F477256

General Info

Members Datasets Scaffolds Average Seq Length
719 342 682 219

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2813990|Ga0451853_2813990_989_1639
Length 216
Sequence MVTKVFLVDDHEIVRRGIADLLSDESDLVVVGEAASVTEALTMVPATGPDVAVLDIRLPDGNGIELCRELRSRLPDLRCLMLTSFTDDEALFDAIMAGASGFVLKQILGTDLVSAIRTVGEGGSLLDSRATAALMERIRASRNADPLAELSEQERAVFELIGEGMTNREIAERLFLAEKTVKNYVSRLLSKLGMQRRTQAAVLATELRKERGHDNT

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221692 Nocardia sp. Root136 Isolate Unclassified
6 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
14 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
15 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
16 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
17 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
18 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
19 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
20 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
21 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
22 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
23 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
24 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
25 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
26 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
27 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
28 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
29 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
30 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
31 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
32 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
33 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
34 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
35 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
36 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
39 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
40 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
41 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
42 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
44 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
45 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
46 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
88 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
89 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
97 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
98 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
99 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
100 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
109 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
134 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
135 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
136 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
137 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
138 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
139 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
153 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
154 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
219 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
234 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
268 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
296 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
299 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
300 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
331 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
341 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
342 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.85
Metatranscriptomes 0
Isolates 5.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.82
Nodule 0.28
Rhizoplane 10.71
Rhizosphere 66.76
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008506 3300001977 Bacteria 1545
2 JGI24739J22299_10040638 3300001989 Bacteria 1551
3 JGI24743J22301_10009379 3300001991 Bacteria 1733
4 JGI24743J22301_10012875 3300001991 Bacteria 1527
5 JGI24750J21931_1005879 3300002070 Bacteria 1515
6 JGI24745J21846_1018384 3300002073 Bacteria 815
7 JGI24748J21848_1004048 3300002074 Bacteria 1678
8 JGI24738J21930_10013664 3300002075 Bacteria 1752
9 JGI24744J21845_10005407 3300002077 Bacteria 2642
10 JGI24744J21845_10015152 3300002077 Bacteria 1542
11 JGI24034J26672_10001864 3300002239 Bacteria 2844
12 JGI24742J22300_10002085 3300002244 Bacteria 3183
13 JGI25406J46586_10004064 3300003203 Bacteria 6840
14 Ga0055540_1000147 3300003792 Bacteria 70743
15 Ga0055540_1000953 3300003792 Bacteria 18785
16 Ga0055540_1004309 3300003792 Bacteria 6483
17 Ga0065704_10206698 3300005289 Bacteria 1124
18 Ga0070676_10010895 3300005328 Bacteria 4938
19 Ga0070690_100001081 3300005330 Bacteria 13985
20 Ga0070690_100063818 3300005330 Bacteria 2378
21 Ga0068869_100028484 3300005334 Bacteria 3904
22 Ga0070666_10032346 3300005335 Bacteria 3455
23 Ga0070666_10053870 3300005335 Bacteria 2714
24 Ga0070682_100006705 3300005337 Bacteria 6458
25 Ga0070682_100128683 3300005337 Bacteria 1710
26 Ga0068868_100002489 3300005338 Bacteria 12789
27 Ga0068868_100068933 3300005338 Bacteria 2817
28 Ga0068868_100288064 3300005338 Bacteria 1392
29 Ga0070660_100109163 3300005339 Bacteria 2200
30 Ga0070660_100673765 3300005339 Bacteria 867
31 Ga0070689_100007750 3300005340 Bacteria 7524
32 Ga0070691_10011741 3300005341 Bacteria 4006
33 Ga0070691_10107500 3300005341 Bacteria 1392
34 Ga0070687_100027796 3300005343 Bacteria 2737
35 Ga0070692_10058134 3300005345 Bacteria 2030
36 Ga0070692_10093407 3300005345 Bacteria 1638
37 Ga0070668_100085784 3300005347 Bacteria 2475
38 Ga0070668_100261860 3300005347 Bacteria 1438
39 Ga0070668_100402416 3300005347 Bacteria 1169
40 Ga0070668_100524146 3300005347 Bacteria 1028
41 Ga0070668_100572743 3300005347 Bacteria 985
42 Ga0070668_100770667 3300005347 Bacteria 853
43 Ga0070669_100001478 3300005353 Bacteria 17002
44 Ga0070669_100006033 3300005353 Bacteria 8743
45 Ga0070675_100118923 3300005354 Bacteria 2244
46 Ga0070671_100096936 3300005355 Bacteria 2473
47 Ga0070671_100375338 3300005355 Bacteria 1215
48 Ga0070674_100001375 3300005356 Bacteria 12855
49 Ga0070674_100008790 3300005356 Bacteria 6027
50 Ga0070674_100085854 3300005356 Bacteria 2259
51 Ga0070673_100238018 3300005364 Bacteria 1581
52 Ga0070688_100006802 3300005365 Bacteria 6135
53 Ga0070688_100039010 3300005365 Bacteria 2905
54 Ga0070659_100081095 3300005366 Bacteria 2591
55 Ga0070659_100196580 3300005366 Bacteria 1659
56 Ga0070659_100280646 3300005366 Bacteria 1386
57 Ga0070667_100000042 3300005367 Bacteria 168902
58 Ga0070667_100002142 3300005367 Bacteria 17375
59 Ga0070667_100002534 3300005367 Bacteria 15909
60 Ga0070667_100003309 3300005367 Bacteria 13771
61 Ga0070667_100553478 3300005367 Bacteria 1057
62 Ga0070703_10125383 3300005406 Bacteria 937
63 Ga0070709_10030195 3300005434 Bacteria 3250
64 Ga0070709_10030246 3300005434 Bacteria 3247
65 Ga0070709_10032912 3300005434 Bacteria 3131
66 Ga0070709_10039422 3300005434 Bacteria 2898
67 Ga0070714_100005869 3300005435 Bacteria 9418
68 Ga0070714_100370711 3300005435 Bacteria 1348
69 Ga0070713_100041193 3300005436 Bacteria 3761
70 Ga0070713_100679440 3300005436 Bacteria 982
71 Ga0070713_100780554 3300005436 Bacteria 915
72 Ga0070710_10001686 3300005437 Bacteria 10415
73 Ga0070710_10090134 3300005437 Bacteria 1807
74 Ga0070701_10036841 3300005438 Bacteria 2466
75 Ga0070701_10054527 3300005438 Bacteria 2085
76 Ga0070711_100000565 3300005439 Bacteria 19359
77 Ga0070711_100067070 3300005439 Bacteria 2516
78 Ga0070705_100005383 3300005440 Bacteria 6237
79 Ga0070700_100001381 3300005441 Bacteria 12051
80 Ga0070700_100075184 3300005441 Bacteria 2166
81 Ga0070700_100083552 3300005441 Bacteria 2067
82 Ga0070694_100007860 3300005444 Bacteria 6509
83 Ga0070694_100227795 3300005444 Bacteria 1401
84 Ga0070663_100003370 3300005455 Bacteria 9222
85 Ga0070663_100072165 3300005455 Bacteria 2514
86 Ga0070663_100529679 3300005455 Bacteria 982
87 Ga0070678_100001483 3300005456 Bacteria 12531
88 Ga0070678_100062648 3300005456 Bacteria 2747
89 Ga0070678_100209014 3300005456 Bacteria 1616
90 Ga0070678_100450981 3300005456 Bacteria 1127
91 Ga0070678_100484260 3300005456 Bacteria 1089
92 Ga0070678_100732809 3300005456 Bacteria 893
93 Ga0070662_100004641 3300005457 Bacteria 8710
94 Ga0070662_100218076 3300005457 Bacteria 1521
95 Ga0070681_10382029 3300005458 Bacteria 1319
96 Ga0068867_100002757 3300005459 Bacteria 12382
97 Ga0068867_100197911 3300005459 Bacteria 1607
98 Ga0068867_100215438 3300005459 Bacteria 1545
99 Ga0070685_10016055 3300005466 Bacteria 3983
100 Ga0070707_100003248 3300005468 Bacteria 15405
101 Ga0070698_100726653 3300005471 Bacteria 936
102 Ga0070684_100132819 3300005535 Bacteria 2246
103 Ga0068853_100003295 3300005539 Bacteria 12353
104 Ga0068853_100043268 3300005539 Bacteria 3853
105 Ga0068853_100075480 3300005539 Bacteria 2942
106 Ga0068853_100545944 3300005539 Bacteria 1097
107 Ga0070672_100037774 3300005543 Bacteria 3686
108 Ga0070672_100278060 3300005543 Bacteria 1415
109 Ga0070686_100028611 3300005544 Bacteria 3381
110 Ga0070686_100070263 3300005544 Bacteria 2289
