082259 | Ga0207648_100822595 | 216 |
| 606 | 3300026095 | Ga0207676_10195416 | Ga0207676_101954162 | 216 |
| 607 | 3300026095 | Ga0207676_10635778 | Ga0207676_106357782 | 216 |
| 608 | 3300026118 | Ga0207675_100006306 | Ga0207675_1000063064 | 216 |
| 609 | 3300026118 | Ga0207675_100069950 | Ga0207675_1000699502 | 216 |
| 610 | 3300026118 | Ga0207675_100117272 | Ga0207675_1001172721 | 216 |
| 611 | 3300026118 | Ga0207675_100137667 | Ga0207675_1001376672 | 216 |
| 612 | 3300026121 | Ga0207683_10005026 | Ga0207683_100050264 | 216 |
| 613 | 3300026121 | Ga0207683_10053936 | Ga0207683_100539364 | 216 |
| 614 | 3300026121 | Ga0207683_10463984 | Ga0207683_104639842 | 216 |
| 615 | 3300026142 | Ga0207698_10039853 | Ga0207698_100398534 | 216 |
| 616 | 3300026142 | Ga0207698_10067945 | Ga0207698_100679453 | 216 |
| 617 | 3300026142 | Ga0207698_11092681 | Ga0207698_110926811 | 216 |
| 618 | 3300028379 | Ga0268266_10220964 | Ga0268266_102209642 | 216 |
| 619 | 3300028379 | Ga0268266_10692422 | Ga0268266_106924221 | 216 |
| 620 | 3300028380 | Ga0268265_10004893 | Ga0268265_100048932 | 216 |
| 621 | 3300028380 | Ga0268265_10464529 | Ga0268265_104645292 | 216 |
| 622 | 3300028381 | Ga0268264_10002682 | Ga0268264_100026823 | 216 |
| 623 | 3300031995 | Ga0307409_100007289 | Ga0307409_1000072896 | 216 |
| 624 | 3300032005 | Ga0307411_10065463 | Ga0307411_100654634 | 216 |
| 625 | 3300034820 | Ga0373959_0086204 | Ga0373959_0086204_12_677 | 216 |
| 626 | 3300035121 | Ga0373960_0172107 | Ga0373960_0172107_40_690 | 216 |
| 627 | 3300035207 | Ga0373942_0048997 | Ga0373942_0048997_517_1167 | 216 |
| 628 | 3300035242 | Ga0373962_0097281 | Ga0373962_0097281_77_727 | 216 |
| 629 | 3300035691 | Ga0373931_0013263 | Ga0373931_0013263_2027_2677 | 216 |
| 630 | 3300035691 | Ga0373931_0036656 | Ga0373931_0036656_287_952 | 216 |
| 631 | 3300037853 | Ga0436364_0988707 | Ga0436364_0988707_4370_5023 | 216 |
| 632 | 3300039437 | Ga0436365_0099441 | Ga0436365_0099441_2436_3107 | 216 |
| 633 | 3300039437 | Ga0436365_0114496 | Ga0436365_0114496_719_1372 | 216 |
| 634 | 3300039437 | Ga0436365_1318964 | Ga0436365_1318964_12288_12974 | 216 |
| 635 | 3300039450 | Ga0436363_1097219 | Ga0436363_1097219_710_1363 | 216 |
| 636 | 3300041460 | Ga0451802_1438524 | Ga0451802_1438524_113_763 | 216 |
| 637 | 3300044658 | Ga0466972_0036745 | Ga0466972_0036745_234_884 | 216 |
| 638 | 3300044683 | Ga0466965_0043644 | Ga0466965_0043644_966_1616 | 216 |
| 639 | 3300044901 | Ga0466960_0000148 | Ga0466960_0000148_10738_11388 | 216 |
| 640 | 3300045976 | Ga0466967_0024904 | Ga0466967_0024904_15_665 | 216 |
| 641 | 3300046455 | Ga0495603_0070641 | Ga0495603_0070641_1076_1729 | 216 |
| 642 | 3300046459 | Ga0495629_0016396 | Ga0495629_0016396_838_1491 | 216 |
| 643 | 3300046459 | Ga0495629_0017034 | Ga0495629_0017034_1782_2465 | 216 |
| 644 | 3300046461 | Ga0495641_0024206 | Ga0495641_0024206_755_1408 | 216 |
| 645 | 3300046472 | Ga0495580_0511256 | Ga0495580_0511256_34_684 | 216 |
| 646 | 3300046473 | Ga0495582_0024047 | Ga0495582_0024047_54_707 | 216 |
| 647 | 3300046473 | Ga0495582_0030585 | Ga0495582_0030585_391_1074 | 216 |
| 648 | 3300046476 | Ga0495662_0130976 | Ga0495662_0130976_570_1223 | 216 |
| 649 | 3300046531 | Ga0495665_0037559 | Ga0495665_0037559_31_684 | 216 |
| 650 | 3300046533 | Ga0495640_0048956 | Ga0495640_0048956_295_948 | 216 |
| 651 | 3300046674 | Ga0495588_0331202 | Ga0495588_0331202_75_728 | 216 |
| 652 | 3300046681 | Ga0495647_0092012 | Ga0495647_0092012_54_707 | 216 |