111 Ga0070695_100008811 3300005545 Bacteria 5996
112 Ga0070695_100074807 3300005545 Bacteria 2226
113 Ga0070696_100013731 3300005546 Bacteria 5439
114 Ga0070696_100048363 3300005546 Bacteria 2952
115 Ga0070696_100180921 3300005546 Bacteria 1564
116 Ga0070693_100028129 3300005547 Bacteria 3054
117 Ga0070665_100002665 3300005548 Bacteria 19411
118 Ga0070665_100047438 3300005548 Bacteria 4311
119 Ga0070665_100958046 3300005548 Bacteria 868
120 Ga0070704_100001549 3300005549 Bacteria 12412
121 Ga0070704_100294060 3300005549 Bacteria 1350
122 Ga0068854_100002581 3300005578 Bacteria 11222
123 Ga0068854_100130145 3300005578 Bacteria 1921
124 Ga0068854_100132508 3300005578 Bacteria 1904
125 Ga0068854_100301191 3300005578 Bacteria 1297
126 Ga0068856_100715258 3300005614 Bacteria 1022
127 Ga0070702_100000718 3300005615 Bacteria 12552
128 Ga0070702_100241439 3300005615 Bacteria 1219
129 Ga0068852_100058714 3300005616 Bacteria 3334
130 Ga0068852_100093560 3300005616 Bacteria 2694
131 Ga0068859_100014976 3300005617 Bacteria 7785
132 Ga0068859_100059900 3300005617 Bacteria 3836
133 Ga0068864_100180114 3300005618 Bacteria 1932
134 Ga0068864_100185266 3300005618 Bacteria 1905
135 Ga0068866_10002610 3300005718 Bacteria 7447
136 Ga0068861_100002207 3300005719 Bacteria 12627
137 Ga0068861_100112024 3300005719 Bacteria 2187
138 Ga0068851_10377681 3300005834 Bacteria 830
139 Ga0068863_100000621 3300005841 Bacteria 35949
140 Ga0068863_100017418 3300005841 Bacteria 6888
141 Ga0068863_100407907 3300005841 Bacteria 1330
142 Ga0068858_100010321 3300005842 Bacteria 8851
143 Ga0068858_100013740 3300005842 Bacteria 7643
144 Ga0068858_100015049 3300005842 Bacteria 7276
145 Ga0068860_100000020 3300005843 Bacteria 283324
146 Ga0068860_100007201 3300005843 Bacteria 11122
147 Ga0068862_100000013 3300005844 Bacteria 263115
148 Ga0068862_100004925 3300005844 Bacteria 11244
149 Ga0068862_100124656 3300005844 Bacteria 2273
150 Ga0068862_100228862 3300005844 Bacteria 1686
151 Ga0068862_100544952 3300005844 Bacteria 1107
152 Ga0081455_10000667 3300005937 Bacteria 44477
153 Ga0081455_10041106 3300005937 Bacteria 4071
154 Ga0081455_10093898 3300005937 Bacteria 2424
155 Ga0081455_10144366 3300005937 Bacteria 1843
156 Ga0081538_10057642 3300005981 Bacteria 2260
157 Ga0081539_10000027 3300005985 Bacteria 328691
158 Ga0070717_10055988 3300006028 Bacteria 3256
159 Ga0070717_10102191 3300006028 Bacteria 2435
160 Ga0070717_10265505 3300006028 Bacteria 1519
161 Ga0075365_10007302 3300006038 Bacteria 6176
162 Ga0075365_10020404 3300006038 Bacteria 4108
163 Ga0075363_100000818 3300006048 Bacteria 10776
164 Ga0075363_100036777 3300006048 Bacteria 2569
165 Ga0075363_100065254 3300006048 Bacteria 1968
166 Ga0075363_100106936 3300006048 Bacteria 1552
167 Ga0075364_10007304 3300006051 Bacteria 6557
168 Ga0075364_10007949 3300006051 Bacteria 6319
169 Ga0075364_10027223 3300006051 Bacteria 3651
170 Ga0075364_10073739 3300006051 Bacteria 2250
171 Ga0075364_10183317 3300006051 Bacteria 1417
172 Ga0070715_10001443 3300006163 Bacteria 6889
173 Ga0070715_10024140 3300006163 Bacteria 2391
174 Ga0070716_100002440 3300006173 Bacteria 8568
175 Ga0070712_100001326 3300006175 Bacteria 15008
176 Ga0075362_10168498 3300006177 Bacteria 1057
177 Ga0075367_10033423 3300006178 Bacteria 2964
178 Ga0075367_10199756 3300006178 Bacteria 1249
179 Ga0075367_10286453 3300006178 Bacteria 1036
180 Ga0075369_10001462 3300006186 Bacteria 8060
181 Ga0075369_10002699 3300006186 Bacteria 6363
182 Ga0075369_10003020 3300006186 Bacteria 6086
183 Ga0075369_10009883 3300006186 Bacteria 3721
184 Ga0075369_10014091 3300006186 Bacteria 3188
185 Ga0075369_10021331 3300006186 Bacteria 2661
186 Ga0075369_10023389 3300006186 Bacteria 2554
187 Ga0075369_10063762 3300006186 Bacteria 1613
188 Ga0075369_10103156 3300006186 Bacteria 1281
189 Ga0097621_100175782 3300006237 Bacteria 1848
190 Ga0075370_10009696 3300006353 Bacteria 5013
191 Ga0075370_10131799 3300006353 Bacteria 1459
192 Ga0075370_10186266 3300006353 Bacteria 1222
193 Ga0068871_100160944 3300006358 Bacteria 1920
194 Ga0075428_100010758 3300006844 Bacteria 10170
195 Ga0075430_100103300 3300006846 Bacteria 2379
196 Ga0075431_100045559 3300006847 Bacteria 4522
197 Ga0068865_100001748 3300006881 Bacteria 12748
198 Ga0068865_100492297 3300006881 Bacteria 1021
199 Ga0097620_100014976 3300006931 Bacteria 7785
200 Ga0097620_100059895 3300006931 Bacteria 3836
201 Ga0097620_100515530 3300006931 Bacteria 1291
202 Ga0105244_10192652 3300009036 Bacteria 963
203 Ga0105250_10012038 3300009092 Bacteria 3582
204 Ga0105250_10099289 3300009092 Bacteria 1187
205 Ga0105240_10512553 3300009093 Bacteria 1332
206 Ga0105240_10532185 3300009093 Bacteria 1303
207 Ga0111539_10233122 3300009094 Bacteria 2143
208 Ga0105245_10004631 3300009098 Bacteria 12148
209 Ga0105245_10151001 3300009098 Bacteria 2197
210 Ga0105245_10176031 3300009098 Bacteria 2041
211 Ga0105245_10993997 3300009098 Bacteria 883
212 Ga0105247_10000009 3300009101 Bacteria 385991
213 Ga0105247_10001964 3300009101 Bacteria 14281
214 Ga0105247_10054015 3300009101 Bacteria 2479
215 Ga0105247_10109332 3300009101 Bacteria 1777
216 Ga0114129_10008093 3300009147 Bacteria 14981
217 Ga0105243_10003417 3300009148 Bacteria 12868
218 Ga0105243_10013745 3300009148 Bacteria 6125
219 Ga0105243_10190098 3300009148 Bacteria 1793
220 Ga0105243_10238929 3300009148 Bacteria 1615
221 Ga0105243_10286244 3300009148 Bacteria 1487
222 Ga0105243_10509579 3300009148 Bacteria 1142
223 Ga0105243_10790841 3300009148 Bacteria 934
224 Ga0105241_10381362 3300009174 Bacteria 1232
225 Ga0105242_10003784 3300009176 Bacteria 11765
226 Ga0105248_10000109 3300009177 Bacteria 93114
227 Ga0105248_10032558 3300009177 Bacteria 5826
228 Ga0105248_10048242 3300009177 Bacteria 4777
229 Ga0105237_10000587 3300009545 Bacteria 50736
230 Ga0105237_10015861 3300009545 Bacteria 7834
231 Ga0105237_10016819 3300009545 Bacteria 7593
232 Ga0105238_10117062 3300009551 Bacteria 2645
233 Ga0105249_10000011 3300009553 Bacteria 292812
234 Ga0105249_10004295 3300009553 Bacteria 12319
235 Ga0105249_10009857 3300009553 Bacteria 8374
236 Ga0105249_10750533 3300009553 Bacteria 1038
237 Ga0105249_10880063 3300009553 Bacteria 962
238 Ga0105239_10011860 3300010375 Bacteria 9724
239 Ga0105239_10014224 3300010375 Bacteria 8832
240 Ga0105239_10017470 3300010375 Bacteria 7933
241 Ga0105239_10276114 3300010375 Bacteria 1891
242 Ga0105246_10028692 3300011119 Bacteria 3658
243 Ga0105246_10273986 3300011119 Bacteria 1350
244 Ga0157369_10124593 3300013105 Bacteria 2733
245 Ga0157378_10007770 3300013297 Bacteria 9363
246 Ga0157378_10101206 3300013297 Bacteria 2632
247 Ga0163162_10006354 3300013306 Bacteria 11437
248 Ga0163162_10036414 3300013306 Bacteria 4904
249 Ga0163162_10086089 3300013306 Bacteria 3220
250 Ga0163162_10116251 3300013306 Bacteria 2776
251 Ga0157372_10014607 3300013307 Bacteria 8400
252 Ga0157372_10459439 3300013307 Bacteria 1484
253 Ga0157375_10004095 3300013308 Bacteria 12638
254 Ga0157375_10089136 3300013308 Bacteria 3140
255 Ga0157375_10136305 3300013308 Bacteria 2579
256 Ga0163163_10006691 3300014325 Bacteria 10099
257 Ga0163163_10072929 3300014325 Bacteria 3423
258 Ga0163163_10079613 3300014325 Bacteria 3275
259 Ga0163163_10742761 3300014325 Bacteria 1045
260 Ga0157380_10006086 3300014326 Bacteria 8459
261 Ga0157380_10121602 3300014326 Bacteria 2212
262 Ga0157377_10052204 3300014745 Bacteria 2308
263 Ga0157377_10052590 3300014745 Bacteria 2300
264 Ga0157379_10003994 3300014968 Bacteria 12576
265 Ga0157379_10122984 3300014968 Bacteria 2335
266 Ga0157379_10587575 3300014968 Bacteria 1038
267 Ga0157376_10303248 3300014969 Bacteria 1513
268 Ga0163161_10002738 3300017792 Bacteria 12540
269 Ga0163161_10091399 3300017792 Bacteria 2253
270 Ga0213876_10040018 3300021384 Bacteria 2476
271 Ga0213876_10177785 3300021384 Bacteria 1132
272 Ga0213875_10002710 3300021388 Bacteria 10464
273 Ga0209025_1110762 3300025294 Bacteria 844
274 Ga0209051_1000333 3300025303 Bacteria 70796
275 Ga0209051_1000520 3300025303 Bacteria 48228
276 Ga0209051_1000717 3300025303 Bacteria 36316
277 Ga0209051_1031282 3300025303 Bacteria 2050
278 Ga0209051_1081288 3300025303 Bacteria 934
279 Ga0207656_10258647 3300025321 Bacteria 854
280 Ga0207682_10328334 3300025893 Bacteria 719
281 Ga0207692_10002807 3300025898 Bacteria 6728
282 Ga0207692_10081045 3300025898 Bacteria 1736
283 Ga0207642_10000103 3300025899 Bacteria 22601
284 Ga0207710_10000014 3300025900 Bacteria 408072
285 Ga0207710_10004537 3300025900 Bacteria 6035
286 Ga0207688_10001724 3300025901 Bacteria 11601
287 Ga0207688_10004440 3300025901 Bacteria 7635
288 Ga0207688_10007439 3300025901 Bacteria 5957
289 Ga0207688_10118469 3300025901 Bacteria 1543
290 Ga0207680_10070547 3300025903 Bacteria 2163
291 Ga0207647_10079356 3300025904 Bacteria 1971
292 Ga0207647_10099876 3300025904 Bacteria 1723
293 Ga0207647_10170793 3300025904 Bacteria 1266
294 Ga0207685_10043018 3300025905 Bacteria 1700
295 Ga0207699_10019581 3300025906 Bacteria 3612
296 Ga0207699_10054119 3300025906 Bacteria 2383
297 Ga0207699_10060788 3300025906 Bacteria 2270
298 Ga0207645_10016541 3300025907 Bacteria 4880
299 Ga0207645_10028640 3300025907 Bacteria 3595
300 Ga0207684_10061299 3300025910 Bacteria 3194
301 Ga0207654_10256097 3300025911 Bacteria 1175
302 Ga0207695_10272319 3300025913 Bacteria 1588
303 Ga0207671_10066155 3300025914 Bacteria 2690
304 Ga0207671_10113907 3300025914 Bacteria 2061
305 Ga0207671_10119898 3300025914 Bacteria 2010
306 Ga0207693_10003311 3300025915 Bacteria 13783
307 Ga0207693_10120569 3300025915 Bacteria 2060
308 Ga0207693_10328042 3300025915 Bacteria 1198
309 Ga0207693_10457059 3300025915 Bacteria 998
310 Ga0207663_10000981 3300025916 Bacteria 13071
311 Ga0207663_10071733 3300025916 Bacteria 2236
312 Ga0207662_10017713 3300025918 Bacteria 4032
313 Ga0207662_10225409 3300025918 Bacteria 1222
314 Ga0207657_10240840 3300025919 Bacteria 1444
315 Ga0207657_10258820 3300025919 Bacteria 1385
316 Ga0207646_10006610 3300025922 Bacteria 11970
317 Ga0207681_10005669 3300025923 Bacteria 7664
318 Ga0207681_10051810 3300025923 Bacteria 2781
319 Ga0207659_10249947 3300025926 Bacteria 1438
320 Ga0207687_10002874 3300025927 Bacteria 11689
321 Ga0207687_10066920 3300025927 Bacteria 2554
322 Ga0207687_10417739 3300025927 Bacteria 1106
323 Ga0207700_10142567 3300025928 Bacteria 1971
324 Ga0207664_10088780 3300025929 Bacteria 2530
325 Ga0207664_10138195 3300025929 Bacteria 2058
326 Ga0207664_10563152 3300025929 Bacteria 1023
327 Ga0207664_10779292 3300025929 Bacteria 860
328 Ga0207644_10041414 3300025931 Bacteria 3258
329 Ga0207690_10373009 3300025932 Bacteria 1132
330 Ga0207690_10389726 3300025932 Bacteria 1109
331 Ga0207706_10010422 3300025933 Bacteria 8491
332 Ga0207706_10039924 3300025933 Bacteria 4160
333 Ga0207706_10054717 3300025933 Bacteria 3521
334 Ga0207686_10001839 3300025934 Bacteria 11801
335 Ga0207709_10007208 3300025935 Bacteria 6205
336 Ga0207709_10064704 3300025935 Bacteria 2297
337 Ga0207709_10259883 3300025935 Bacteria 1273
338 Ga0207670_10070046 3300025936 Bacteria 2421
339 Ga0207669_10000215 3300025937 Bacteria 26345
340 Ga0207669_10056441 3300025937 Bacteria 2385
341 Ga0207704_10000580 3300025938 Bacteria 16284
342 Ga0207665_10002002 3300025939 Bacteria 13735
343 Ga0207691_10037577 3300025940 Bacteria 4484
344 Ga0207711_10000322 3300025941 Bacteria 51422
345 Ga0207711_10008630 3300025941 Bacteria 8520
346 Ga0207711_10127926 3300025941 Bacteria 2274
347 Ga0207689_10014414 3300025942 Bacteria 6724
348 Ga0207667_10120130 3300025949 Bacteria 2708
349 Ga0207712_10000020 3300025961 Bacteria 292796
350 Ga0207712_10013121 3300025961 Bacteria 5308
351 Ga0207712_10073455 3300025961 Bacteria 2467
352 Ga0207712_10126557 3300025961 Bacteria 1941
353 Ga0207668_10003993 3300025972 Bacteria 8692
354 Ga0207668_10005510 3300025972 Bacteria 7462
355 Ga0207668_10117799 3300025972 Bacteria 2005
356 Ga0207668_10286561 3300025972 Bacteria 1353
357 Ga0207640_10001964 3300025981 Bacteria 11078
358 Ga0207640_10093916 3300025981 Bacteria 2085
359 Ga0207658_10000055 3300025986 Bacteria 125014
360 Ga0207658_10001485 3300025986 Bacteria 18208
361 Ga0207658_10065842 3300025986 Bacteria 2723
362 Ga0207658_10511736 3300025986 Bacteria 1070
363 Ga0207677_10003911 3300026023 Bacteria 7931
364 Ga0207677_10044493 3300026023 Bacteria 2959
365 Ga0207703_10006323 3300026035 Bacteria 9469
366 Ga0207703_10009452 3300026035 Bacteria 7656
367 Ga0207703_10426467 3300026035 Bacteria 1235
368 Ga0207639_10008988 3300026041 Bacteria 6878
369 Ga0207639_10072670 3300026041 Bacteria 2694
370 Ga0207678_10013443 3300026067 Bacteria 7185
371 Ga0207678_10018721 3300026067 Bacteria 6081
372 Ga0207678_10100347 3300026067 Bacteria 2473
373 Ga0207678_10359287 3300026067 Bacteria 1257
374 Ga0207708_10009940 3300026075 Bacteria 7064
375 Ga0207702_10651297 3300026078 Bacteria 1036
376 Ga0207641_10003088 3300026088 Bacteria 15007
377 Ga0207641_10025442 3300026088 Bacteria 4880
378 Ga0207648_10006769 3300026089 Bacteria 11365
379 Ga0207648_10066765 3300026089 Bacteria 3137
380 Ga0207648_10082259 3300026089 Bacteria 2808
381 Ga0207676_10195416 3300026095 Bacteria 1784
382 Ga0207676_10635778 3300026095 Bacteria 1028
383 Ga0207675_100006306 3300026118 Bacteria 11254
384 Ga0207675_100069950 3300026118 Bacteria 3280
385 Ga0207675_100117272 3300026118 Bacteria 2517
386 Ga0207675_100137667 3300026118 Bacteria 2318
387 Ga0207683_10005026 3300026121 Bacteria 11354
388 Ga0207683_10053936 3300026121 Bacteria 3526
389 Ga0207683_10463984 3300026121 Bacteria 1168
390 Ga0207698_10039853 3300026142 Bacteria 3484
391 Ga0207698_10067945 3300026142 Bacteria 2813
392 Ga0207698_11092681 3300026142 Bacteria 810
393 Ga0268266_10081328 3300028379 Bacteria 2824
394 Ga0268266_10220964 3300028379 Bacteria 1741
395 Ga0268266_10692422 3300028379 Bacteria 982
396 Ga0268265_10000004 3300028380 Bacteria 648376
397 Ga0268265_10004893 3300028380 Bacteria 9225
398 Ga0268265_10464529 3300028380 Bacteria 1185
399 Ga0268265_10740188 3300028380 Bacteria 953
400 Ga0268264_10000024 3300028381 Bacteria 470081
401 Ga0268264_10002682 3300028381 Bacteria 15540
402 Ga0307515_10055239 3300028794 Bacteria 5808
403 Ga0307512_10024587 3300030522 Bacteria 5356
404 Ga0265327_10000964 3300031251 Bacteria 41214
405 Ga0265327_10028389 3300031251 Bacteria 3202
406 Ga0307513_10245457 3300031456 Bacteria 1592
407 Ga0307413_10392857 3300031824 Bacteria 1084
408 Ga0307410_10069603 3300031852 Bacteria 2435
409 Ga0307409_100007289 3300031995 Bacteria 6603
410 Ga0307416_100074799 3300032002 Bacteria 2832
411 Ga0307416_100645697 3300032002 Bacteria 1143
412 Ga0307411_10065463 3300032005 Bacteria 2438
413 Ga0373959_0086204 3300034820 Bacteria 730
414 Ga0373960_0172107 3300035121 Bacteria 751
415 Ga0373942_0048997 3300035207 Bacteria 1179
416 Ga0373962_0097281 3300035242 Bacteria 914
417 Ga0373931_0013263 3300035691 Bacteria 4011
418 Ga0373931_0036656 3300035691 Bacteria 2557
419 Ga0316584_0015074 3300036712 Bacteria 5523
420 Ga0316584_0138875 3300036712 Bacteria 1813
421 Ga0436364_0988707 3300037853 Bacteria 16804
422 Ga0436365_0099441 3300039437 Bacteria 9181
423 Ga0436365_0114496 3300039437 Bacteria 2367
424 Ga0436365_1318964 3300039437 Bacteria 13827
425 Ga0436361_0761186 3300039447 Bacteria 1393
426 Ga0436363_0146676 3300039450 Bacteria 2284
427 Ga0436363_1097219 3300039450 Bacteria 1568
428 Ga0451795_1539735 3300041456 Bacteria 1526
429 Ga0451802_1438524 3300041460 Bacteria 1121
430 Ga0451802_1840921 3300041460 Bacteria 1334
431 Ga0451837_1099642 3300041494 Bacteria 882
432 Ga0451853_2813990 3300041512 Bacteria 1933
433 Ga0466972_0016979 3300044658 Bacteria 3641
434 Ga0466972_0036745 3300044658 Bacteria 2395
435 Ga0466965_0043644 3300044683 Bacteria 2214
436 Ga0466965_0217396 3300044683 Bacteria 1018
437 Ga0466963_0117387 3300044694 Bacteria 1829
438 Ga0466971_0025853 3300044719 Bacteria 2622
439 Ga0466968_0001467 3300044735 Bacteria 8445
440 Ga0466970_0197000 3300044765 Bacteria 1120
441 Ga0466957_0006319 3300044842 Bacteria 6681
442 Ga0466957_0286968 3300044842 Bacteria 1103
443 Ga0466960_0000148 3300044901 Bacteria 24082
444 Ga0466960_0000254 3300044901 Bacteria 18334
445 Ga0466959_0097113 3300045049 Bacteria 2111
446 Ga0466958_0132137 3300045836 Bacteria 1568
447 Ga0466958_0485170 3300045836 Bacteria 801
448 Ga0466967_0004060 3300045976 Bacteria 9768
449 Ga0466967_0018811 3300045976 Bacteria 5535
450 Ga0466967_0024904 3300045976 Bacteria 4927
451 Ga0466967_0988248 3300045976 Bacteria 838
452 Ga0495603_0070641 3300046455 Bacteria 2052
453 Ga0495629_0016396 3300046459 Bacteria 5318
454 Ga0495629_0017034 3300046459 Bacteria 5214
455 Ga0495638_0001425 3300046460 Bacteria 21684
456 Ga0495638_0016648 3300046460 Bacteria 4920
457 Ga0495638_0022263 3300046460 Bacteria 4161
458 Ga0495641_0024206 3300046461 Bacteria 3001
459 Ga0495580_0511256 3300046472 Bacteria 801
460 Ga0495582_0024047 3300046473 Bacteria 3331
461 Ga0495582_0030585 3300046473 Bacteria 2956
462 Ga0495662_0130976 3300046476 Bacteria 1233
463 Ga0495607_0006562 3300046501 Bacteria 8176
464 Ga0495606_0012168 3300046507 Bacteria 6936
465 Ga0495648_0006285 3300046524 Bacteria 9716
466 Ga0495665_0037559 3300046531 Bacteria 2585
467 Ga0495665_0188020 3300046531 Bacteria 1072
468 Ga0495640_0048956 3300046533 Bacteria 2917
469 Ga0495645_0164747 3300046543 Bacteria 1530
470 Ga0495668_0030531 3300046616 Bacteria 3042
471 Ga0495611_0030198 3300046648 Bacteria 2381
472 Ga0495625_0086223 3300046660 Bacteria 2179
473 Ga0495625_0512166 3300046660 Bacteria 732
474 Ga0495635_0440364 3300046663 Bacteria 862
475 Ga0495588_0331202 3300046674 Bacteria 801
476 Ga0495657_0155126 3300046675 Bacteria 1420
477 Ga0495647_0092012 3300046681 Bacteria 1245
478 Ga0495647_0112348 3300046681 Bacteria 1138
479 Ga0495658_0029021 3300046683 Bacteria 2990
480 Ga0495581_0006653 3300047315 Bacteria 6697
481 Ga0495581_0043682 3300047315 Bacteria 2592
482 Ga0495604_0271939 3300047317 Bacteria 1148
483 Ga0495674_0031919 3300047319 Bacteria 4780
484 Ga0495674_0476514 3300047319 Bacteria 1001
485 Ga0495672_0009344 3300047320 Bacteria 7116
486 Ga0495676_0101140 3300047321 Bacteria 2133
487 Ga0495676_0178612 3300047321 Bacteria 1489
488 Ga0495683_0000316 3300047323 Bacteria 40616
489 Ga0495683_0002516 3300047323 Bacteria 11015
490 Ga0495673_0007756 3300047469 Bacteria 6126
491 Ga0495686_0000767 3300047472 Bacteria 42353
492 Ga0495686_0158823 3300047472 Bacteria 1322
493 Ga0495593_0006145 3300047673 Bacteria 7065
494 Ga0495593_0011199 3300047673 Bacteria 5157
495 Ga0496100_0000111 3300048903 Bacteria 47022
496 Ga0496100_0000406 3300048903 Bacteria 20830
497 Ga0496100_0003117 3300048903 Bacteria 8582
498 Ga0496100_0024059 3300048903 Bacteria 3710
499 Ga0496100_0024790 3300048903 Bacteria 3663
500 Ga0496101_0000091 3300048904 Bacteria 97934
501 Ga0496101_0000103 3300048904 Bacteria 88726
502 Ga0496101_0002051 3300048904 Bacteria 12257
503 Ga0496101_0007249 3300048904 Bacteria 7175
504 Ga0496101_0010006 3300048904 Bacteria 6248
505 Ga0496101_0099777 3300048904 Bacteria 2171
506 Ga0496101_0214736 3300048904 Bacteria 1491
507 Ga0496102_0000016 3300048905 Bacteria 286787
508 Ga0496102_0000451 3300048905 Bacteria 46781
509 Ga0496102_0000692 3300048905 Bacteria 33501
510 Ga0496102_0005014 3300048905 Bacteria 11214
511 Ga0496102_0025597 3300048905 Bacteria 5255
512 Ga0496102_0078246 3300048905 Bacteria 3044
513 Ga0496102_0082914 3300048905 Bacteria 2957
514 Ga0496102_0095201 3300048905 Bacteria 2760
515 Ga0496102_0307158 3300048905 Bacteria 1495
516 Ga0496102_0436643 3300048905 Bacteria 1229
517 Ga0496102_0671425 3300048905 Bacteria 959
518 Ga0496103_0000015 3300048906 Bacteria 287966
519 Ga0496103_0001793 3300048906 Bacteria 14014
520 Ga0496103_0001954 3300048906 Bacteria 13333
521 Ga0496103_0005966 3300048906 Bacteria 7286
522 Ga0496103_0007217 3300048906 Bacteria 6627
523 Ga0496103_0126052 3300048906 Bacteria 1633
524 Ga0496103_0163072 3300048906 Bacteria 1430
525 Ga0496103_0280237 3300048906 Bacteria 1072
526 Ga0496104_0244496 3300048907 Bacteria 1707
527 Ga0496104_0736661 3300048907 Bacteria 893
528 Ga0496104_0898994 3300048907 Bacteria 790
529 Ga0496105_0003710 3300048908 Bacteria 11365
530 Ga0496105_0078328 3300048908 Bacteria 2729
531 Ga0496105_0138269 3300048908 Bacteria 2006
532 Ga0496106_0000731 3300048909 Bacteria 23666
533 Ga0496106_0005443 3300048909 Bacteria 9422
534 Ga0496106_0021401 3300048909 Bacteria 4802
535 Ga0496106_0052538 3300048909 Bacteria 3075
536 Ga0496106_0631649 3300048909 Bacteria 856
537 Ga0496107_0002328 3300048910 Bacteria 12263
538 Ga0496107_0008519 3300048910 Bacteria 7098
539 Ga0496107_0010233 3300048910 Bacteria 6509
540 Ga0496108_0001277 3300048911 Bacteria 19717
541 Ga0496108_0003194 3300048911 Bacteria 13188
542 Ga0496108_0003852 3300048911 Bacteria 12042
543 Ga0496108_0021900 3300048911 Bacteria 5254
544 Ga0496108_0119564 3300048911 Bacteria 2259
545 Ga0496108_0138114 3300048911 Bacteria 2099
546 Ga0496108_0289633 3300048911 Bacteria 1426
547 Ga0496109_0000562 3300048912 Bacteria 31022
548 Ga0496109_0023877 3300048912 Bacteria 5429
549 Ga0496109_0036402 3300048912 Bacteria 4442
550 Ga0496109_0236078 3300048912 Bacteria 1720
551 Ga0496110_0013540 3300048913 Bacteria 6749
552 Ga0496110_0024078 3300048913 Bacteria 5187
553 Ga0496110_0187131 3300048913 Bacteria 1880
554 Ga0496112_0003021 3300048915 Bacteria 13753
555 Ga0496112_0099487 3300048915 Bacteria 2878
556 Ga0496112_0139323 3300048915 Bacteria 2395
557 Ga0496112_0253530 3300048915 Bacteria 1710
558 Ga0496112_0424970 3300048915 Bacteria 1267
559 Ga0496113_0002057 3300048916 Bacteria 11559
560 Ga0496113_0075998 3300048916 Bacteria 2565
561 Ga0496114_0003175 3300048917 Bacteria 12602
562 Ga0496114_0005368 3300048917 Bacteria 10019
563 Ga0496114_0276246 3300048917 Bacteria 1481
564 Ga0496115_0004547 3300048918 Bacteria 10039
565 Ga0496115_0045816 3300048918 Bacteria 3493
566 Ga0496115_0051265 3300048918 Bacteria 3309
567 Ga0496115_0214433 3300048918 Bacteria 1590
568 Ga0496115_0238309 3300048918 Bacteria 1500
569 Ga0496116_0000055 3300048919 Bacteria 286923
570 Ga0496116_0017473 3300048919 Bacteria 5564
571 Ga0496116_0018185 3300048919 Bacteria 5428
572 Ga0496117_0000006 3300048920 Bacteria 758420
573 Ga0496117_0000280 3300048920 Bacteria 95337
574 Ga0496118_0000004 3300048921 Bacteria 758420
575 Ga0496118_0000505 3300048921 Bacteria 64638
576 Ga0496118_0010921 3300048921 Bacteria 8929
577 Ga0496119_0004681 3300048922 Bacteria 13481
578 Ga0496119_0016780 3300048922 Bacteria 5546
579 Ga0496119_0060206 3300048922 Bacteria 2275
580 Ga0496119_0077816 3300048922 Bacteria 1920
581 Ga0496120_0000272 3300048923 Bacteria 86274
582 Ga0496120_0003889 3300048923 Bacteria 13079
583 Ga0496120_0015574 3300048923 Bacteria 5009
584 Ga0496120_0166763 3300048923 Bacteria 1093
585 Ga0496121_0000134 3300048924 Bacteria 165728
586 Ga0496121_0000331 3300048924 Bacteria 98656
587 Ga0496121_0001052 3300048924 Bacteria 48971
588 Ga0496121_0375458 3300048924 Bacteria 939
589 Ga0496122_0000453 3300048925 Bacteria 85486
590 Ga0496122_0011900 3300048925 Bacteria 8741
591 Ga0496122_0287503 3300048925 Bacteria 895
592 Ga0496123_0011572 3300048926 Bacteria 7630
593 Ga0496123_0025319 3300048926 Bacteria 4477
594 Ga0496124_0000113 3300048927 Bacteria 165710
595 Ga0496124_0007312 3300048927 Bacteria 11777
596 Ga0496124_0019870 3300048927 Bacteria 6231
597 Ga0496125_0000127 3300048928 Bacteria 165710
598 Ga0496125_0082997 3300048928 Bacteria 2440
599 Ga0496125_0269324 3300048928 Bacteria 1062
600 Ga0496125_0351198 3300048928 Bacteria 881
601 Ga0496126_0000140 3300048929 Bacteria 165728
602 Ga0496126_0000675 3300048929 Bacteria 62838
603 Ga0496126_0004884 3300048929 Bacteria 15679
604 Ga0496126_0016629 3300048929 Bacteria 7351
605 Ga0496126_0023986 3300048929 Bacteria 5898
606 Ga0496126_0037423 3300048929 Bacteria 4528
607 Ga0496126_0467960 3300048929 Bacteria 1012
608 Ga0501031_0468258 3300049568 Bacteria 814
609 Ga0501032_0000802 3300049569 Bacteria 25536
610 Ga0501033_0051666 3300049570 Bacteria 3047
611 Ga0501034_0010251 3300049571 Bacteria 9776
612 Ga0501034_0122633 3300049571 Bacteria 2585
613 Ga0501037_0001268 3300049573 Bacteria 18615
614 Ga0501038_0001207 3300049574 Bacteria 23435
615 Ga0501039_0001670 3300049575 Bacteria 16354
616 Ga0501040_0242101 3300049576 Bacteria 1286
617 Ga0501043_0002613 3300049579 Bacteria 15190
618 Ga0501046_0177183 3300049580 Bacteria 1596
619 Ga0501047_0029682 3300049581 Bacteria 5272
620 Ga0501047_0261489 3300049581 Bacteria 1578
621 Ga0501047_0298684 3300049581 Bacteria 1453
622 Ga0501069_0044707 3300049585 Bacteria 2452
623 Ga0501070_0786090 3300049586 Bacteria 748
624 Ga0501035_0005039 3300049822 Bacteria 12510
625 Ga0501044_0000150 3300049823 Bacteria 85886
626 Ga0501044_0044651 3300049823 Bacteria 4598
627 Ga0501044_0205321 3300049823 Bacteria 1927
628 Ga0501044_0271268 3300049823 Bacteria 1632
629 nmdc:mga03n38_18459_c1 3300050490 Bacteria 2754
630 nmdc:mga03n38_20052_c1 3300050490 Bacteria 2668
631 nmdc:mga03n38_21497_c1 3300050490 Bacteria 2597
632 nmdc:mga03n38_2985_c1 3300050490 Bacteria 5352
633 nmdc:mga03n38_3516_c1 3300050490 Bacteria 5049
634 nmdc:mga00v17_105056_c1 3300050491 Bacteria 1786
635 nmdc:mga00v17_167213_c1 3300050491 Bacteria 1417
636 nmdc:mga00v17_189928_c1 3300050491 Bacteria 1326
637 nmdc:mga00v17_4304_c1 3300050491 Bacteria 7393
638 nmdc:mga00v17_5980_c1 3300050491 Bacteria 6438
639 nmdc:mga00v17_76422_c1 3300050491 Bacteria 2083
640 nmdc:mga0yw44_11615_c1 3300050492 Bacteria 4557
641 nmdc:mga0yw44_127509_c2 3300050492 Bacteria 1026
642 nmdc:mga0yw44_3661_c2 3300050492 Bacteria 4387
643 nmdc:mga06z11_48663_c1 3300050494 Bacteria 2159
644 nmdc:mga04h51_145009_c1 3300050495 Bacteria 903
645 nmdc:mga07m45_110204_c1 3300050496 Bacteria 966
646 nmdc:mga07m45_147162_c1 3300050496 Bacteria 1365
647 nmdc:mga07m45_46592_c2 3300050496 Bacteria 1219
648 nmdc:mga05p37_9376_c1 3300050507 Bacteria 11585
649 nmdc:mga0qj67_173006_c1 3300050509 Bacteria 1754
650 nmdc:mga06r32_76788_c1 3300050510 Bacteria 3244
651 nmdc:mga08y16_550944_c1 3300050511 Bacteria 1167
652 nmdc:mga08y16_913761_c1 3300050511 Bacteria 863
653 nmdc:mga0sz30_11783_c1 3300050516 Bacteria 3386
654 nmdc:mga0sz30_14241_c1 3300050516 Bacteria 3126
655 nmdc:mga0sz30_2129_c1 3300050516 Bacteria 7075
656 nmdc:mga0sz30_22661_c1 3300050516 Bacteria 2551
657 nmdc:mga0sz30_232075_c1 3300050516 Bacteria 821
658 nmdc:mga0sz30_34722_c1 3300050516 Bacteria 2101
659 nmdc:mga0sz30_39939_c1 3300050516 Bacteria 918
660 nmdc:mga0sz30_7123_c1 3300050516 Bacteria 4183
661 nmdc:mga0sz30_8334_c1 3300050516 Bacteria 3910
662 Ga0500610_0009568 3300053079 Bacteria 4307
663 Ga0500635_0001998 3300053080 Bacteria 4977
664 Ga0500643_000986 3300053087 Bacteria 17489
665 Ga0500643_005407 3300053087 Bacteria 5509
666 Ga0500562_054533 3300053108 Bacteria 1071
667 Ga0500642_0067593 3300053130 Bacteria 1620
668 Ga0500652_001168 3300053131 Bacteria 8385
669 Ga0500652_001181 3300053131 Bacteria 8340
670 Ga0500652_036148 3300053131 Bacteria 1965
671 Ga0500559_0004792 3300053136 Bacteria 6335
672 Ga0500559_0008521 3300053136 Bacteria 4488
673 Ga0500559_0177783 3300053136 Bacteria 1002
674 Ga0500577_0004330 3300053142 Bacteria 3747
675 Ga0500588_0045998 3300053146 Bacteria 1340
676 Ga0500616_0007595 3300053153 Bacteria 6855
677 Ga0500616_0035258 3300053153 Bacteria 2721
678 Ga0500627_0010274 3300053158 Bacteria 3408
679 Ga0500627_0010700 3300053158 Bacteria 3355
680 Ga0500645_000007 3300053730 Bacteria 233700
681 Ga0500645_000025 3300053730 Bacteria 125835
682 Ga0500645_059016 3300053730 Bacteria 1111

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0188020 Ga0495665_0188020_496_1059 186
2 3300025893 Ga0207682_10328334 Ga0207682_103283341 188
3 3300039447 Ga0436361_0761186 Ga0436361_0761186_586_1299 190
4 3300006028 Ga0070717_10055988 Ga0070717_100559882 196
5 3300048905 Ga0496102_0078246 Ga0496102_0078246_127_798 198
6 3300048906 Ga0496103_0163072 Ga0496103_0163072_430_1101 198
7 3300048921 Ga0496118_0000505 Ga0496118_0000505_24737_25408 198
8 3300044719 Ga0466971_0025853 Ga0466971_0025853_874_1545 199
9 3300044842 Ga0466957_0286968 Ga0466957_0286968_350_1021 199
10 3300041456 Ga0451795_1539735 Ga0451795_1539735_517_1212 201
11 3300041460 Ga0451802_1840921 Ga0451802_1840921_352_1047 201
12 3300003203 JGI25406J46586_10004064 JGI25406J46586_100040645 205
13 3300005985 Ga0081539_10000027 Ga0081539_10000027130 205
14 iso_pu_bacteria 2738543034 2739363284 205
15 3300005356 Ga0070674_100085854 Ga0070674_1000858543 206
16 iso_pu_bacteria 2551306166 2552107360 206
17 iso_pu_bacteria 2643221692 2644518199 206
18 iso_pu_bacteria 2904765812 2904767097 206
19 iso_pu_bacteria 2904770941 2904773858 206
20 iso_pu_bacteria 2908811453 2908814742 206
21 iso_pu_bacteria 2919420072 2919420455 206
22 iso_pu_bacteria 2919432681 2919433787 206
23 3300047315 Ga0495581_0006653 Ga0495581_0006653_2813_3448 207
24 3300028380 Ga0268265_10740188 Ga0268265_107401882 208
25 3300045976 Ga0466967_0004060 Ga0466967_0004060_8866_9498 208
26 3300005436 Ga0070713_100780554 Ga0070713_1007805541 209
27 3300006051 Ga0075364_10183317 Ga0075364_101833172 209
28 3300006177 Ga0075362_10168498 Ga0075362_101684981 209
29 3300006178 Ga0075367_10286453 Ga0075367_102864532 209
30 3300028794 Ga0307515_10055239 Ga0307515_100552395 209
31 3300050491 nmdc:mga00v17_167213_c1 nmdc:mga00v17_167213_c1_294_929 209
32 iso_pu_bacteria 2738543028 2739328628 209
33 iso_pu_bacteria 2870782633 2870790440 209
34 iso_pu_bacteria 2956939328 2956941146 209
35 iso_pu_bacteria 3001119090 3001120834 209
36 3300005468 Ga0070707_100003248 Ga0070707_1000032485 210
37 3300006178 Ga0075367_10199756 Ga0075367_101997562 210
38 3300009092 Ga0105250_10099289 Ga0105250_100992892 210
39 3300025910 Ga0207684_10061299 Ga0207684_100612992 210
40 3300025922 Ga0207646_10006610 Ga0207646_100066108 210
41 3300046663 Ga0495635_0440364 Ga0495635_0440364_214_849 210
42 3300048907 Ga0496104_0736661 Ga0496104_0736661_30_677 210
43 3300049586 Ga0501070_0786090 Ga0501070_0786090_82_714 210
44 3300053136 Ga0500559_0008521 Ga0500559_0008521_490_1125 210
45 iso_pu_bacteria 2558860112 2558909644 210
46 iso_pu_bacteria 2899359706 2899363265 210
47 iso_pu_bacteria 2919713450 2919713561 210
48 3300005436 Ga0070713_100679440 Ga0070713_1006794401 211
49 3300005456 Ga0070678_100484260 Ga0070678_1004842601 211
50 3300025929 Ga0207664_10563152 Ga0207664_105631522 211
51 3300044683 Ga0466965_0217396 Ga0466965_0217396_166_810 211
52 3300044694 Ga0466963_0117387 Ga0466963_0117387_963_1607 211
53 3300045836 Ga0466958_0485170 Ga0466958_0485170_49_693 211
54 3300048922 Ga0496119_0060206 Ga0496119_0060206_1356_2015 211
55 3300049569 Ga0501032_0000802 Ga0501032_0000802_2027_2662 211
56 3300049571 Ga0501034_0010251 Ga0501034_0010251_1840_2475 211
57 3300049573 Ga0501037_0001268 Ga0501037_0001268_8640_9275 211
58 3300049574 Ga0501038_0001207 Ga0501038_0001207_14612_15247 211
59 3300049575 Ga0501039_0001670 Ga0501039_0001670_14293_14928 211
60 3300049576 Ga0501040_0242101 Ga0501040_0242101_162_797 211
61 3300049579 Ga0501043_0002613 Ga0501043_0002613_8212_8847 211
62 iso_pu_bacteria 2558860112 2558913793 211
63 iso_pu_bacteria 2643221687 2644489026 211
64 iso_pu_bacteria 2738541264 2738667697 211
65 iso_pu_bacteria 2738541274 2738705796 211
66 iso_pu_bacteria 2738541356 2739146767 211
67 iso_pu_bacteria 2738543011 2739240143 211
68 iso_pu_bacteria 2738543028 2739330286 211
69 iso_pu_bacteria 2842134933 2842139391 211
70 iso_pu_bacteria 2870782633 2870790394 211
71 iso_pu_bacteria 2889300758 2889303371 211
72 iso_pu_bacteria 2902792274 2902792611 211
73 iso_pu_bacteria 2902799365 2902800141 211
74 iso_pu_bacteria 2939582691 2939587618 211
75 iso_pu_bacteria 2939743619 2939748565 211
76 3300005434 Ga0070709_10030246 Ga0070709_100302464 212
77 3300005436 Ga0070713_100041193 Ga0070713_1000411931 212
78 3300006028 Ga0070717_10265505 Ga0070717_102655051 212
79 3300006048 Ga0075363_100106936 Ga0075363_1001069362 212
80 3300009148 Ga0105243_10013745 Ga0105243_100137452 212
81 3300025294 Ga0209025_1110762 Ga0209025_11107621 212
82 3300025906 Ga0207699_10019581 Ga0207699_100195812 212
83 3300025929 Ga0207664_10088780 Ga0207664_100887802 212
84 3300025935 Ga0207709_10259883 Ga0207709_102598831 212
85 3300041512 Ga0451853_2813990 Ga0451853_2813990_989_1639 212
86 3300044765 Ga0466970_0197000 Ga0466970_0197000_98_739 212
87 3300047321 Ga0495676_0178612 Ga0495676_0178612_110_787 212
88 3300047472 Ga0495686_0158823 Ga0495686_0158823_508_1146 212
89 3300048905 Ga0496102_0436643 Ga0496102_0436643_409_1083 212
90 3300050491 nmdc:mga00v17_189928_c1 nmdc:mga00v17_189928_c1_557_1198 212
91 iso_pu_bacteria 2643221715 2644634805 212
92 iso_pu_bacteria 2791354901 2791916558 212
93 iso_pu_bacteria 2795385470 2795781939 212
94 3300005356 Ga0070674_100008790 Ga0070674_1000087902 213
95 3300006931 Ga0097620_100515530 Ga0097620_1005155302 213
96 3300025937 Ga0207669_10056441 Ga0207669_100564413 213
97 3300036712 Ga0316584_0015074 Ga0316584_0015074_1344_1985 213
98 3300045976 Ga0466967_0988248 Ga0466967_0988248_40_681 213
99 3300046501 Ga0495607_0006562 Ga0495607_0006562_80_721 213
100 3300046675 Ga0495657_0155126 Ga0495657_0155126_709_1368 213
101 3300047323 Ga0495683_0000316 Ga0495683_0000316_32608_33249 213
102 3300048904 Ga0496101_0099777 Ga0496101_0099777_461_1114 213
103 3300048905 Ga0496102_0025597 Ga0496102_0025597_1899_2552 213
104 3300048909 Ga0496106_0052538 Ga0496106_0052538_1606_2259 213
105 3300048928 Ga0496125_0351198 Ga0496125_0351198_85_726 213
106 3300048929 Ga0496126_0037423 Ga0496126_0037423_1219_1860 213
107 3300049581 Ga0501047_0298684 Ga0501047_0298684_644_1312 213
108 3300049585 Ga0501069_0044707 Ga0501069_0044707_1345_2013 213
109 3300049823 Ga0501044_0044651 Ga0501044_0044651_488_1129 213
110 3300053080 Ga0500635_0001998 Ga0500635_0001998_3173_3826 213
111 3300053087 Ga0500643_005407 Ga0500643_005407_106_747 213
112 3300053131 Ga0500652_001181 Ga0500652_001181_4019_4672 213
113 3300053131 Ga0500652_036148 Ga0500652_036148_931_1572 213
114 3300053136 Ga0500559_0004792 Ga0500559_0004792_2919_3560 213
115 3300053158 Ga0500627_0010274 Ga0500627_0010274_1256_1897 213
116 3300053730 Ga0500645_000025 Ga0500645_000025_47043_47684 213
117 3300005435 Ga0070714_100370711 Ga0070714_1003707111 214
118 3300005535 Ga0070684_100132819 Ga0070684_1001328193 214
119 3300005937 Ga0081455_10000667 Ga0081455_1000066716 214
120 3300009094 Ga0111539_10233122 Ga0111539_102331222 214
121 3300009148 Ga0105243_10790841 Ga0105243_107908411 214
122 3300030522 Ga0307512_10024587 Ga0307512_100245873 214
123 3300031456 Ga0307513_10245457 Ga0307513_102454572 214
124 3300045836 Ga0466958_0132137 Ga0466958_0132137_878_1522 214
125 3300046543 Ga0495645_0164747 Ga0495645_0164747_783_1430 214
126 3300047323 Ga0495683_0002516 Ga0495683_0002516_4438_5082 214
127 3300047472 Ga0495686_0000767 Ga0495686_0000767_17091_17741 214
128 3300048904 Ga0496101_0214736 Ga0496101_0214736_46_693 214
129 3300048906 Ga0496103_0280237 Ga0496103_0280237_366_1013 214
130 3300048907 Ga0496104_0244496 Ga0496104_0244496_565_1212 214
131 3300048915 Ga0496112_0424970 Ga0496112_0424970_527_1174 214
132 3300048916 Ga0496113_0002057 Ga0496113_0002057_5006_5653 214
133 3300048925 Ga0496122_0011900 Ga0496122_0011900_6856_7503 214
134 3300048926 Ga0496123_0025319 Ga0496123_0025319_1367_2014 214
135 3300048928 Ga0496125_0082997 Ga0496125_0082997_1654_2301 214
136 3300048929 Ga0496126_0004884 Ga0496126_0004884_5751_6398 214
137 3300049581 Ga0501047_0261489 Ga0501047_0261489_869_1537 214
138 3300049823 Ga0501044_0271268 Ga0501044_0271268_85_753 214
139 3300050511 nmdc:mga08y16_550944_c1 nmdc:mga08y16_550944_c1_111_755 214
140 iso_pu_bacteria 2547132424 2548697148 214
141 3300003792 Ga0055540_1000147 Ga0055540_100014721 215
142 3300003792 Ga0055540_1000953 Ga0055540_10009535 215
143 3300003792 Ga0055540_1004309 Ga0055540_10043092 215
144 3300005289 Ga0065704_10206698 Ga0065704_102066982 215
145 3300005330 Ga0070690_100063818 Ga0070690_1000638183 215
146 3300005335 Ga0070666_10032346 Ga0070666_100323462 215
147 3300005347 Ga0070668_100402416 Ga0070668_1004024162 215
148 3300005347 Ga0070668_100524146 Ga0070668_1005241462 215
149 3300005353 Ga0070669_100001478 Ga0070669_10000147815 215
150 3300005355 Ga0070671_100375338 Ga0070671_1003753381 215
151 3300005367 Ga0070667_100000042 Ga0070667_100000042113 215
152 3300005367 Ga0070667_100002534 Ga0070667_1000025349 215
153 3300005434 Ga0070709_10032912 Ga0070709_100329124 215
154 3300005435 Ga0070714_100005869 Ga0070714_1000058695 215
155 3300005437 Ga0070710_10090134 Ga0070710_100901342 215
156 3300005455 Ga0070663_100529679 Ga0070663_1005296791 215
157 3300005456 Ga0070678_100209014 Ga0070678_1002090142 215
158 3300005456 Ga0070678_100732809 Ga0070678_1007328091 215
159 3300005539 Ga0068853_100043268 Ga0068853_1000432684 215
160 3300005548 Ga0070665_100002665 Ga0070665_10000266518 215
161 3300005617 Ga0068859_100059900 Ga0068859_1000599002 215
162 3300005841 Ga0068863_100000621 Ga0068863_1000006215 215
163 3300005841 Ga0068863_100407907 Ga0068863_1004079073 215
164 3300005842 Ga0068858_100013740 Ga0068858_1000137404 215
165 3300005843 Ga0068860_100000020 Ga0068860_10000002046 215
166 3300005844 Ga0068862_100000013 Ga0068862_10000001328 215
167 3300005981 Ga0081538_10057642 Ga0081538_100576422 215
168 3300006028 Ga0070717_10102191 Ga0070717_101021913 215
169 3300006038 Ga0075365_10007302 Ga0075365_100073024 215
170 3300006051 Ga0075364_10073739 Ga0075364_100737392 215
171 3300006178 Ga0075367_10033423 Ga0075367_100334232 215
172 3300006186 Ga0075369_10009883 Ga0075369_100098832 215
173 3300006186 Ga0075369_10014091 Ga0075369_100140912 215
174 3300006186 Ga0075369_10021331 Ga0075369_100213314 215
175 3300006931 Ga0097620_100059895 Ga0097620_1000598952 215
176 3300009098 Ga0105245_10993997 Ga0105245_109939971 215
177 3300009101 Ga0105247_10000009 Ga0105247_10000009145 215
178 3300009148 Ga0105243_10509579 Ga0105243_105095791 215
179 3300009177 Ga0105248_10000109 Ga0105248_1000010928 215
180 3300009177 Ga0105248_10048242 Ga0105248_100482422 215
181 3300009545 Ga0105237_10000587 Ga0105237_1000058743 215
182 3300009545 Ga0105237_10016819 Ga0105237_100168192 215
183 3300009553 Ga0105249_10000011 Ga0105249_1000001170 215
184 3300009553 Ga0105249_10750533 Ga0105249_107505332 215
185 3300010375 Ga0105239_10011860 Ga0105239_100118608 215
186 3300010375 Ga0105239_10017470 Ga0105239_100174707 215
187 3300011119 Ga0105246_10273986 Ga0105246_102739862 215
188 3300013306 Ga0163162_10086089 Ga0163162_100860893 215
189 3300013308 Ga0157375_10136305 Ga0157375_101363054 215
190 3300014325 Ga0163163_10006691 Ga0163163_100066912 215
191 3300014968 Ga0157379_10122984 Ga0157379_101229842 215
192 3300014969 Ga0157376_10303248 Ga0157376_103032483 215
193 3300025303 Ga0209051_1000333 Ga0209051_100033321 215
194 3300025303 Ga0209051_1000520 Ga0209051_100052041 215
195 3300025303 Ga0209051_1000717 Ga0209051_100071735 215
196 3300025303 Ga0209051_1031282 Ga0209051_10312822 215
197 3300025303 Ga0209051_1081288 Ga0209051_10812881 215
198 3300025898 Ga0207692_10081045 Ga0207692_100810452 215
199 3300025900 Ga0207710_10000014 Ga0207710_10000014162 215
200 3300025903 Ga0207680_10070547 Ga0207680_100705472 215
201 3300025904 Ga0207647_10170793 Ga0207647_101707932 215
202 3300025906 Ga0207699_10054119 Ga0207699_100541192 215
203 3300025914 Ga0207671_10066155 Ga0207671_100661554 215
204 3300025914 Ga0207671_10113907 Ga0207671_101139072 215
205 3300025923 Ga0207681_10051810 Ga0207681_100518102 215
206 3300025928 Ga0207700_10142567 Ga0207700_101425672 215
207 3300025929 Ga0207664_10779292 Ga0207664_107792921 215
208 3300025941 Ga0207711_10000322 Ga0207711_1000032228 215
209 3300025941 Ga0207711_10127926 Ga0207711_101279263 215
210 3300025961 Ga0207712_10000020 Ga0207712_10000020209 215
211 3300025972 Ga0207668_10003993 Ga0207668_100039936 215
212 3300025972 Ga0207668_10286561 Ga0207668_102865611 215
213 3300025986 Ga0207658_10000055 Ga0207658_1000005546 215
214 3300025986 Ga0207658_10001485 Ga0207658_100014859 215
215 3300026035 Ga0207703_10009452 Ga0207703_100094525 215
216 3300026041 Ga0207639_10072670 Ga0207639_100726702 215
217 3300026067 Ga0207678_10359287 Ga0207678_103592872 215
218 3300026088 Ga0207641_10003088 Ga0207641_100030885 215
219 3300028379 Ga0268266_10081328 Ga0268266_100813282 215
220 3300028380 Ga0268265_10000004 Ga0268265_10000004224 215
221 3300028381 Ga0268264_10000024 Ga0268264_10000024226 215
222 3300031251 Ga0265327_10000964 Ga0265327_1000096416 215
223 3300031251 Ga0265327_10028389 Ga0265327_100283892 215
224 3300031824 Ga0307413_10392857 Ga0307413_103928572 215
225 3300031852 Ga0307410_10069603 Ga0307410_100696032 215
226 3300032002 Ga0307416_100074799 Ga0307416_1000747992 215
227 3300032002 Ga0307416_100645697 Ga0307416_1006456972 215
228 3300036712 Ga0316584_0138875 Ga0316584_0138875_1016_1663 215
229 3300039450 Ga0436363_0146676 Ga0436363_0146676_559_1275 215
230 3300041494 Ga0451837_1099642 Ga0451837_1099642_153_800 215
231 3300044658 Ga0466972_0016979 Ga0466972_0016979_2089_2736 215
232 3300044735 Ga0466968_0001467 Ga0466968_0001467_4539_5186 215
233 3300044842 Ga0466957_0006319 Ga0466957_0006319_2331_2978 215
234 3300044901 Ga0466960_0000254 Ga0466960_0000254_336_983 215
235 3300045049 Ga0466959_0097113 Ga0466959_0097113_150_797 215
236 3300045976 Ga0466967_0018811 Ga0466967_0018811_3616_4263 215
237 3300046460 Ga0495638_0001425 Ga0495638_0001425_6778_7530 215
238 3300046460 Ga0495638_0016648 Ga0495638_0016648_2135_2887 215
239 3300046460 Ga0495638_0022263 Ga0495638_0022263_555_1202 215
240 3300046507 Ga0495606_0012168 Ga0495606_0012168_2397_3044 215
241 3300046524 Ga0495648_0006285 Ga0495648_0006285_1710_2357 215
242 3300046616 Ga0495668_0030531 Ga0495668_0030531_1957_2604 215
243 3300046648 Ga0495611_0030198 Ga0495611_0030198_64_711 215
244 3300046660 Ga0495625_0086223 Ga0495625_0086223_444_1196 215
245 3300046660 Ga0495625_0512166 Ga0495625_0512166_55_702 215
246 3300047320 Ga0495672_0009344 Ga0495672_0009344_2681_3328 215
247 3300047469 Ga0495673_0007756 Ga0495673_0007756_2143_2790 215
248 3300048903 Ga0496100_0000111 Ga0496100_0000111_33891_34538 215
249 3300048903 Ga0496100_0000406 Ga0496100_0000406_19612_20364 215
250 3300048903 Ga0496100_0024790 Ga0496100_0024790_2766_3413 215
251 3300048904 Ga0496101_0000091 Ga0496101_0000091_29571_30323 215
252 3300048904 Ga0496101_0000103 Ga0496101_0000103_36796_37443 215
253 3300048904 Ga0496101_0007249 Ga0496101_0007249_211_858 215
254 3300048904 Ga0496101_0010006 Ga0496101_0010006_4896_5648 215
255 3300048905 Ga0496102_0000016 Ga0496102_0000016_225262_226014 215
256 3300048905 Ga0496102_0000451 Ga0496102_0000451_7500_8147 215
257 3300048905 Ga0496102_0082914 Ga0496102_0082914_1269_1916 215
258 3300048906 Ga0496103_0000015 Ga0496103_0000015_60761_61513 215
259 3300048906 Ga0496103_0001793 Ga0496103_0001793_7596_8243 215
260 3300048906 Ga0496103_0007217 Ga0496103_0007217_3269_3916 215
261 3300048907 Ga0496104_0898994 Ga0496104_0898994_98_745 215
262 3300048908 Ga0496105_0078328 Ga0496105_0078328_1427_2179 215
263 3300048908 Ga0496105_0138269 Ga0496105_0138269_944_1696 215
264 3300048909 Ga0496106_0005443 Ga0496106_0005443_1014_1661 215
265 3300048909 Ga0496106_0021401 Ga0496106_0021401_3653_4405 215
266 3300048910 Ga0496107_0008519 Ga0496107_0008519_2662_3309 215
267 3300048910 Ga0496107_0010233 Ga0496107_0010233_5199_5951 215
268 3300048911 Ga0496108_0003194 Ga0496108_0003194_7274_7921 215
269 3300048911 Ga0496108_0289633 Ga0496108_0289633_268_1020 215
270 3300048912 Ga0496109_0000562 Ga0496109_0000562_10528_11175 215
271 3300048913 Ga0496110_0024078 Ga0496110_0024078_3666_4313 215
272 3300048916 Ga0496113_0075998 Ga0496113_0075998_35_682 215
273 3300048917 Ga0496114_0005368 Ga0496114_0005368_7603_8355 215
274 3300048917 Ga0496114_0276246 Ga0496114_0276246_35_682 215
275 3300048918 Ga0496115_0045816 Ga0496115_0045816_492_1244 215
276 3300048918 Ga0496115_0051265 Ga0496115_0051265_1780_2427 215
277 3300048918 Ga0496115_0238309 Ga0496115_0238309_578_1225 215
278 3300048919 Ga0496116_0000055 Ga0496116_0000055_60948_61700 215
279 3300048919 Ga0496116_0017473 Ga0496116_0017473_24_671 215
280 3300048919 Ga0496116_0018185 Ga0496116_0018185_2679_3326 215
281 3300048920 Ga0496117_0000006 Ga0496117_0000006_696895_697647 215
282 3300048920 Ga0496117_0000280 Ga0496117_0000280_11875_12522 215
283 3300048921 Ga0496118_0000004 Ga0496118_0000004_696895_697647 215
284 3300048921 Ga0496118_0010921 Ga0496118_0010921_889_1536 215
285 3300048922 Ga0496119_0004681 Ga0496119_0004681_11698_12345 215
286 3300048922 Ga0496119_0016780 Ga0496119_0016780_3819_4571 215
287 3300048922 Ga0496119_0077816 Ga0496119_0077816_806_1453 215
288 3300048923 Ga0496120_0000272 Ga0496120_0000272_29896_30648 215
289 3300048923 Ga0496120_0003889 Ga0496120_0003889_6407_7054 215
290 3300048923 Ga0496120_0015574 Ga0496120_0015574_2044_2691 215
291 3300048923 Ga0496120_0166763 Ga0496120_0166763_270_923 215
292 3300048924 Ga0496121_0000134 Ga0496121_0000134_113891_114538 215
293 3300048924 Ga0496121_0000331 Ga0496121_0000331_72966_73718 215
294 3300048924 Ga0496121_0001052 Ga0496121_0001052_37001_37648 215
295 3300048924 Ga0496121_0375458 Ga0496121_0375458_208_855 215
296 3300048925 Ga0496122_0000453 Ga0496122_0000453_33261_33908 215
297 3300048925 Ga0496122_0287503 Ga0496122_0287503_200_847 215
298 3300048926 Ga0496123_0011572 Ga0496123_0011572_4724_5371 215
299 3300048927 Ga0496124_0000113 Ga0496124_0000113_51191_51838 215
300 3300048927 Ga0496124_0007312 Ga0496124_0007312_2074_2721 215
301 3300048927 Ga0496124_0019870 Ga0496124_0019870_470_1117 215
302 3300048928 Ga0496125_0000127 Ga0496125_0000127_113873_114520 215
303 3300048928 Ga0496125_0269324 Ga0496125_0269324_22_669 215
304 3300048929 Ga0496126_0000140 Ga0496126_0000140_51191_51838 215
305 3300048929 Ga0496126_0000675 Ga0496126_0000675_28455_29207 215
306 3300048929 Ga0496126_0016629 Ga0496126_0016629_1193_1840 215
307 3300048929 Ga0496126_0467960 Ga0496126_0467960_221_868 215
308 3300049568 Ga0501031_0468258 Ga0501031_0468258_67_774 215
309 3300049570 Ga0501033_0051666 Ga0501033_0051666_875_1582 215
310 3300049571 Ga0501034_0122633 Ga0501034_0122633_139_846 215
311 3300049580 Ga0501046_0177183 Ga0501046_0177183_661_1368 215
312 3300049581 Ga0501047_0029682 Ga0501047_0029682_3880_4587 215
313 3300049822 Ga0501035_0005039 Ga0501035_0005039_2444_3151 215
314 3300049823 Ga0501044_0000150 Ga0501044_0000150_76160_76867 215
315 3300049823 Ga0501044_0205321 Ga0501044_0205321_39_866 215
316 3300050490 nmdc:mga03n38_18459_c1 nmdc:mga03n38_18459_c1_2081_2728 215
317 3300050491 nmdc:mga00v17_105056_c1 nmdc:mga00v17_105056_c1_785_1522 215
318 3300050492 nmdc:mga0yw44_11615_c1 nmdc:mga0yw44_11615_c1_3753_4400 215
319 3300050494 nmdc:mga06z11_48663_c1 nmdc:mga06z11_48663_c1_916_1563 215
320 3300050496 nmdc:mga07m45_110204_c1 nmdc:mga07m45_110204_c1_67_714 215
321 3300050496 nmdc:mga07m45_147162_c1 nmdc:mga07m45_147162_c1_248_898 215
322 3300050511 nmdc:mga08y16_913761_c1 nmdc:mga08y16_913761_c1_73_720 215
323 3300050516 nmdc:mga0sz30_14241_c1 nmdc:mga0sz30_14241_c1_2330_2977 215
324 3300050516 nmdc:mga0sz30_39939_c1 nmdc:mga0sz30_39939_c1_202_873 215
325 3300053079 Ga0500610_0009568 Ga0500610_0009568_531_1283 215
326 3300053087 Ga0500643_000986 Ga0500643_000986_13491_14138 215
327 3300053131 Ga0500652_001168 Ga0500652_001168_5045_5692 215
328 3300053136 Ga0500559_0177783 Ga0500559_0177783_68_715 215
329 3300053142 Ga0500577_0004330 Ga0500577_0004330_677_1327 215
330 3300053146 Ga0500588_0045998 Ga0500588_0045998_102_749 215
331 3300053153 Ga0500616_0007595 Ga0500616_0007595_328_975 215
332 3300053153 Ga0500616_0035258 Ga0500616_0035258_179_931 215
333 3300053158 Ga0500627_0010700 Ga0500627_0010700_2421_3068 215
334 3300053730 Ga0500645_000007 Ga0500645_000007_77925_78572 215
335 3300053730 Ga0500645_059016 Ga0500645_059016_223_870 215
336 iso_pu_bacteria 2902810491 2902813654 215
337 iso_pu_bacteria 8056060235 8056064116 215
338 3300001977 JGI24746J21847_1008506 JGI24746J21847_10085062 216
339 3300001989 JGI24739J22299_10040638 JGI24739J22299_100406382 216
340 3300001991 JGI24743J22301_10009379 JGI24743J22301_100093792 216
341 3300001991 JGI24743J22301_10012875 JGI24743J22301_100128752 216
342 3300002070 JGI24750J21931_1005879 JGI24750J21931_10058792 216
343 3300002073 JGI24745J21846_1018384 JGI24745J21846_10183841 216
344 3300002074 JGI24748J21848_1004048 JGI24748J21848_10040481 216
345 3300002075 JGI24738J21930_10013664 JGI24738J21930_100136642 216
346 3300002077 JGI24744J21845_10005407 JGI24744J21845_100054073 216
347 3300002077 JGI24744J21845_10015152 JGI24744J21845_100151522 216
348 3300002239 JGI24034J26672_10001864 JGI24034J26672_100018642 216
349 3300002244 JGI24742J22300_10002085 JGI24742J22300_100020853 216
350 3300005328 Ga0070676_10010895 Ga0070676_100108952 216
351 3300005330 Ga0070690_100001081 Ga0070690_10000108118 216
352 3300005334 Ga0068869_100028484 Ga0068869_1000284843 216
353 3300005335 Ga0070666_10053870 Ga0070666_100538702 216
354 3300005337 Ga0070682_100006705 Ga0070682_1000067052 216
355 3300005337 Ga0070682_100128683 Ga0070682_1001286832 216
356 3300005338 Ga0068868_100002489 Ga0068868_1000024894 216
357 3300005338 Ga0068868_100068933 Ga0068868_1000689333 216
358 3300005338 Ga0068868_100288064 Ga0068868_1002880641 216
359 3300005339 Ga0070660_100109163 Ga0070660_1001091632 216
360 3300005339 Ga0070660_100673765 Ga0070660_1006737651 216
361 3300005340 Ga0070689_100007750 Ga0070689_1000077504 216
362 3300005341 Ga0070691_10011741 Ga0070691_100117412 216
363 3300005341 Ga0070691_10107500 Ga0070691_101075002 216
364 3300005343 Ga0070687_100027796 Ga0070687_1000277963 216
365 3300005345 Ga0070692_10058134 Ga0070692_100581341 216
366 3300005345 Ga0070692_10093407 Ga0070692_100934072 216
367 3300005347 Ga0070668_100085784 Ga0070668_1000857842 216
368 3300005347 Ga0070668_100261860 Ga0070668_1002618602 216
369 3300005347 Ga0070668_100572743 Ga0070668_1005727432 216
370 3300005347 Ga0070668_100770667 Ga0070668_1007706671 216
371 3300005353 Ga0070669_100006033 Ga0070669_1000060334 216
372 3300005354 Ga0070675_100118923 Ga0070675_1001189233 216
373 3300005355 Ga0070671_100096936 Ga0070671_1000969363 216
374 3300005356 Ga0070674_100001375 Ga0070674_1000013757 216
375 3300005364 Ga0070673_100238018 Ga0070673_1002380182 216
376 3300005365 Ga0070688_100006802 Ga0070688_1000068023 216
377 3300005365 Ga0070688_100039010 Ga0070688_1000390103 216
378 3300005366 Ga0070659_100081095 Ga0070659_1000810953 216
379 3300005366 Ga0070659_100196580 Ga0070659_1001965802 216
380 3300005366 Ga0070659_100280646 Ga0070659_1002806461 216
381 3300005367 Ga0070667_100002142 Ga0070667_1000021422 216
382 3300005367 Ga0070667_100003309 Ga0070667_1000033097 216
383 3300005367 Ga0070667_100553478 Ga0070667_1005534782 216
384 3300005406 Ga0070703_10125383 Ga0070703_101253832 216
385 3300005434 Ga0070709_10030195 Ga0070709_100301953 216
386 3300005434 Ga0070709_10039422 Ga0070709_100394222 216
387 3300005437 Ga0070710_10001686 Ga0070710_100016863 216
388 3300005438 Ga0070701_10036841 Ga0070701_100368412 216
389 3300005438 Ga0070701_10054527 Ga0070701_100545272 216
390 3300005439 Ga0070711_100000565 Ga0070711_10000056517 216
391 3300005439 Ga0070711_100067070 Ga0070711_1000670702 216
392 3300005440 Ga0070705_100005383 Ga0070705_1000053833 216
393 3300005441 Ga0070700_100001381 Ga0070700_1000013817 216
394 3300005441 Ga0070700_100075184 Ga0070700_1000751843 216
395 3300005441 Ga0070700_100083552 Ga0070700_1000835522 216
396 3300005444 Ga0070694_100007860 Ga0070694_1000078604 216
397 3300005444 Ga0070694_100227795 Ga0070694_1002277951 216
398 3300005455 Ga0070663_100003370 Ga0070663_1000033707 216
399 3300005455 Ga0070663_100072165 Ga0070663_1000721653 216
400 3300005456 Ga0070678_100001483 Ga0070678_1000014833 216
401 3300005456 Ga0070678_100062648 Ga0070678_1000626482 216
402 3300005456 Ga0070678_100450981 Ga0070678_1004509811 216
403 3300005457 Ga0070662_100004641 Ga0070662_1000046413 216
404 3300005457 Ga0070662_100218076 Ga0070662_1002180762 216
405 3300005458 Ga0070681_10382029 Ga0070681_103820292 216
406 3300005459 Ga0068867_100002757 Ga0068867_10000275712 216
407 3300005459 Ga0068867_100197911 Ga0068867_1001979112 216
408 3300005459 Ga0068867_100215438 Ga0068867_1002154382 216
409 3300005466 Ga0070685_10016055 Ga0070685_100160554 216
410 3300005471 Ga0070698_100726653 Ga0070698_1007266531 216
411 3300005539 Ga0068853_100003295 Ga0068853_1000032955 216
412 3300005539 Ga0068853_100075480 Ga0068853_1000754802 216
413 3300005539 Ga0068853_100545944 Ga0068853_1005459442 216
414 3300005543 Ga0070672_100037774 Ga0070672_1000377743 216
415 3300005543 Ga0070672_100278060 Ga0070672_1002780602 216
416 3300005544 Ga0070686_100028611 Ga0070686_1000286112 216
417 3300005544 Ga0070686_100070263 Ga0070686_1000702632 216
418 3300005545 Ga0070695_100008811 Ga0070695_1000088112 216
419 3300005545 Ga0070695_100074807 Ga0070695_1000748072 216
420 3300005546 Ga0070696_100013731 Ga0070696_1000137313 216
421 3300005546 Ga0070696_100048363 Ga0070696_1000483631 216
422 3300005546 Ga0070696_100180921 Ga0070696_1001809212 216
423 3300005547 Ga0070693_100028129 Ga0070693_1000281292 216
424 3300005548 Ga0070665_100047438 Ga0070665_1000474383 216
425 3300005548 Ga0070665_100958046 Ga0070665_1009580461 216
426 3300005549 Ga0070704_100001549 Ga0070704_1000015495 216
427 3300005549 Ga0070704_100294060 Ga0070704_1002940602 216
428 3300005578 Ga0068854_100002581 Ga0068854_1000025813 216
429 3300005578 Ga0068854_100130145 Ga0068854_1001301452 216
430 3300005578 Ga0068854_100132508 Ga0068854_1001325082 216
431 3300005578 Ga0068854_100301191 Ga0068854_1003011912 216
432 3300005614 Ga0068856_100715258 Ga0068856_1007152582 216
433 3300005615 Ga0070702_100000718 Ga0070702_1000007187 216
434 3300005615 Ga0070702_100241439 Ga0070702_1002414391 216
435 3300005616 Ga0068852_100058714 Ga0068852_1000587144 216
436 3300005616 Ga0068852_100093560 Ga0068852_1000935602 216
437 3300005617 Ga0068859_100014976 Ga0068859_1000149768 216
438 3300005618 Ga0068864_100180114 Ga0068864_1001801142 216
439 3300005618 Ga0068864_100185266 Ga0068864_1001852662 216
440 3300005718 Ga0068866_10002610 Ga0068866_100026104 216
441 3300005719 Ga0068861_100002207 Ga0068861_1000022076 216
442 3300005719 Ga0068861_100112024 Ga0068861_1001120242 216
443 3300005834 Ga0068851_10377681 Ga0068851_103776811 216
444 3300005841 Ga0068863_100017418 Ga0068863_1000174182 216
445 3300005842 Ga0068858_100010321 Ga0068858_1000103216 216
446 3300005842 Ga0068858_100015049 Ga0068858_1000150499 216
447 3300005843 Ga0068860_100007201 Ga0068860_1000072018 216
448 3300005844 Ga0068862_100004925 Ga0068862_1000049258 216
449 3300005844 Ga0068862_100124656 Ga0068862_1001246563 216
450 3300005844 Ga0068862_100228862 Ga0068862_1002288622 216
451 3300005844 Ga0068862_100544952 Ga0068862_1005449521 216
452 3300005937 Ga0081455_10041106 Ga0081455_100411063 216
453 3300005937 Ga0081455_10093898 Ga0081455_100938982 216
454 3300005937 Ga0081455_10144366 Ga0081455_101443662 216
455 3300006038 Ga0075365_10020404 Ga0075365_100204042 216
456 3300006048 Ga0075363_100000818 Ga0075363_1000008184 216
457 3300006048 Ga0075363_100036777 Ga0075363_1000367773 216
458 3300006048 Ga0075363_100065254 Ga0075363_1000652543 216
459 3300006051 Ga0075364_10007304 Ga0075364_100073044 216
460 3300006051 Ga0075364_10007949 Ga0075364_100079494 216
461 3300006051 Ga0075364_10027223 Ga0075364_100272234 216
462 3300006163 Ga0070715_10001443 Ga0070715_100014432 216
463 3300006163 Ga0070715_10024140 Ga0070715_100241402 216
464 3300006173 Ga0070716_100002440 Ga0070716_1000024406 216
465 3300006175 Ga0070712_100001326 Ga0070712_10000132619 216
466 3300006186 Ga0075369_10001462 Ga0075369_100014627 216
467 3300006186 Ga0075369_10002699 Ga0075369_100026997 216
468 3300006186 Ga0075369_10003020 Ga0075369_100030206 216
469 3300006186 Ga0075369_10023389 Ga0075369_100233891 216
470 3300006186 Ga0075369_10063762 Ga0075369_100637622 216
471 3300006186 Ga0075369_10103156 Ga0075369_101031561 216
472 3300006237 Ga0097621_100175782 Ga0097621_1001757822 216
473 3300006353 Ga0075370_10009696 Ga0075370_100096962 216
474 3300006353 Ga0075370_10131799 Ga0075370_101317992 216
475 3300006353 Ga0075370_10186266 Ga0075370_101862662 216
476 3300006358 Ga0068871_100160944 Ga0068871_1001609442 216
477 3300006844 Ga0075428_100010758 Ga0075428_1000107586 216
478 3300006846 Ga0075430_100103300 Ga0075430_1001033003 216
479 3300006847 Ga0075431_100045559 Ga0075431_1000455594 216
480 3300006881 Ga0068865_100001748 Ga0068865_1000017486 216
481 3300006881 Ga0068865_100492297 Ga0068865_1004922972 216
482 3300006931 Ga0097620_100014976 Ga0097620_1000149762 216
483 3300009036 Ga0105244_10192652 Ga0105244_101926521 216
484 3300009092 Ga0105250_10012038 Ga0105250_100120382 216
485 3300009093 Ga0105240_10512553 Ga0105240_105125532 216
486 3300009093 Ga0105240_10532185 Ga0105240_105321852 216
487 3300009098 Ga0105245_10004631 Ga0105245_100046318 216
488 3300009098 Ga0105245_10151001 Ga0105245_101510012 216
489 3300009098 Ga0105245_10176031 Ga0105245_101760311 216
490 3300009101 Ga0105247_10001964 Ga0105247_100019646 216
491 3300009101 Ga0105247_10054015 Ga0105247_100540152 216
492 3300009101 Ga0105247_10109332 Ga0105247_101093323 216
493 3300009147 Ga0114129_10008093 Ga0114129_100080936 216
494 3300009148 Ga0105243_10003417 Ga0105243_100034177 216
495 3300009148 Ga0105243_10190098 Ga0105243_101900982 216
496 3300009148 Ga0105243_10238929 Ga0105243_102389292 216
497 3300009148 Ga0105243_10286244 Ga0105243_102862441 216
498 3300009174 Ga0105241_10381362 Ga0105241_103813622 216
499 3300009176 Ga0105242_10003784 Ga0105242_100037847 216
500 3300009177 Ga0105248_10032558 Ga0105248_100325583 216
501 3300009545 Ga0105237_10015861 Ga0105237_100158616 216
502 3300009551 Ga0105238_10117062 Ga0105238_101170621 216
503 3300009553 Ga0105249_10004295 Ga0105249_100042956 216
504 3300009553 Ga0105249_10009857 Ga0105249_100098577 216
505 3300009553 Ga0105249_10880063 Ga0105249_108800632 216
506 3300010375 Ga0105239_10014224 Ga0105239_100142248 216
507 3300010375 Ga0105239_10276114 Ga0105239_102761142 216
508 3300011119 Ga0105246_10028692 Ga0105246_100286922 216
509 3300013105 Ga0157369_10124593 Ga0157369_101245933 216
510 3300013297 Ga0157378_10007770 Ga0157378_100077707 216
511 3300013297 Ga0157378_10101206 Ga0157378_101012062 216
512 3300013306 Ga0163162_10006354 Ga0163162_100063546 216
513 3300013306 Ga0163162_10036414 Ga0163162_100364142 216
514 3300013306 Ga0163162_10116251 Ga0163162_101162513 216
515 3300013307 Ga0157372_10014607 Ga0157372_100146073 216
516 3300013307 Ga0157372_10459439 Ga0157372_104594391 216
517 3300013308 Ga0157375_10004095 Ga0157375_100040956 216
518 3300013308 Ga0157375_10089136 Ga0157375_100891361 216
519 3300014325 Ga0163163_10072929 Ga0163163_100729292 216
520 3300014325 Ga0163163_10079613 Ga0163163_100796132 216
521 3300014325 Ga0163163_10742761 Ga0163163_107427612 216
522 3300014326 Ga0157380_10006086 Ga0157380_100060864 216
523 3300014326 Ga0157380_10121602 Ga0157380_101216022 216
524 3300014745 Ga0157377_10052204 Ga0157377_100522042 216
525 3300014745 Ga0157377_10052590 Ga0157377_100525902 216
526 3300014968 Ga0157379_10003994 Ga0157379_100039947 216
527 3300014968 Ga0157379_10587575 Ga0157379_105875752 216
528 3300017792 Ga0163161_10002738 Ga0163161_100027388 216
529 3300017792 Ga0163161_10091399 Ga0163161_100913992 216
530 3300021384 Ga0213876_10040018 Ga0213876_100400181 216
531 3300021384 Ga0213876_10177785 Ga0213876_101777851 216
532 3300021388 Ga0213875_10002710 Ga0213875_100027104 216
533 3300025321 Ga0207656_10258647 Ga0207656_102586472 216
534 3300025898 Ga0207692_10002807 Ga0207692_100028075 216
535 3300025899 Ga0207642_10000103 Ga0207642_1000010313 216
536 3300025900 Ga0207710_10004537 Ga0207710_100045372 216
537 3300025901 Ga0207688_10001724 Ga0207688_100017247 216
538 3300025901 Ga0207688_10004440 Ga0207688_100044408 216
539 3300025901 Ga0207688_10007439 Ga0207688_100074394 216
540 3300025901 Ga0207688_10118469 Ga0207688_101184692 216
541 3300025904 Ga0207647_10079356 Ga0207647_100793563 216
542 3300025904 Ga0207647_10099876 Ga0207647_100998762 216
543 3300025905 Ga0207685_10043018 Ga0207685_100430182 216
544 3300025906 Ga0207699_10060788 Ga0207699_100607882 216
545 3300025907 Ga0207645_10016541 Ga0207645_100165413 216
546 3300025907 Ga0207645_10028640 Ga0207645_100286402 216
547 3300025911 Ga0207654_10256097 Ga0207654_102560972 216
548 3300025913 Ga0207695_10272319 Ga0207695_102723193 216
549 3300025914 Ga0207671_10119898 Ga0207671_101198982 216
550 3300025915 Ga0207693_10003311 Ga0207693_100033114 216
551 3300025915 Ga0207693_10120569 Ga0207693_101205691 216
552 3300025915 Ga0207693_10328042 Ga0207693_103280421 216
553 3300025915 Ga0207693_10457059 Ga0207693_104570591 216
554 3300025916 Ga0207663_10000981 Ga0207663_1000098113 216
555 3300025916 Ga0207663_10071733 Ga0207663_100717333 216
556 3300025918 Ga0207662_10017713 Ga0207662_100177134 216
557 3300025918 Ga0207662_10225409 Ga0207662_102254092 216
558 3300025919 Ga0207657_10240840 Ga0207657_102408402 216
559 3300025919 Ga0207657_10258820 Ga0207657_102588202 216
560 3300025923 Ga0207681_10005669 Ga0207681_100056696 216
561 3300025926 Ga0207659_10249947 Ga0207659_102499472 216
562 3300025927 Ga0207687_10002874 Ga0207687_100028744 216
563 3300025927 Ga0207687_10066920 Ga0207687_100669203 216
564 3300025927 Ga0207687_10417739 Ga0207687_104177391 216
565 3300025929 Ga0207664_10138195 Ga0207664_101381953 216
566 3300025931 Ga0207644_10041414 Ga0207644_100414143 216
567 3300025932 Ga0207690_10373009 Ga0207690_103730092 216
568 3300025932 Ga0207690_10389726 Ga0207690_103897262 216
569 3300025933 Ga0207706_10010422 Ga0207706_100104225 216
570 3300025933 Ga0207706_10039924 Ga0207706_100399244 216
571 3300025933 Ga0207706_10054717 Ga0207706_100547173 216
572 3300025934 Ga0207686_10001839 Ga0207686_100018394 216
573 3300025935 Ga0207709_10007208 Ga0207709_100072084 216
574 3300025935 Ga0207709_10064704 Ga0207709_100647042 216
575 3300025936 Ga0207670_10070046 Ga0207670_100700462 216
576 3300025937 Ga0207669_10000215 Ga0207669_100002154 216
577 3300025938 Ga0207704_10000580 Ga0207704_100005803 216
578 3300025939 Ga0207665_10002002 Ga0207665_1000200213 216
579 3300025940 Ga0207691_10037577 Ga0207691_100375774 216
580 3300025941 Ga0207711_10008630 Ga0207711_100086305 216
581 3300025942 Ga0207689_10014414 Ga0207689_100144142 216
582 3300025949 Ga0207667_10120130 Ga0207667_101201302 216
583 3300025961 Ga0207712_10013121 Ga0207712_100131213 216
584 3300025961 Ga0207712_10073455 Ga0207712_100734552 216
585 3300025961 Ga0207712_10126557 Ga0207712_101265572 216
586 3300025972 Ga0207668_10005510 Ga0207668_100055102 216
587 3300025972 Ga0207668_10117799 Ga0207668_101177992 216
588 3300025981 Ga0207640_10001964 Ga0207640_100019643 216
589 3300025981 Ga0207640_10093916 Ga0207640_100939163 216
590 3300025986 Ga0207658_10065842 Ga0207658_100658423 216
591 3300025986 Ga0207658_10511736 Ga0207658_105117361 216
592 3300026023 Ga0207677_10003911 Ga0207677_100039116 216
593 3300026023 Ga0207677_10044493 Ga0207677_100444935 216
594 3300026035 Ga0207703_10006323 Ga0207703_100063233 216
595 3300026035 Ga0207703_10426467 Ga0207703_104264672 216
596 3300026041 Ga0207639_10008988 Ga0207639_100089884 216
597 3300026067 Ga0207678_10013443 Ga0207678_100134436 216
598 3300026067 Ga0207678_10018721 Ga0207678_100187214 216
599 3300026067 Ga0207678_10100347 Ga0207678_101003473 216
600 3300026075 Ga0207708_10009940 Ga0207708_100099403 216
601 3300026078 Ga0207702_10651297 Ga0207702_106512972 216
602 3300026088 Ga0207641_10025442 Ga0207641_100254425 216
603 3300026089 Ga0207648_10006769 Ga0207648_100067694 216
604 3300026089 Ga0207648_10066765 Ga0207648_100667653 216
605 3300026089 Ga0207648_10082259 Ga0207648_100822595 216
606 3300026095 Ga0207676_10195416 Ga0207676_101954162 216
607 3300026095 Ga0207676_10635778 Ga0207676_106357782 216
608 3300026118 Ga0207675_100006306 Ga0207675_1000063064 216
609 3300026118 Ga0207675_100069950 Ga0207675_1000699502 216
610 3300026118 Ga0207675_100117272 Ga0207675_1001172721 216
611 3300026118 Ga0207675_100137667 Ga0207675_1001376672 216
612 3300026121 Ga0207683_10005026 Ga0207683_100050264 216
613 3300026121 Ga0207683_10053936 Ga0207683_100539364 216
614 3300026121 Ga0207683_10463984 Ga0207683_104639842 216
615 3300026142 Ga0207698_10039853 Ga0207698_100398534 216
616 3300026142 Ga0207698_10067945 Ga0207698_100679453 216
617 3300026142 Ga0207698_11092681 Ga0207698_110926811 216
618 3300028379 Ga0268266_10220964 Ga0268266_102209642 216
619 3300028379 Ga0268266_10692422 Ga0268266_106924221 216
620 3300028380 Ga0268265_10004893 Ga0268265_100048932 216
621 3300028380 Ga0268265_10464529 Ga0268265_104645292 216
622 3300028381 Ga0268264_10002682 Ga0268264_100026823 216
623 3300031995 Ga0307409_100007289 Ga0307409_1000072896 216
624 3300032005 Ga0307411_10065463 Ga0307411_100654634 216
625 3300034820 Ga0373959_0086204 Ga0373959_0086204_12_677 216
626 3300035121 Ga0373960_0172107 Ga0373960_0172107_40_690 216
627 3300035207 Ga0373942_0048997 Ga0373942_0048997_517_1167 216
628 3300035242 Ga0373962_0097281 Ga0373962_0097281_77_727 216
629 3300035691 Ga0373931_0013263 Ga0373931_0013263_2027_2677 216
630 3300035691 Ga0373931_0036656 Ga0373931_0036656_287_952 216
631 3300037853 Ga0436364_0988707 Ga0436364_0988707_4370_5023 216
632 3300039437 Ga0436365_0099441 Ga0436365_0099441_2436_3107 216
633 3300039437 Ga0436365_0114496 Ga0436365_0114496_719_1372 216
634 3300039437 Ga0436365_1318964 Ga0436365_1318964_12288_12974 216
635 3300039450 Ga0436363_1097219 Ga0436363_1097219_710_1363 216
636 3300041460 Ga0451802_1438524 Ga0451802_1438524_113_763 216
637 3300044658 Ga0466972_0036745 Ga0466972_0036745_234_884 216
638 3300044683 Ga0466965_0043644 Ga0466965_0043644_966_1616 216
639 3300044901 Ga0466960_0000148 Ga0466960_0000148_10738_11388 216
640 3300045976 Ga0466967_0024904 Ga0466967_0024904_15_665 216
641 3300046455 Ga0495603_0070641 Ga0495603_0070641_1076_1729 216
642 3300046459 Ga0495629_0016396 Ga0495629_0016396_838_1491 216
643 3300046459 Ga0495629_0017034 Ga0495629_0017034_1782_2465 216
644 3300046461 Ga0495641_0024206 Ga0495641_0024206_755_1408 216
645 3300046472 Ga0495580_0511256 Ga0495580_0511256_34_684 216
646 3300046473 Ga0495582_0024047 Ga0495582_0024047_54_707 216
647 3300046473 Ga0495582_0030585 Ga0495582_0030585_391_1074 216
648 3300046476 Ga0495662_0130976 Ga0495662_0130976_570_1223 216
649 3300046531 Ga0495665_0037559 Ga0495665_0037559_31_684 216
650 3300046533 Ga0495640_0048956 Ga0495640_0048956_295_948 216
651 3300046674 Ga0495588_0331202 Ga0495588_0331202_75_728 216
652 3300046681 Ga0495647_0092012 Ga0495647_0092012_54_707 216
653 3300046681 Ga0495647_0112348 Ga0495647_0112348_302_955 216
654 3300046683 Ga0495658_0029021 Ga0495658_0029021_1811_2464 216
655 3300047315 Ga0495581_0043682 Ga0495581_0043682_1077_1730 216
656 3300047317 Ga0495604_0271939 Ga0495604_0271939_457_1137 216
657 3300047319 Ga0495674_0031919 Ga0495674_0031919_3430_4083 216
658 3300047319 Ga0495674_0476514 Ga0495674_0476514_110_763 216
659 3300047321 Ga0495676_0101140 Ga0495676_0101140_700_1353 216
660 3300047673 Ga0495593_0006145 Ga0495593_0006145_2265_2918 216
661 3300047673 Ga0495593_0011199 Ga0495593_0011199_2190_2843 216
662 3300048903 Ga0496100_0003117 Ga0496100_0003117_6856_7521 216
663 3300048903 Ga0496100_0024059 Ga0496100_0024059_2886_3542 216
664 3300048904 Ga0496101_0002051 Ga0496101_0002051_6164_6829 216
665 3300048905 Ga0496102_0000692 Ga0496102_0000692_26763_27428 216
666 3300048905 Ga0496102_0005014 Ga0496102_0005014_7048_7782 216
667 3300048905 Ga0496102_0095201 Ga0496102_0095201_532_1221 216
668 3300048905 Ga0496102_0307158 Ga0496102_0307158_170_820 216
669 3300048905 Ga0496102_0671425 Ga0496102_0671425_37_687 216
670 3300048906 Ga0496103_0001954 Ga0496103_0001954_7784_8449 216
671 3300048906 Ga0496103_0005966 Ga0496103_0005966_3233_3967 216
672 3300048906 Ga0496103_0126052 Ga0496103_0126052_488_1222 216
673 3300048908 Ga0496105_0003710 Ga0496105_0003710_4284_5018 216
674 3300048909 Ga0496106_0000731 Ga0496106_0000731_21796_22461 216
675 3300048909 Ga0496106_0631649 Ga0496106_0631649_15_671 216
676 3300048910 Ga0496107_0002328 Ga0496107_0002328_5603_6268 216
677 3300048911 Ga0496108_0001277 Ga0496108_0001277_1114_1764 216
678 3300048911 Ga0496108_0003852 Ga0496108_0003852_5200_5850 216
679 3300048911 Ga0496108_0021900 Ga0496108_0021900_1605_2339 216
680 3300048911 Ga0496108_0119564 Ga0496108_0119564_1083_1733 216
681 3300048911 Ga0496108_0138114 Ga0496108_0138114_377_1111 216
682 3300048912 Ga0496109_0023877 Ga0496109_0023877_2541_3191 216
683 3300048912 Ga0496109_0036402 Ga0496109_0036402_3037_3687 216
684 3300048912 Ga0496109_0236078 Ga0496109_0236078_1038_1688 216
685 3300048913 Ga0496110_0013540 Ga0496110_0013540_3011_3661 216
686 3300048913 Ga0496110_0187131 Ga0496110_0187131_983_1633 216
687 3300048915 Ga0496112_0003021 Ga0496112_0003021_4194_4844 216
688 3300048915 Ga0496112_0099487 Ga0496112_0099487_1280_1930 216
689 3300048915 Ga0496112_0139323 Ga0496112_0139323_531_1265 216
690 3300048915 Ga0496112_0253530 Ga0496112_0253530_219_872 216
691 3300048917 Ga0496114_0003175 Ga0496114_0003175_5300_5965 216
692 3300048918 Ga0496115_0004547 Ga0496115_0004547_5624_6289 216
693 3300048918 Ga0496115_0214433 Ga0496115_0214433_706_1356 216
694 3300048929 Ga0496126_0023986 Ga0496126_0023986_1833_2492 216
695 3300050490 nmdc:mga03n38_20052_c1 nmdc:mga03n38_20052_c1_49_699 216
696 3300050490 nmdc:mga03n38_21497_c1 nmdc:mga03n38_21497_c1_1142_1816 216
697 3300050490 nmdc:mga03n38_2985_c1 nmdc:mga03n38_2985_c1_3641_4294 216
698 3300050490 nmdc:mga03n38_3516_c1 nmdc:mga03n38_3516_c1_2961_3611 216
699 3300050491 nmdc:mga00v17_4304_c1 nmdc:mga00v17_4304_c1_2928_3581 216
700 3300050491 nmdc:mga00v17_5980_c1 nmdc:mga00v17_5980_c1_3966_4616 216
701 3300050491 nmdc:mga00v17_76422_c1 nmdc:mga00v17_76422_c1_416_1066 216
702 3300050492 nmdc:mga0yw44_127509_c2 nmdc:mga0yw44_127509_c2_67_717 216
703 3300050492 nmdc:mga0yw44_3661_c2 nmdc:mga0yw44_3661_c2_949_1602 216
704 3300050495 nmdc:mga04h51_145009_c1 nmdc:mga04h51_145009_c1_63_713 216
705 3300050496 nmdc:mga07m45_46592_c2 nmdc:mga07m45_46592_c2_218_868 216
706 3300050507 nmdc:mga05p37_9376_c1 nmdc:mga05p37_9376_c1_7425_8075 216
707 3300050509 nmdc:mga0qj67_173006_c1 nmdc:mga0qj67_173006_c1_188_838 216
708 3300050510 nmdc:mga06r32_76788_c1 nmdc:mga06r32_76788_c1_297_947 216
709 3300050516 nmdc:mga0sz30_11783_c1 nmdc:mga0sz30_11783_c1_1238_1972 216
710 3300050516 nmdc:mga0sz30_2129_c1 nmdc:mga0sz30_2129_c1_2919_3569 216
711 3300050516 nmdc:mga0sz30_22661_c1 nmdc:mga0sz30_22661_c1_901_1554 216
712 3300050516 nmdc:mga0sz30_232075_c1 nmdc:mga0sz30_232075_c1_112_762 216
713 3300050516 nmdc:mga0sz30_34722_c1 nmdc:mga0sz30_34722_c1_455_1105 216
714 3300050516 nmdc:mga0sz30_7123_c1 nmdc:mga0sz30_7123_c1_2974_3624 216
715 3300050516 nmdc:mga0sz30_8334_c1 nmdc:mga0sz30_8334_c1_445_1104 216
716 3300053108 Ga0500562_054533 Ga0500562_054533_278_1033 216
717 3300053130 Ga0500642_0067593 Ga0500642_0067593_733_1395 216
718 iso_pu_bacteria 2842134933 2842136823 216
719 iso_pu_bacteria 2902799365 2902799826 216

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

5

117

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

148

204

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

147

192

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

150

191

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zlj-assembly4.cif.gz_H crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9827 145 208
1zlk-assembly1.cif.gz_B crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex 0.9804 145 208
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.9771 150 202
6ekh-assembly1.cif.gz_Y crystal structure of activated chey from methanoccocus maripaludis 0.9713 1 113
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.9666 1 118
ID Description Score Start End Superfamily
1zlkB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9804 145 208 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9771 150 202 1.10.10.10
6ekhY00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9713 1 113 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 1 119 3.40.50.2300
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.962 149 206 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3M1KUN1-F1-model_v4 Response regulator 0.9866 1 123 GO:0000160
GO:0003677
AF-K9TAR8-F1-model_v4 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain 0.9854 2 123 GO:0000160
GO:0003677
GO:0016020
AF-A0A563VXF1-F1-model_v4 Response regulatory domain-containing protein 0.9834 1 123 GO:0000160
GO:0003677
GO:0016020
AF-C8XHH1-F1-model_v4 Response regulator receiver protein 0.9787 1 127 GO:0000160
GO:0003677
AF-A0A397RJT3-F1-model_v4 deleted 0.9598 2 139

Feature Viewer

pLDDT pTM Quality
81.83 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map