| 653 | 3300046681 | Ga0495647_0112348 | Ga0495647_0112348_302_955 | 216 |
| 654 | 3300046683 | Ga0495658_0029021 | Ga0495658_0029021_1811_2464 | 216 |
| 655 | 3300047315 | Ga0495581_0043682 | Ga0495581_0043682_1077_1730 | 216 |
| 656 | 3300047317 | Ga0495604_0271939 | Ga0495604_0271939_457_1137 | 216 |
| 657 | 3300047319 | Ga0495674_0031919 | Ga0495674_0031919_3430_4083 | 216 |
| 658 | 3300047319 | Ga0495674_0476514 | Ga0495674_0476514_110_763 | 216 |
| 659 | 3300047321 | Ga0495676_0101140 | Ga0495676_0101140_700_1353 | 216 |
| 660 | 3300047673 | Ga0495593_0006145 | Ga0495593_0006145_2265_2918 | 216 |
| 661 | 3300047673 | Ga0495593_0011199 | Ga0495593_0011199_2190_2843 | 216 |
| 662 | 3300048903 | Ga0496100_0003117 | Ga0496100_0003117_6856_7521 | 216 |
| 663 | 3300048903 | Ga0496100_0024059 | Ga0496100_0024059_2886_3542 | 216 |
| 664 | 3300048904 | Ga0496101_0002051 | Ga0496101_0002051_6164_6829 | 216 |
| 665 | 3300048905 | Ga0496102_0000692 | Ga0496102_0000692_26763_27428 | 216 |
| 666 | 3300048905 | Ga0496102_0005014 | Ga0496102_0005014_7048_7782 | 216 |
| 667 | 3300048905 | Ga0496102_0095201 | Ga0496102_0095201_532_1221 | 216 |
| 668 | 3300048905 | Ga0496102_0307158 | Ga0496102_0307158_170_820 | 216 |
| 669 | 3300048905 | Ga0496102_0671425 | Ga0496102_0671425_37_687 | 216 |
| 670 | 3300048906 | Ga0496103_0001954 | Ga0496103_0001954_7784_8449 | 216 |
| 671 | 3300048906 | Ga0496103_0005966 | Ga0496103_0005966_3233_3967 | 216 |
| 672 | 3300048906 | Ga0496103_0126052 | Ga0496103_0126052_488_1222 | 216 |
| 673 | 3300048908 | Ga0496105_0003710 | Ga0496105_0003710_4284_5018 | 216 |
| 674 | 3300048909 | Ga0496106_0000731 | Ga0496106_0000731_21796_22461 | 216 |
| 675 | 3300048909 | Ga0496106_0631649 | Ga0496106_0631649_15_671 | 216 |
| 676 | 3300048910 | Ga0496107_0002328 | Ga0496107_0002328_5603_6268 | 216 |
| 677 | 3300048911 | Ga0496108_0001277 | Ga0496108_0001277_1114_1764 | 216 |
| 678 | 3300048911 | Ga0496108_0003852 | Ga0496108_0003852_5200_5850 | 216 |
| 679 | 3300048911 | Ga0496108_0021900 | Ga0496108_0021900_1605_2339 | 216 |
| 680 | 3300048911 | Ga0496108_0119564 | Ga0496108_0119564_1083_1733 | 216 |
| 681 | 3300048911 | Ga0496108_0138114 | Ga0496108_0138114_377_1111 | 216 |
| 682 | 3300048912 | Ga0496109_0023877 | Ga0496109_0023877_2541_3191 | 216 |
| 683 | 3300048912 | Ga0496109_0036402 | Ga0496109_0036402_3037_3687 | 216 |
| 684 | 3300048912 | Ga0496109_0236078 | Ga0496109_0236078_1038_1688 | 216 |
| 685 | 3300048913 | Ga0496110_0013540 | Ga0496110_0013540_3011_3661 | 216 |
| 686 | 3300048913 | Ga0496110_0187131 | Ga0496110_0187131_983_1633 | 216 |
| 687 | 3300048915 | Ga0496112_0003021 | Ga0496112_0003021_4194_4844 | 216 |
| 688 | 3300048915 | Ga0496112_0099487 | Ga0496112_0099487_1280_1930 | 216 |
| 689 | 3300048915 | Ga0496112_0139323 | Ga0496112_0139323_531_1265 | 216 |
| 690 | 3300048915 | Ga0496112_0253530 | Ga0496112_0253530_219_872 | 216 |
| 691 | 3300048917 | Ga0496114_0003175 | Ga0496114_0003175_5300_5965 | 216 |
| 692 | 3300048918 | Ga0496115_0004547 | Ga0496115_0004547_5624_6289 | 216 |
| 693 | 3300048918 | Ga0496115_0214433 | Ga0496115_0214433_706_1356 | 216 |
| 694 | 3300048929 | Ga0496126_0023986 | Ga0496126_0023986_1833_2492 | 216 |
| 695 | 3300050490 | nmdc:mga03n38_20052_c1 | nmdc:mga03n38_20052_c1_49_699 | 216 |
| 696 | 3300050490 | nmdc:mga03n38_21497_c1 | nmdc:mga03n38_21497_c1_1142_1816 | 216 |
| 697 | 3300050490 | nmdc:mga03n38_2985_c1 | nmdc:mga03n38_2985_c1_3641_4294 | 216 |
| 698 | 3300050490 | nmdc:mga03n38_3516_c1 | nmdc:mga03n38_3516_c1_2961_3611 | 216 |
| 699 | 3300050491 | nmdc:mga00v17_4304_c1 | nmdc:mga00v17_4304_c1_2928_3581 | 216 |
| 700 | 3300050491 | nmdc:mga00v17_5980_c1 | nmdc:mga00v17_5980_c1_3966_4616 | 216 |
| 701 | 3300050491 | nmdc:mga00v17_76422_c1 | nmdc:mga00v17_76422_c1_416_1066 | 216 |
| 702 | 3300050492 | nmdc:mga0yw44_127509_c2 | nmdc:mga0yw44_127509_c2_67_717 | 216 |
| 703 | 3300050492 | nmdc:mga0yw44_3661_c2 | nmdc:mga0yw44_3661_c2_949_1602 | 216 |
| 704 | 3300050495 | nmdc:mga04h51_145009_c1 | nmdc:mga04h51_145009_c1_63_713 | 216 |
| 705 | 3300050496 | nmdc:mga07m45_46592_c2 | nmdc:mga07m45_46592_c2_218_868 | 216 |
| 706 | 3300050507 | nmdc:mga05p37_9376_c1 | nmdc:mga05p37_9376_c1_7425_8075 | 216 |
| 707 | 3300050509 | nmdc:mga0qj67_173006_c1 | nmdc:mga0qj67_173006_c1_188_838 | 216 |
| 708 | 3300050510 | nmdc:mga06r32_76788_c1 | nmdc:mga06r32_76788_c1_297_947 | 216 |
| 709 | 3300050516 | nmdc:mga0sz30_11783_c1 | nmdc:mga0sz30_11783_c1_1238_1972 | 216 |
| 710 | 3300050516 | nmdc:mga0sz30_2129_c1 | nmdc:mga0sz30_2129_c1_2919_3569 | 216 |
| 711 | 3300050516 | nmdc:mga0sz30_22661_c1 | nmdc:mga0sz30_22661_c1_901_1554 | 216 |
| 712 | 3300050516 | nmdc:mga0sz30_232075_c1 | nmdc:mga0sz30_232075_c1_112_762 | 216 |
| 713 | 3300050516 | nmdc:mga0sz30_34722_c1 | nmdc:mga0sz30_34722_c1_455_1105 | 216 |
| 714 | 3300050516 | nmdc:mga0sz30_7123_c1 | nmdc:mga0sz30_7123_c1_2974_3624 | 216 |
| 715 | 3300050516 | nmdc:mga0sz30_8334_c1 | nmdc:mga0sz30_8334_c1_445_1104 | 216 |
| 716 | 3300053108 | Ga0500562_054533 | Ga0500562_054533_278_1033 | 216 |
| 717 | 3300053130 | Ga0500642_0067593 | Ga0500642_0067593_733_1395 | 216 |
| 718 | iso_pu_bacteria | 2842134933 | 2842136823 | 216 |
| 719 | iso_pu_bacteria | 2902799365 | 2902799826 | 216 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zlj-assembly4.cif.gz_H | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain | 0.9827 | 145 | 208 |
| 1zlk-assembly1.cif.gz_B | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex | 0.9804 | 145 | 208 |
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.9771 | 150 | 202 |
| 6ekh-assembly1.cif.gz_Y | crystal structure of activated chey from methanoccocus maripaludis | 0.9713 | 1 | 113 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.9666 | 1 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1zlkB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9804 | 145 | 208 | 1.10.10.10 |
| 3ulqB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9771 | 150 | 202 | 1.10.10.10 |
| 6ekhY00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9713 | 1 | 113 | 3.40.50.2300 |
| 3eulC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9653 | 1 | 119 | 3.40.50.2300 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.962 | 149 | 206 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1KUN1-F1-model_v4 | Response regulator | 0.9866 | 1 | 123 |
GO:0000160
GO:0003677 |
| AF-K9TAR8-F1-model_v4 | Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain | 0.9854 | 2 | 123 |
GO:0000160
GO:0003677 GO:0016020 |
| AF-A0A563VXF1-F1-model_v4 | Response regulatory domain-containing protein | 0.9834 | 1 | 123 |
GO:0000160
GO:0003677 GO:0016020 |
| AF-C8XHH1-F1-model_v4 | Response regulator receiver protein | 0.9787 | 1 | 127 |
GO:0000160
GO:0003677 |
| AF-A0A397RJT3-F1-model_v4 | deleted | 0.9598 | 2 | 139 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar