F477244

General Info

Members Datasets Scaffolds Average Seq Length
719 324 1438 168

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10013384|Ga0207700_100133846
Length 165
Sequence MTTNHEKAFAARPEVYDAWGRLNGAVKAGMDRRRYELVTLAAARRLRSSYCCLAHGTVLLELGEPVLELALDHHAAGLEEVDVAVMDLAEKVVDDATSVDEADRERLRSLGLSEADILDVVLAASARCFFSKTLDAVGARADADYMKLAPELREVLVVGRPIAEA

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
226 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
233 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
234 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
235 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
244 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.68
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 8.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10013384 3300025928 Bacteria 5336
2 JGI24745J21846_1008495 3300002073 Bacteria 1158
3 JGI24738J21930_10007916 3300002075 Bacteria 2431
4 Ga0070658_10002246 3300005327 Bacteria 16202
5 Ga0070658_10012968 3300005327 Bacteria 6689
6 Ga0070658_10624982 3300005327 Bacteria 934
7 Ga0070683_100040499 3300005329 Bacteria 4284
8 Ga0070683_100051181 3300005329 Bacteria 3824
9 Ga0070683_100128458 3300005329 Bacteria 2397
10 Ga0070683_100135124 3300005329 Bacteria 2335
11 Ga0070683_100283671 3300005329 Bacteria 1575
12 Ga0070690_100056132 3300005330 Bacteria 2524
13 Ga0070690_100368928 3300005330 Unclassified 1046
14 Ga0070670_100247464 3300005331 Bacteria 1553
15 Ga0070677_10020164 3300005333 Bacteria 2425
16 Ga0068869_100034090 3300005334 Bacteria 3599
17 Ga0068869_100054298 3300005334 Bacteria 2916
18 Ga0070680_100003014 3300005336 Bacteria 12499
19 Ga0070680_100634034 3300005336 Bacteria 918
20 Ga0070682_100004449 3300005337 Bacteria 7780
21 Ga0070682_100868350 3300005337 Bacteria 739
22 Ga0068868_100016912 3300005338 Bacteria 5426
23 Ga0068868_100028572 3300005338 Bacteria 4265
24 Ga0068868_100078054 3300005338 Bacteria 2650
25 Ga0068868_100306995 3300005338 Bacteria 1349
26 Ga0070660_100006426 3300005339 Bacteria 8146
27 Ga0070660_100019024 3300005339 Bacteria 5028
28 Ga0070660_100210920 3300005339 Bacteria 1577
29 Ga0070660_100660465 3300005339 Bacteria 876
30 Ga0070689_100054456 3300005340 Bacteria 3097
31 Ga0070691_10005665 3300005341 Bacteria 5695
32 Ga0070661_100013401 3300005344 Bacteria 5755
33 Ga0070661_100189302 3300005344 Bacteria 1569
34 Ga0070661_100595265 3300005344 Bacteria 893
35 Ga0070692_10001978 3300005345 Bacteria 7760
36 Ga0070675_100005503 3300005354 Bacteria 9694
37 Ga0070675_100047824 3300005354 Bacteria 3506
38 Ga0070675_100077583 3300005354 Bacteria 2765
39 Ga0070675_100328532 3300005354 Bacteria 1352
40 Ga0070675_101081631 3300005354 Unclassified 737
41 Ga0070671_100052072 3300005355 Bacteria 3405
42 Ga0070671_100096221 3300005355 Bacteria 2483
43 Ga0070671_100357926 3300005355 Bacteria 1246
44 Ga0070671_101184559 3300005355 Bacteria 672
45 Ga0070674_100022979 3300005356 Bacteria 4027
46 Ga0070674_100044679 3300005356 Bacteria 3022
47 Ga0070674_100252801 3300005356 Bacteria 1385
48 Ga0070673_100003272 3300005364 Bacteria 10052
49 Ga0070673_100046360 3300005364 Bacteria 3376
50 Ga0070688_100001684 3300005365 Bacteria 11040
51 Ga0070688_100088081 3300005365 Bacteria 2023
52 Ga0070659_100018493 3300005366 Bacteria 5258
53 Ga0070659_100225371 3300005366 Bacteria 1548
54 Ga0070667_100571655 3300005367 Bacteria 1040
55 Ga0070703_10318095 3300005406 Bacteria 654
56 Ga0070709_10017902 3300005434 Bacteria 4070
57 Ga0070709_10322252 3300005434 Bacteria 1134
58 Ga0070709_10365869 3300005434 Bacteria 1069
59 Ga0070709_10402274 3300005434 Unclassified 1022
60 Ga0070709_10441250 3300005434 Bacteria 979
61 Ga0070714_100045976 3300005435 Bacteria 3701
62 Ga0070714_100067112 3300005435 Bacteria 3092
63 Ga0070714_100134609 3300005435 Bacteria 2212
64 Ga0070714_100152195 3300005435 Bacteria 2085
65 Ga0070714_100307998 3300005435 Bacteria 1478
66 Ga0070714_101088197 3300005435 Bacteria 779
67 Ga0070713_100036906 3300005436 Bacteria 3948
68 Ga0070713_100042573 3300005436 Bacteria 3707
69 Ga0070713_100093613 3300005436 Bacteria 2589
70 Ga0070713_100104357 3300005436 Bacteria 2461
71 Ga0070713_100569247 3300005436 Unclassified 1074
72 Ga0070713_100817497 3300005436 Bacteria 894
73 Ga0070713_100888140 3300005436 Bacteria 857
74 Ga0070713_100889235 3300005436 Bacteria 856
75 Ga0070701_10034878 3300005438 Bacteria 2523
76 Ga0070711_100138370 3300005439 Unclassified 1822
77 Ga0070700_100066624 3300005441 Bacteria 2286
78 Ga0070700_100129341 3300005441 Bacteria 1702
79 Ga0070708_100252581 3300005445 Bacteria 1656
80 Ga0070708_100927595 3300005445 Unclassified 817
81 Ga0070663_100021470 3300005455 Bacteria 4295
82 Ga0070663_100088373 3300005455 Bacteria 2291
83 Ga0070678_100020731 3300005456 Bacteria 4319
84 Ga0070678_100116140 3300005456 Bacteria 2102
85 Ga0070678_100957020 3300005456 Bacteria 785
86 Ga0070662_100010836 3300005457 Bacteria 6003
87 Ga0070662_100022055 3300005457 Bacteria 4355
88 Ga0070662_100388463 3300005457 Bacteria 1150
89 Ga0070662_100615099 3300005457 Bacteria 914
90 Ga0070681_10044555 3300005458 Bacteria 4441
91 Ga0070681_10608640 3300005458 Bacteria 1007
92 Ga0068867_100110726 3300005459 Bacteria 2109
93 Ga0068867_100363779 3300005459 Bacteria 1211
94 Ga0070685_10050101 3300005466 Bacteria 2411
95 Ga0070685_10117123 3300005466 Bacteria 1649
96 Ga0070707_100012417 3300005468 Bacteria 7955
97 Ga0070707_101454158 3300005468 Unclassified 652
98 Ga0070698_100440575 3300005471 Bacteria 1238
99 Ga0070699_100198012 3300005518 Bacteria 1786
100 Ga0070679_100010105 3300005530 Bacteria 8944
101 Ga0070679_100047424 3300005530 Bacteria 4282
102 Ga0070679_100260628 3300005530 Bacteria 1689
103 Ga0070679_100760924 3300005530 Bacteria 912
104 Ga0070684_100022528 3300005535 Bacteria 5255
105 Ga0070684_100202594 3300005535 Bacteria 1808
106 Ga0070684_100389338 3300005535 Bacteria 1284
107 Ga0070684_100401564 3300005535 Bacteria 1264
108 Ga0068853_100008648 3300005539 Bacteria 8185
109 Ga0068853_100216204 3300005539 Bacteria 1749
110 Ga0068853_100677333 3300005539 Bacteria 983
111 Ga0070672_100004142 3300005543 Bacteria 9466
112 Ga0070672_100019912 3300005543 Bacteria 4882
113 Ga0070686_100042474 3300005544 Bacteria 2848
114 Ga0070696_100040208 3300005546 Bacteria 3228
115 Ga0070693_100554982 3300005547 Bacteria 823
116 Ga0070665_100468937 3300005548 Bacteria 1269
117 Ga0070665_100886657 3300005548 Bacteria 905
118 Ga0070704_100002650 3300005549 Bacteria 10103
119 Ga0068855_100009917 3300005563 Bacteria 11486
120 Ga0068855_100011500 3300005563 Bacteria 10694
121 Ga0070664_100087744 3300005564 Bacteria 2690
122 Ga0070664_100100534 3300005564 Bacteria 2514
123 Ga0068854_100014764 3300005578 Bacteria 5156
124 Ga0068854_100041514 3300005578 Bacteria 3250
125 Ga0068854_100081675 3300005578 Bacteria 2388
126 Ga0068856_100065522 3300005614 Unclassified 3591
127 Ga0068856_100711424 3300005614 Bacteria 1025
128 Ga0068856_101257178 3300005614 Bacteria 756
129 Ga0070702_100004598 3300005615 Bacteria 6322
130 Ga0070702_100093022 3300005615 Bacteria 1832
131 Ga0070702_100343443 3300005615 Bacteria 1048
132 Ga0070702_100401935 3300005615 Bacteria 980
133 Ga0068852_100189242 3300005616 Bacteria 1941
134 Ga0068852_100419248 3300005616 Bacteria 1320
135 Ga0068864_100002446 3300005618 Bacteria 15342
136 Ga0068864_100032373 3300005618 Bacteria 4443
137 Ga0068864_100746069 3300005618 Bacteria 959
138 Ga0068861_100084176 3300005719 Bacteria 2497
139 Ga0068861_100106799 3300005719 Bacteria 2237
140 Ga0068861_100192807 3300005719 Unclassified 1705
141 Ga0068851_10025520 3300005834 Bacteria 2899
142 Ga0068870_10242795 3300005840 Bacteria 1113
143 Ga0068863_101293854 3300005841 Bacteria 736
144 Ga0068858_100067060 3300005842 Bacteria 3323
145 Ga0068858_100068193 3300005842 Bacteria 3296
146 Ga0068860_100603982 3300005843 Unclassified 1103
147 Ga0081455_10016850 3300005937 Bacteria 7027
148 Ga0070717_10023388 3300006028 Bacteria 4894
149 Ga0070717_10157192 3300006028 Bacteria 1970
150 Ga0075432_10040158 3300006058 Bacteria 1632
151 Ga0070715_10068805 3300006163 Unclassified 1575
152 Ga0070716_100002183 3300006173 Bacteria 9006
153 Ga0070712_100069553 3300006175 Bacteria 2512
154 Ga0070712_100200493 3300006175 Unclassified 1567
155 Ga0070712_100207715 3300006175 Bacteria 1542
156 Ga0070712_100229723 3300006175 Bacteria 1473
157 Ga0070712_100512955 3300006175 Bacteria 1006
158 Ga0070712_101187118 3300006175 Bacteria 664
159 Ga0097621_100021889 3300006237 Bacteria 4954
160 Ga0097621_100029863 3300006237 Bacteria 4309
161 Ga0097621_100134045 3300006237 Bacteria 2111
162 Ga0097621_100687249 3300006237 Bacteria 941
163 Ga0068871_100038569 3300006358 Bacteria 3817
164 Ga0068871_100417448 3300006358 Bacteria 1198
165 Ga0075428_101617046 3300006844 Unclassified 677
166 Ga0075431_100860236 3300006847 Bacteria 878
167 Ga0075433_10166818 3300006852 Bacteria 1960
168 Ga0075434_100410268 3300006871 Bacteria 1376
169 Ga0075434_100610998 3300006871 Bacteria 1109
170 Ga0075429_100338375 3300006880 Bacteria 1317
171 Ga0068865_100007432 3300006881 Bacteria 6742
172 Ga0068865_100014093 3300006881 Bacteria 5072
173 Ga0068865_100071190 3300006881 Bacteria 2466
174 Ga0068865_100325296 3300006881 Bacteria 1238
175 Ga0075436_100056893 3300006914 Bacteria 2701
176 Ga0105240_10189093 3300009093 Bacteria 2422
177 Ga0105240_10466541 3300009093 Bacteria 1410
178 Ga0111539_10028527 3300009094 Bacteria 6808
179 Ga0111539_10077730 3300009094 Bacteria 3906
180 Ga0105245_10016608 3300009098 Bacteria 6425
181 Ga0105245_10026165 3300009098 Bacteria 5134
182 Ga0105245_10047194 3300009098 Bacteria 3849
183 Ga0105245_10103292 3300009098 Bacteria 2640
184 Ga0105245_10316810 3300009098 Bacteria 1535
185 Ga0105245_11664864 3300009098 Unclassified 690
186 Ga0105247_10021780 3300009101 Bacteria 3856
187 Ga0114129_10004271 3300009147 Bacteria 20184
188 Ga0114129_10141826 3300009147 Bacteria 3293
189 Ga0114129_10218885 3300009147 Bacteria 2570
190 Ga0105243_10004668 3300009148 Bacteria 10783
191 Ga0105243_10039138 3300009148 Bacteria 3696
192 Ga0105243_10043495 3300009148 Bacteria 3520
193 Ga0105243_10596482 3300009148 Bacteria 1063
194 Ga0105241_10347379 3300009174 Bacteria 1287
195 Ga0105241_10399826 3300009174 Bacteria 1205
196 Ga0105242_10009778 3300009176 Bacteria 7349
197 Ga0105242_10087789 3300009176 Bacteria 2611
198 Ga0105248_10349919 3300009177 Bacteria 1664
199 Ga0105248_10926326 3300009177 Bacteria 984
200 Ga0105248_11325502 3300009177 Bacteria 814
201 Ga0105237_11106636 3300009545 Unclassified 799
202 Ga0105237_11501504 3300009545 Bacteria 680
203 Ga0105238_10025064 3300009551 Bacteria 6080
204 Ga0105238_10136782 3300009551 Bacteria 2428
205 Ga0105249_10081258 3300009553 Bacteria 3012
206 Ga0105239_10012022 3300010375 Bacteria 9653
207 Ga0105239_10016925 3300010375 Bacteria 8058
208 Ga0105239_11141396 3300010375 Bacteria 897
209 Ga0105246_10002422 3300011119 Bacteria 11257
210 Ga0105246_10024978 3300011119 Bacteria 3891
211 Ga0105246_10099791 3300011119 Bacteria 2111
212 Ga0105246_10631513 3300011119 Unclassified 930
213 Ga0157342_1023313 3300012507 Bacteria 734
214 Ga0157373_10077615 3300013100 Bacteria 2343
215 Ga0157371_10008776 3300013102 Bacteria 8018
216 Ga0157370_10004745 3300013104 Bacteria 15476
217 Ga0157369_10135441 3300013105 Unclassified 2608
218 Ga0157369_10229636 3300013105 Bacteria 1940
219 Ga0157374_10021483 3300013296 Bacteria 5744
220 Ga0163162_11942801 3300013306 Bacteria 674
221 Ga0157372_10015578 3300013307 Bacteria 8150
222 Ga0157372_10185600 3300013307 Bacteria 2408
223 Ga0157375_10036371 3300013308 Bacteria 4710
224 Ga0157375_10043935 3300013308 Bacteria 4336
225 Ga0157375_10064228 3300013308 Bacteria 3654
226 Ga0157375_10079652 3300013308 Bacteria 3312
227 Ga0157375_10143415 3300013308 Bacteria 2517
228 Ga0163163_10004309 3300014325 Bacteria 12126
229 Ga0163163_10042065 3300014325 Bacteria 4472
230 Ga0163163_10406033 3300014325 Bacteria 1421
231 Ga0157380_10076670 3300014326 Bacteria 2722
232 Ga0157380_10080193 3300014326 Bacteria 2668
233 Ga0157377_10004333 3300014745 Bacteria 6515
234 Ga0157377_10027192 3300014745 Bacteria 3069
235 Ga0157377_10036615 3300014745 Bacteria 2700
236 Ga0157377_10047155 3300014745 Bacteria 2413
237 Ga0157379_10060947 3300014968 Bacteria 3374
238 Ga0157376_10002114 3300014969 Bacteria 13375
239 Ga0157376_10014437 3300014969 Bacteria 5931
240 Ga0157376_10467307 3300014969 Bacteria 1234
241 Ga0163161_10208119 3300017792 Bacteria 1510
242 Ga0197907_10066705 3300020069 Bacteria 4788
243 Ga0206356_10644285 3300020070 Unclassified 757
244 Ga0206354_11059346 3300020081 Bacteria 1916
245 Ga0206353_11406901 3300020082 Bacteria 1090
246 Ga0206353_11708877 3300020082 Bacteria 1604
247 Ga0224712_10012774 3300022467 Bacteria 2654
248 Ga0207656_10042289 3300025321 Bacteria 1938
249 Ga0207692_10042189 3300025898 Bacteria 2263
250 Ga0207692_10185241 3300025898 Bacteria 1215
251 Ga0207642_10035052 3300025899 Bacteria 2139
252 Ga0207688_10005718 3300025901 Bacteria 6765
253 Ga0207688_10028872 3300025901 Bacteria 3051
254 Ga0207688_10030423 3300025901 Bacteria 2977
255 Ga0207688_10030820 3300025901 Bacteria 2959
256 Ga0207688_10142853 3300025901 Bacteria 1410
257 Ga0207685_10035555 3300025905 Unclassified 1819
258 Ga0207699_10018894 3300025906 Unclassified 3661
259 Ga0207699_10025172 3300025906 Bacteria 3265
260 Ga0207699_10074500 3300025906 Bacteria 2085
261 Ga0207699_10101710 3300025906 Bacteria 1825
262 Ga0207707_10147817 3300025912 Bacteria 2055
263 Ga0207707_10571023 3300025912 Unclassified 959
264 Ga0207695_10066162 3300025913 Bacteria 3713
265 Ga0207671_10022937 3300025914 Bacteria 4713
266 Ga0207671_10973316 3300025914 Bacteria 669
267 Ga0207693_10051668 3300025915 Bacteria 3225
268 Ga0207693_10217832 3300025915 Unclassified 1500
269 Ga0207693_10263170 3300025915 Bacteria 1352
270 Ga0207693_10352919 3300025915 Bacteria 1151
271 Ga0207663_10135880 3300025916 Unclassified 1706
272 Ga0207663_10237896 3300025916 Bacteria 1334
273 Ga0207663_10305437 3300025916 Bacteria 1190
274 Ga0207660_10055182 3300025917 Bacteria 2838
275 Ga0207660_10084615 3300025917 Bacteria 2338
276 Ga0207660_10609359 3300025917 Unclassified 889
277 Ga0207662_10552652 3300025918 Bacteria 797
278 Ga0207657_10000500 3300025919 Bacteria 41333
279 Ga0207657_10006924 3300025919 Bacteria 11686
280 Ga0207657_10009238 3300025919 Bacteria 9937
281 Ga0207657_10071185 3300025919 Bacteria 2945
282 Ga0207657_10090727 3300025919 Bacteria 2550
283 Ga0207649_10073595 3300025920 Bacteria 2189
284 Ga0207649_10310218 3300025920 Bacteria 1156
285 Ga0207649_11035411 3300025920 Bacteria 646
286 Ga0207652_10193850 3300025921 Bacteria 1828
287 Ga0207652_10222553 3300025921 Bacteria 1700
288 Ga0207652_11032837 3300025921 Unclassified 721
289 Ga0207646_10256513 3300025922 Bacteria 1580
290 Ga0207681_10066987 3300025923 Bacteria 2488
291 Ga0207694_10023862 3300025924 Bacteria 4644
292 Ga0207694_10125211 3300025924 Bacteria 2055
293 Ga0207659_10009818 3300025926 Bacteria 5992
294 Ga0207687_10001904 3300025927 Bacteria 14357
295 Ga0207687_10006499 3300025927 Bacteria 7720
296 Ga0207687_10029501 3300025927 Bacteria 3691
297 Ga0207687_10094115 3300025927 Bacteria 2192
298 Ga0207700_10010908 3300025928 Bacteria 5768
299 Ga0207700_10222301 3300025928 Unclassified 1601
300 Ga0207700_10343267 3300025928 Bacteria 1299
301 Ga0207700_10442631 3300025928 Bacteria 1144
302 Ga0207700_10770624 3300025928 Bacteria 860
303 Ga0207700_10879600 3300025928 Bacteria 802
304 Ga0207664_10026372 3300025929 Bacteria 4391
305 Ga0207664_10031744 3300025929 Bacteria 4043
306 Ga0207664_10312546 3300025929 Bacteria 1385
307 Ga0207664_10335251 3300025929 Unclassified 1336
308 Ga0207664_10373554 3300025929 Bacteria 1265
309 Ga0207664_10890943 3300025929 Bacteria 799
310 Ga0207644_10563525 3300025931 Unclassified 944
311 Ga0207690_10006808 3300025932 Bacteria 6778
312 Ga0207690_10432208 3300025932 Bacteria 1055
313 Ga0207706_10002917 3300025933 Bacteria 16524
314 Ga0207706_10074467 3300025933 Bacteria 2986
315 Ga0207706_10137817 3300025933 Bacteria 2147
316 Ga0207686_10006569 3300025934 Bacteria 6262
317 Ga0207686_10159561 3300025934 Bacteria 1579
318 Ga0207709_10027984 3300025935 Bacteria 3255
319 Ga0207709_10086541 3300025935 Bacteria 2035
320 Ga0207670_11540512 3300025936 Bacteria 565
321 Ga0207669_10015953 3300025937 Bacteria 3802
322 Ga0207669_10193461 3300025937 Bacteria 1469
323 Ga0207669_10270640 3300025937 Bacteria 1276
324 Ga0207704_10053704 3300025938 Bacteria 2451
325 Ga0207704_10075682 3300025938 Bacteria 2153
326 Ga0207704_10094267 3300025938 Bacteria 1976
327 Ga0207665_10004807 3300025939 Bacteria 8995
328 Ga0207665_10313215 3300025939 Unclassified 1176
329 Ga0207665_10720204 3300025939 Bacteria 785
330 Ga0207691_10004695 3300025940 Bacteria 13225
331 Ga0207691_10010964 3300025940 Bacteria 8697
332 Ga0207691_10602969 3300025940 Bacteria 929
333 Ga0207691_10935459 3300025940 Unclassified 725
334 Ga0207711_10108875 3300025941 Bacteria 2462
335 Ga0207711_10364345 3300025941 Bacteria 1339
336 Ga0207711_10767671 3300025941 Unclassified 898
337 Ga0207689_10041019 3300025942 Bacteria 3830
338 Ga0207689_10046265 3300025942 Bacteria 3596
339 Ga0207689_10083185 3300025942 Bacteria 2632
340 Ga0207661_10048769 3300025944 Bacteria 3367
341 Ga0207661_10146828 3300025944 Bacteria 2035
342 Ga0207661_10186627 3300025944 Bacteria 1815
343 Ga0207661_10808270 3300025944 Bacteria 863
344 Ga0207679_10030896 3300025945 Bacteria 3745
345 Ga0207679_10541165 3300025945 Bacteria 1044
346 Ga0207667_10014022 3300025949 Bacteria 9147
347 Ga0207667_10040461 3300025949 Bacteria 4963
348 Ga0207667_10119352 3300025949 Bacteria 2718
349 Ga0207667_10375747 3300025949 Bacteria 1448
350 Ga0207651_10128463 3300025960 Bacteria 1935
351 Ga0207712_10042163 3300025961 Bacteria 3141
352 Ga0207712_10107180 3300025961 Bacteria 2089
353 Ga0207668_10102769 3300025972 Bacteria 2127
354 Ga0207668_10824780 3300025972 Bacteria 822
355 Ga0207640_10698400 3300025981 Bacteria 869
356 Ga0207677_10003865 3300026023 Bacteria 7979
357 Ga0207677_10029217 3300026023 Bacteria 3499
358 Ga0207677_10787539 3300026023 Bacteria 850
359 Ga0207703_10269003 3300026035 Bacteria 1543
360 Ga0207703_10480508 3300026035 Bacteria 1164
361 Ga0207639_10325133 3300026041 Bacteria 1367
362 Ga0207678_10040053 3300026067 Bacteria 4064
363 Ga0207678_10063597 3300026067 Bacteria 3171
364 Ga0207678_10747377 3300026067 Unclassified 862
365 Ga0207708_10039650 3300026075 Bacteria 3589
366 Ga0207702_10844312 3300026078 Bacteria 906
367 Ga0207702_10977782 3300026078 Bacteria 839
368 Ga0207641_10310849 3300026088 Bacteria 1491
369 Ga0207648_10024835 3300026089 Bacteria 5345
370 Ga0207648_10047368 3300026089 Bacteria 3768
371 Ga0207648_10135286 3300026089 Bacteria 2171
372 Ga0207676_10050731 3300026095 Bacteria 3236
373 Ga0207676_10429659 3300026095 Bacteria 1241
374 Ga0207674_10089443 3300026116 Bacteria 3072
375 Ga0207674_10106894 3300026116 Bacteria 2775
376 Ga0207674_10603539 3300026116 Unclassified 1060
377 Ga0207675_100028123 3300026118 Bacteria 5235
378 Ga0207675_100054500 3300026118 Bacteria 3730
379 Ga0207675_100085094 3300026118 Bacteria 2967
380 Ga0207675_100299894 3300026118 Bacteria 1565
381 Ga0207683_10010150 3300026121 Bacteria 8035
382 Ga0207683_10023897 3300026121 Bacteria 5258
383 Ga0207683_10024814 3300026121 Bacteria 5165
384 Ga0207698_10006255 3300026142 Bacteria 7408
385 Ga0207698_10132067 3300026142 Bacteria 2136
386 Ga0207698_10649106 3300026142 Bacteria 1045
387 Ga0207428_10047959 3300027907 Bacteria 3429
388 Ga0268266_10186488 3300028379 Bacteria 1892
389 Ga0268266_11139863 3300028379 Bacteria 754
390 Ga0268265_10408104 3300028380 Bacteria 1258
391 Ga0268264_10511461 3300028381 Bacteria 1172
392 Ga0265337_1017963 3300028556 Bacteria 2255
393 Ga0265326_10003428 3300028558 Bacteria 5185
394 Ga0265319_1002436 3300028563 Bacteria 10168
395 Ga0265334_10001479 3300028573 Bacteria 11324
396 Ga0265318_10028191 3300028577 Bacteria 2198
397 Ga0265322_10116896 3300028654 Bacteria 759
398 Ga0265336_10002607 3300028666 Bacteria 7353
399 Ga0265338_10007032 3300028800 Bacteria 14118
400 Ga0265324_10002584 3300029957 Bacteria 9107
401 Ga0265332_10004978 3300031238 Bacteria 6178
402 Ga0265320_10124094 3300031240 Unclassified 1176
403 Ga0265325_10016011 3300031241 Bacteria 4199
404 Ga0265340_10001964 3300031247 Bacteria 11740
405 Ga0265331_10384920 3300031250 Bacteria 629
406 Ga0265327_10185018 3300031251 Bacteria 951
407 Ga0265316_10015673 3300031344 Bacteria 6614
408 Ga0265313_10006404 3300031595 Bacteria 8343
409 Ga0265314_10007900 3300031711 Bacteria 9178
410 Ga0265342_10063193 3300031712 Bacteria 2176
411 Ga0373948_0073060 3300034817 Bacteria 772
412 Ga0373926_0048807 3300035083 Unclassified 1523
413 Ga0373934_0192845 3300035086 Bacteria 838
414 Ga0373951_0217998 3300035091 Bacteria 562
415 Ga0373936_0038842 3300035113 Bacteria 1904
416 Ga0373941_0009412 3300035115 Bacteria 2461
417 Ga0373945_0004091 3300035116 Archaea 4623
418 Ga0373953_0100612 3300035117 Bacteria 1216
419 Ga0373954_0299611 3300035118 Bacteria 793
420 Ga0373954_0395143 3300035118 Bacteria 684
421 Ga0373957_0033740 3300035120 Bacteria 1891
422 Ga0373957_0203680 3300035120 Bacteria 825
423 Ga0373943_0000611 3300035170 Bacteria 15520
424 Ga0373943_0261021 3300035170 Bacteria 975
425 Ga0373943_0756986 3300035170 Bacteria 577
426 Ga0373946_0164232 3300035171 Bacteria 1044
427 Ga0373946_0369083 3300035171 Bacteria 720
428 Ga0373955_0033908 3300035172 Bacteria 2691
429 Ga0373955_0131637 3300035172 Unclassified 1460
430 Ga0373961_0009456 3300035241 Bacteria 2386
431 Ga0373924_0111947 3300035410 Bacteria 1180
432 Ga0373931_0164644 3300035691 Bacteria 1302
433 Ga0373935_0104722 3300035692 Bacteria 1870
434 Ga0373927_0114463 3300035695 Bacteria 1758
435 Ga0373927_0274219 3300035695 Unclassified 1109
436 Ga0373933_0437941 3300035724 Bacteria 854
437 Ga0373947_0001645 3300035725 Bacteria 13684
438 Ga0373947_0087902 3300035725 Bacteria 1933
439 Ga0373947_0346439 3300035725 Bacteria 996
440 Ga0373937_0157455 3300036401 Bacteria 2129
441 Ga0373937_0680894 3300036401 Bacteria 974
442 Ga0373925_0339387 3300037068 Bacteria 1218
443 Ga0373925_0656828 3300037068 Bacteria 864
444 Ga0395899_0025098 3300037312 Bacteria 4500
445 Ga0395900_0091819 3300037418 Bacteria 3119
446 Ga0395898_0058910 3300037466 Bacteria 3737
447 Ga0395905_0097984 3300037471 Bacteria 2753
448 Ga0395901_0003793 3300038443 Bacteria 15221
449 Ga0395901_0575323 3300038443 Bacteria 1139
450 Ga0395901_0699094 3300038443 Bacteria 1012
451 Ga0451807_1927123 3300041486 Bacteria 966
452 Ga0451845_0748284 3300041501 Unclassified 767
453 Ga0451853_0563705 3300041512 Bacteria 1771
454 Ga0466963_0003664 3300044694 Bacteria 8840
455 Ga0466963_0040113 3300044694 Bacteria 3069
456 Ga0466957_0026204 3300044842 Bacteria 3458
457 Ga0466960_0000027 3300044901 Bacteria 51555
458 Ga0466967_0006427 3300045976 Bacteria 8313
459 Ga0466967_0087600 3300045976 Bacteria 2823
460 Ga0495592_0059959 3300046454 Bacteria 2800
461 Ga0495592_0082504 3300046454 Bacteria 2323
462 Ga0495592_0229130 3300046454 Bacteria 1238
463 Ga0495603_0009699 3300046455 Bacteria 5824
464 Ga0495603_0055713 3300046455 Bacteria 2342
465 Ga0495603_0086118 3300046455 Bacteria 1839
466 Ga0495629_0061713 3300046459 Bacteria 2619
467 Ga0495641_0030785 3300046461 Bacteria 2568
468 Ga0495641_0067290 3300046461 Bacteria 1611
469 Ga0495641_0206453 3300046461 Bacteria 881
470 Ga0495651_0031320 3300046462 Bacteria 4147
471 Ga0495651_0316939 3300046462 Bacteria 1041
472 Ga0495651_0741065 3300046462 Bacteria 610
473 Ga0495653_0008743 3300046463 Bacteria 8294
474 Ga0495653_0078383 3300046463 Bacteria 2450
475 Ga0495653_0177430 3300046463 Bacteria 1465
476 Ga0495653_0566533 3300046463 Unclassified 701
477 Ga0495580_0079968 3300046472 Bacteria 2279
478 Ga0495580_0246627 3300046472 Bacteria 1223
479 Ga0495582_0013511 3300046473 Bacteria 4495
480 Ga0495582_0043040 3300046473 Bacteria 2487
481 Ga0495582_0106495 3300046473 Bacteria 1573
482 Ga0495582_0178019 3300046473 Bacteria 1211
483 Ga0495639_0001364 3300046475 Bacteria 10963
484 Ga0495639_0017211 3300046475 Bacteria 3140
485 Ga0495662_0006680 3300046476 Bacteria 5749
486 Ga0495664_0068435 3300046477 Bacteria 2118
487 Ga0495594_0009395 3300046499 Bacteria 5052
488 Ga0495608_0020534 3300046511 Bacteria 4541
489 Ga0495608_0028561 3300046511 Bacteria 3790
490 Ga0495608_0137970 3300046511 Bacteria 1557
491 Ga0495608_0306635 3300046511 Unclassified 982
492 Ga0495618_0134430 3300046514 Bacteria 1582
493 Ga0495618_0141853 3300046514 Bacteria 1536
494 Ga0495618_0470033 3300046514 Unclassified 761
495 Ga0495628_0477827 3300046516 Bacteria 902
496 Ga0495630_0118348 3300046517 Bacteria 2009
497 Ga0495630_0309434 3300046517 Bacteria 1207
498 Ga0495630_0349583 3300046517 Bacteria 1131
499 Ga0495666_0019124 3300046526 Bacteria 3402
500 Ga0495652_0158711 3300046529 Bacteria 1758
501 Ga0495665_0001660 3300046531 Bacteria 11939
502 Ga0495640_0014567 3300046533 Bacteria 5944
503 Ga0495640_0059573 3300046533 Bacteria 2600
504 Ga0495640_0236361 3300046533 Unclassified 1148
505 Ga0495586_0054620 3300046535 Archaea 2165
506 Ga0495587_0013545 3300046536 Bacteria 5123
507 Ga0495587_0188631 3300046536 Bacteria 1168
508 Ga0495645_0192403 3300046543 Bacteria 1389
509 Ga0495667_0014578 3300046559 Bacteria 5309
510 Ga0495667_0015837 3300046559 Bacteria 5097
511 Ga0495634_0005671 3300046642 Bacteria 9555
512 Ga0495634_0146171 3300046642 Bacteria 1497
513 Ga0495634_0417507 3300046642 Unclassified 795
514 Ga0495635_0006524 3300046663 Bacteria 8141
515 Ga0495635_0105594 3300046663 Bacteria 1924
516 Ga0495635_0251835 3300046663 Bacteria 1190
517 Ga0495588_0083604 3300046674 Bacteria 1668
518 Ga0495588_0283161 3300046674 Bacteria 873
519 Ga0495657_0025027 3300046675 Bacteria 4241
520 Ga0495657_0108013 3300046675 Bacteria 1766
521 Ga0495599_0107826 3300046678 Bacteria 1735
522 Ga0495599_0418090 3300046678 Unclassified 797
523 Ga0495623_0022529 3300046679 Bacteria 4069
524 Ga0495623_0186644 3300046679 Bacteria 1201
525 Ga0495646_0215162 3300046680 Bacteria 1041
526 Ga0495646_0268827 3300046680 Bacteria 909
527 Ga0495647_0016582 3300046681 Unclassified 2594
528 Ga0495647_0240562 3300046681 Bacteria 803
529 Ga0495658_0003162 3300046683 Bacteria 8211
530 Ga0495658_0203352 3300046683 Bacteria 1235
531 Ga0495658_0517770 3300046683 Bacteria 763
532 Ga0495613_0024274 3300046689 Bacteria 4517
533 Ga0495624_0003459 3300046690 Bacteria 11701
534 Ga0495624_0259846 3300046690 Bacteria 1049
535 Ga0495624_0508609 3300046690 Bacteria 720
536 Ga0495600_0002467 3300046809 Bacteria 10614
537 Ga0495600_0013142 3300046809 Bacteria 5193
538 Ga0495600_0030486 3300046809 Bacteria 3493
539 Ga0495581_0002705 3300047315 Bacteria 10095
540 Ga0495581_0034298 3300047315 Bacteria 2936
541 Ga0495604_0511195 3300047317 Unclassified 778
542 Ga0495674_0030120 3300047319 Bacteria 4938
543 Ga0495674_0046818 3300047319 Bacteria 3838
544 Ga0495674_0175193 3300047319 Bacteria 1788
545 Ga0495674_0236194 3300047319 Bacteria 1507
546 Ga0495674_0292720 3300047319 Bacteria 1331
547 Ga0495674_0315489 3300047319 Bacteria 1275
548 Ga0495676_0062029 3300047321 Bacteria 2921
549 Ga0495676_0093232 3300047321 Unclassified 2246
550 Ga0495676_0668626 3300047321 Bacteria 673
551 Ga0495676_0713650 3300047321 Bacteria 648
552 Ga0495680_0007344 3300047322 Bacteria 10133
553 Ga0495680_0017518 3300047322 Bacteria 6113
554 Ga0495680_0114235 3300047322 Bacteria 1998
555 Ga0495675_0071944 3300047444 Bacteria 2182
556 Ga0495684_0118853 3300047471 Bacteria 1991
557 Ga0495684_0157267 3300047471 Bacteria 1697
558 Ga0495684_0161729 3300047471 Bacteria 1669
559 Ga0495684_0168252 3300047471 Bacteria 1631
560 Ga0495684_0442851 3300047471 Unclassified 904
561 Ga0495593_0000565 3300047673 Bacteria 21033
562 Ga0495593_0063917 3300047673 Bacteria 1921
563 Ga0495602_0046738 3300048088 Bacteria 3907
564 Ga0495602_0084063 3300048088 Bacteria 2663
565 Ga0495602_0372677 3300048088 Bacteria 1025
566 Ga0495614_0016330 3300048089 Bacteria 3232
567 Ga0496100_0014311 3300048903 Bacteria 4604
568 Ga0496100_0123503 3300048903 Bacteria 1814
569 Ga0496100_0131543 3300048903 Unclassified 1763
570 Ga0496100_0138809 3300048903 Bacteria 1720
571 Ga0496100_0158035 3300048903 Bacteria 1623
572 Ga0496100_0621115 3300048903 Bacteria 840
573 Ga0496100_0855944 3300048903 Unclassified 713
574 Ga0496101_0034801 3300048904 Bacteria 3560
575 Ga0496101_0041291 3300048904 Bacteria 3289
576 Ga0496101_0060979 3300048904 Bacteria 2738
577 Ga0496101_0279130 3300048904 Bacteria 1305
578 Ga0496102_0007138 3300048905 Bacteria 9541
579 Ga0496102_0322318 3300048905 Unclassified 1456
580 Ga0496102_0534447 3300048905 Bacteria 1095
581 Ga0496102_0848783 3300048905 Bacteria 835
582 Ga0496102_0851294 3300048905 Bacteria 834
583 Ga0496103_0003608 3300048906 Bacteria 9443
584 Ga0496103_0778956 3300048906 Bacteria 604
585 Ga0496104_0001928 3300048907 Bacteria 17982
586 Ga0496104_0037003 3300048907 Bacteria 4564
587 Ga0496104_0086929 3300048907 Bacteria 2985
588 Ga0496104_0091702 3300048907 Bacteria 2905
589 Ga0496104_0365161 3300048907 Bacteria 1356
590 Ga0496104_1388879 3300048907 Bacteria 605
591 Ga0496105_0004932 3300048908 Bacteria 10089
592 Ga0496105_0009958 3300048908 Bacteria 7456
593 Ga0496105_0019382 3300048908 Bacteria 5487
594 Ga0496105_0078859 3300048908 Bacteria 2719
595 Ga0496105_0428181 3300048908 Bacteria 1047
596 Ga0496105_0488256 3300048908 Bacteria 968
597 Ga0496106_0000267 3300048909 Bacteria 36822
598 Ga0496106_0015438 3300048909 Bacteria 5653
599 Ga0496106_0199299 3300048909 Unclassified 1593
600 Ga0496106_0227276 3300048909 Bacteria 1489
601 Ga0496106_0388930 3300048909 Bacteria 1121
602 Ga0496106_0699103 3300048909 Bacteria 808
603 Ga0496106_1046613 3300048909 Unclassified 641
604 Ga0496107_0010706 3300048910 Bacteria 6378
605 Ga0496107_0266171 3300048910 Bacteria 1276
606 Ga0496107_0321745 3300048910 Bacteria 1151
607 Ga0496108_0002523 3300048911 Bacteria 14650
608 Ga0496108_0011624 3300048911 Bacteria 7161
609 Ga0496108_0019450 3300048911 Bacteria 5578
610 Ga0496108_0029748 3300048911 Bacteria 4526
611 Ga0496108_0104245 3300048911 Bacteria 2421
612 Ga0496108_0666052 3300048911 Bacteria 904
613 Ga0496108_0788825 3300048911 Unclassified 820
614 Ga0496108_0867802 3300048911 Unclassified 776
615 Ga0496109_0005242 3300048912 Bacteria 10824
616 Ga0496109_0027254 3300048912 Bacteria 5100
617 Ga0496109_0192034 3300048912 Bacteria 1919
618 Ga0496109_0236811 3300048912 Bacteria 1717
619 Ga0496109_0237571 3300048912 Bacteria 1714
620 Ga0496109_0448832 3300048912 Unclassified 1218
621 Ga0496109_1743924 3300048912 Bacteria 556
622 Ga0496110_0007349 3300048913 Bacteria 8796
623 Ga0496110_0047805 3300048913 Bacteria 3748
624 Ga0496110_0057578 3300048913 Bacteria 3421
625 Ga0496110_0072025 3300048913 Bacteria 3066
626 Ga0496110_0140880 3300048913 Bacteria 2180
627 Ga0496110_0284137 3300048913 Unclassified 1507
628 Ga0496110_0993166 3300048913 Bacteria 747
629 Ga0496111_0002443 3300048914 Bacteria 11228
630 Ga0496111_0006525 3300048914 Bacteria 7585
631 Ga0496111_0193486 3300048914 Bacteria 1512
632 Ga0496111_0280656 3300048914 Bacteria 1235
633 Ga0496112_0000999 3300048915 Bacteria 20726
634 Ga0496112_0197750 3300048915 Bacteria 1970
635 Ga0496112_0484225 3300048915 Unclassified 1173
636 Ga0496112_0514949 3300048915 Bacteria 1131
637 Ga0496112_0887956 3300048915 Bacteria 814
638 Ga0496113_0001652 3300048916 Bacteria 12587
639 Ga0496113_0166760 3300048916 Bacteria 1743
640 Ga0496114_0087378 3300048917 Bacteria 2643
641 Ga0496114_0121830 3300048917 Bacteria 2244
642 Ga0496114_0145600 3300048917 Bacteria 2053
643 Ga0496114_0183247 3300048917 Bacteria 1829
644 Ga0496114_0554194 3300048917 Bacteria 1015
645 Ga0496114_0663763 3300048917 Bacteria 916
646 Ga0496114_1109651 3300048917 Bacteria 676
647 Ga0496115_0008805 3300048918 Bacteria 7480
648 Ga0496115_0112062 3300048918 Bacteria 2241
649 Ga0496115_0302107 3300048918 Bacteria 1311
650 Ga0496124_0639714 3300048927 Bacteria 685
651 Ga0501032_0016957 3300049569 Bacteria 5119
652 Ga0501033_0025189 3300049570 Bacteria 4482
653 Ga0501034_0344083 3300049571 Bacteria 1421
654 Ga0501038_0081702 3300049574 Bacteria 2722
655 Ga0501039_0011391 3300049575 Bacteria 6771
656 Ga0501041_0072993 3300049577 Bacteria 2108
657 Ga0501042_0146021 3300049578 Bacteria 1705
658 Ga0501046_0214263 3300049580 Bacteria 1428
659 Ga0501048_0036051 3300049582 Bacteria 3556
660 Ga0501067_0011369 3300049583 Bacteria 4929
661 Ga0501067_0018117 3300049583 Bacteria 3899
662 Ga0501067_0068142 3300049583 Bacteria 1970
663 Ga0501067_0118681 3300049583 Bacteria 1471
664 Ga0501067_0130336 3300049583 Bacteria 1400
665 Ga0501068_0077050 3300049584 Bacteria 2041
666 Ga0501068_0105611 3300049584 Bacteria 1748
667 Ga0501069_0020441 3300049585 Bacteria 3587
668 Ga0501069_0022054 3300049585 Bacteria 3460
669 Ga0501070_0035918 3300049586 Bacteria 4139
670 Ga0501071_0016220 3300049587 Bacteria 5121
671 Ga0501072_0028620 3300049588 Bacteria 4350
672 Ga0501074_0052534 3300049590 Bacteria 2941
673 Ga0501075_0156324 3300049591 Bacteria 1738
674 Ga0501076_0025411 3300049592 Bacteria 4582
675 Ga0501077_0025222 3300049593 Bacteria 3776
676 Ga0501079_0089795 3300049741 Bacteria 2379
677 Ga0501080_0020358 3300049742 Bacteria 6139
678 Ga0501081_0003439 3300049743 Bacteria 10101
679 Ga0501083_0017148 3300049744 Bacteria 5051
680 Ga0501044_0215088 3300049823 Bacteria 1875
681 Ga0501045_0006588 3300049824 Bacteria 8045
682 Ga0501045_0690826 3300049824 Bacteria 753
683 Ga0501045_1044059 3300049824 Unclassified 599
684 nmdc:mga05p37_13738_c1 3300050507 Bacteria 9702
685 nmdc:mga05p37_1437006_c1 3300050507 Bacteria 692
686 nmdc:mga05p37_161533_c1 3300050507 Bacteria 2736
687 nmdc:mga05p37_347448_c1 3300050507 Bacteria 1747
688 nmdc:mga05p37_55719_c1 3300050507 Bacteria 4866
689 nmdc:mga09592_313304_c1 3300050508 Bacteria 1360
690 nmdc:mga06r32_432874_c1 3300050510 Bacteria 1296
691 nmdc:mga06r32_747909_c1 3300050510 Bacteria 941
692 nmdc:mga08y16_36275_c1 3300050511 Bacteria 5177
693 nmdc:mga08y16_538225_c1 3300050511 Bacteria 1183
694 nmdc:mga08y16_55053_c1 3300050511 Bacteria 4158
695 nmdc:mga0n895_16510_c1 3300050512 Bacteria 6777
696 nmdc:mga0a205_140087_c1 3300050515 Bacteria 2319
697 nmdc:mga0a205_183177_c1 3300050515 Bacteria 1988
698 nmdc:mga0a205_708412_c1 3300050515 Bacteria 856
699 Ga0495601_0011602 3300053077 Bacteria 5279
700 Ga0495601_0050872 3300053077 Bacteria 2614
701 Ga0495601_0099689 3300053077 Bacteria 1875
702 Ga0495612_0019518 3300053078 Bacteria 2714
703 Ga0495612_0272438 3300053078 Bacteria 755
704 Ga0495595_0017686 3300053084 Bacteria 3070
705 Ga0495595_0021737 3300053084 Bacteria 2806
706 Ga0495595_0032166 3300053084 Bacteria 2361
707 Ga0495595_0227660 3300053084 Unclassified 931
708 Ga0495595_0323647 3300053084 Bacteria 776
709 Ga0495619_0034435 3300053085 Bacteria 3292
710 Ga0495619_0040196 3300053085 Bacteria 3057
711 Ga0495619_0098459 3300053085 Bacteria 1988
712 Ga0495619_0204205 3300053085 Bacteria 1368
713 Ga0495619_0529357 3300053085 Unclassified 809
714 Ga0501084_0118766 3300054114 Bacteria 2223
715 Ga0501084_0210234 3300054114 Bacteria 1641
716 Ga0501082_0946871 3300060353 Bacteria 753
717 Ga0501082_1224192 3300060353 Unclassified 656
718 Ga0530510_0027347 3300061734 Bacteria 4086
719 Ga0530510_0039801 3300061734 Bacteria 3392
720 Ga0207700_10013384
721 JGI24745J21846_1008495
722 JGI24738J21930_10007916
723 Ga0070658_10002246
724 Ga0070658_10012968
725 Ga0070658_10624982
726 Ga0070683_100040499
727 Ga0070683_100051181
728 Ga0070683_100128458
729 Ga0070683_100135124
730 Ga0070683_100283671
731 Ga0070690_100056132
732 Ga0070690_100368928
733 Ga0070670_100247464
734 Ga0070677_10020164
735 Ga0068869_100034090
736 Ga0068869_100054298
737 Ga0070680_100003014
738 Ga0070680_100634034
739 Ga0070682_100004449
740 Ga0070682_100868350
741 Ga0068868_100016912
742 Ga0068868_100028572
743 Ga0068868_100078054
744 Ga0068868_100306995
745 Ga0070660_100006426
746 Ga0070660_100019024
747 Ga0070660_100210920
748 Ga0070660_100660465
749 Ga0070689_100054456
750 Ga0070691_10005665
751 Ga0070661_100013401
752 Ga0070661_100189302
753 Ga0070661_100595265
754 Ga0070692_10001978
755 Ga0070675_100005503
756 Ga0070675_100047824
757 Ga0070675_100077583
758 Ga0070675_100328532
759 Ga0070675_101081631
760 Ga0070671_100052072
761 Ga0070671_100096221
762 Ga0070671_100357926
763 Ga0070671_101184559
764 Ga0070674_100022979
765 Ga0070674_100044679
766 Ga0070674_100252801
767 Ga0070673_100003272
768 Ga0070673_100046360
769 Ga0070688_100001684
770 Ga0070688_100088081
771 Ga0070659_100018493
772 Ga0070659_100225371
773 Ga0070667_100571655
774 Ga0070703_10318095
775 Ga0070709_10017902
776 Ga0070709_10322252
777 Ga0070709_10365869
778 Ga0070709_10402274
779 Ga0070709_10441250
780 Ga0070714_100045976
781 Ga0070714_100067112
782 Ga0070714_100134609
783 Ga0070714_100152195
784 Ga0070714_100307998
785 Ga0070714_101088197
786 Ga0070713_100036906
787 Ga0070713_100042573
788 Ga0070713_100093613
789 Ga0070713_100104357
790 Ga0070713_100569247
791 Ga0070713_100817497
792 Ga0070713_100888140
793 Ga0070713_100889235
794 Ga0070701_10034878
795 Ga0070711_100138370
796 Ga0070700_100066624
797 Ga0070700_100129341
798 Ga0070708_100252581
799 Ga0070708_100927595
800 Ga0070663_100021470
801 Ga0070663_100088373
802 Ga0070678_100020731
803 Ga0070678_100116140
804 Ga0070678_100957020
805 Ga0070662_100010836
806 Ga0070662_100022055
807 Ga0070662_100388463
808 Ga0070662_100615099
809 Ga0070681_10044555
810 Ga0070681_10608640
811 Ga0068867_100110726
812 Ga0068867_100363779
813 Ga0070685_10050101
814 Ga0070685_10117123
815 Ga0070707_100012417
816 Ga0070707_101454158
817 Ga0070698_100440575
818 Ga0070699_100198012
819 Ga0070679_100010105
820 Ga0070679_100047424
821 Ga0070679_100260628
822 Ga0070679_100760924
823 Ga0070684_100022528
824 Ga0070684_100202594
825 Ga0070684_100389338
826 Ga0070684_100401564
827 Ga0068853_100008648
828 Ga0068853_100216204
829 Ga0068853_100677333
830 Ga0070672_100004142
831 Ga0070672_100019912
832 Ga0070686_100042474
833 Ga0070696_100040208
834 Ga0070693_100554982
835 Ga0070665_100468937
836 Ga0070665_100886657
837 Ga0070704_100002650
838 Ga0068855_100009917
839 Ga0068855_100011500
840 Ga0070664_100087744
841 Ga0070664_100100534
842 Ga0068854_100014764
843 Ga0068854_100041514
844 Ga0068854_100081675
845 Ga0068856_100065522
846 Ga0068856_100711424
847 Ga0068856_101257178
848 Ga0070702_100004598
849 Ga0070702_100093022
850 Ga0070702_100343443
851 Ga0070702_100401935
852 Ga0068852_100189242
853 Ga0068852_100419248
854 Ga0068864_100002446
855 Ga0068864_100032373
856 Ga0068864_100746069
857 Ga0068861_100084176
858 Ga0068861_100106799
859 Ga0068861_100192807
860 Ga0068851_10025520
861 Ga0068870_10242795
862 Ga0068863_101293854
863 Ga0068858_100067060
864 Ga0068858_100068193
865 Ga0068860_100603982
866 Ga0081455_10016850
867 Ga0070717_10023388
868 Ga0070717_10157192
869 Ga0075432_10040158
870 Ga0070715_10068805
871 Ga0070716_100002183
872 Ga0070712_100069553
873 Ga0070712_100200493
874 Ga0070712_100207715
875 Ga0070712_100229723
876 Ga0070712_100512955
877 Ga0070712_101187118
878 Ga0097621_100021889
879 Ga0097621_100029863
880 Ga0097621_100134045
881 Ga0097621_100687249
882 Ga0068871_100038569
883 Ga0068871_100417448
884 Ga0075428_101617046
885 Ga0075431_100860236
886 Ga0075433_10166818
887 Ga0075434_100410268
888 Ga0075434_100610998
889 Ga0075429_100338375
890 Ga0068865_100007432
891 Ga0068865_100014093
892 Ga0068865_100071190
893 Ga0068865_100325296
894 Ga0075436_100056893
895 Ga0105240_10189093
896 Ga0105240_10466541
897 Ga0111539_10028527
898 Ga0111539_10077730
899 Ga0105245_10016608
900 Ga0105245_10026165
901 Ga0105245_10047194
902 Ga0105245_10103292
903 Ga0105245_10316810
904 Ga0105245_11664864
905 Ga0105247_10021780
906 Ga0114129_10004271
907 Ga0114129_10141826
908 Ga0114129_10218885
909 Ga0105243_10004668
910 Ga0105243_10039138
911 Ga0105243_10043495
912 Ga0105243_10596482
913 Ga0105241_10347379
914 Ga0105241_10399826
915 Ga0105242_10009778
916 Ga0105242_10087789
917 Ga0105248_10349919
918 Ga0105248_10926326
919 Ga0105248_11325502
920 Ga0105237_11106636
921 Ga0105237_11501504
922 Ga0105238_10025064
923 Ga0105238_10136782
924 Ga0105249_10081258
925 Ga0105239_10012022
926 Ga0105239_10016925
927 Ga0105239_11141396
928 Ga0105246_10002422
929 Ga0105246_10024978
930 Ga0105246_10099791
931 Ga0105246_10631513
932 Ga0157342_1023313
933 Ga0157373_10077615
934 Ga0157371_10008776
935 Ga0157370_10004745
936 Ga0157369_10135441
937 Ga0157369_10229636
938 Ga0157374_10021483
939 Ga0163162_11942801
940 Ga0157372_10015578
941 Ga0157372_10185600
942 Ga0157375_10036371
943 Ga0157375_10043935
944 Ga0157375_10064228
945 Ga0157375_10079652
946 Ga0157375_10143415
947 Ga0163163_10004309
948 Ga0163163_10042065
949 Ga0163163_10406033
950 Ga0157380_10076670
951 Ga0157380_10080193
952 Ga0157377_10004333
953 Ga0157377_10027192
954 Ga0157377_10036615
955 Ga0157377_10047155
956 Ga0157379_10060947
957 Ga0157376_10002114
958 Ga0157376_10014437
959 Ga0157376_10467307
960 Ga0163161_10208119
961 Ga0197907_10066705
962 Ga0206356_10644285
963 Ga0206354_11059346
964 Ga0206353_11406901
965 Ga0206353_11708877
966 Ga0224712_10012774
967 Ga0207656_10042289
968 Ga0207692_10042189
969 Ga0207692_10185241
970 Ga0207642_10035052
971 Ga0207688_10005718
972 Ga0207688_10028872
973 Ga0207688_10030423
974 Ga0207688_10030820
975 Ga0207688_10142853
976 Ga0207685_10035555
977 Ga0207699_10018894
978 Ga0207699_10025172
979 Ga0207699_10074500
980 Ga0207699_10101710
981 Ga0207707_10147817
982 Ga0207707_10571023
983 Ga0207695_10066162
984 Ga0207671_10022937
985 Ga0207671_10973316
986 Ga0207693_10051668
987 Ga0207693_10217832
988 Ga0207693_10263170
989 Ga0207693_10352919
990 Ga0207663_10135880
991 Ga0207663_10237896
992 Ga0207663_10305437
993 Ga0207660_10055182
994 Ga0207660_10084615
995 Ga0207660_10609359
996 Ga0207662_10552652
997 Ga0207657_10000500
998 Ga0207657_10006924
999 Ga0207657_10009238
1000 Ga0207657_10071185
1001 Ga0207657_10090727
1002 Ga0207649_10073595
1003 Ga0207649_10310218
1004 Ga0207649_11035411
1005 Ga0207652_10193850
1006 Ga0207652_10222553
1007 Ga0207652_11032837
1008 Ga0207646_10256513
1009 Ga0207681_10066987
1010 Ga0207694_10023862
1011 Ga0207694_10125211
1012 Ga0207659_10009818
1013 Ga0207687_10001904
1014 Ga0207687_10006499
1015 Ga0207687_10029501
1016 Ga0207687_10094115
1017 Ga0207700_10010908
1018 Ga0207700_10222301
1019 Ga0207700_10343267
1020 Ga0207700_10442631
1021 Ga0207700_10770624
1022 Ga0207700_10879600
1023 Ga0207664_10026372
1024 Ga0207664_10031744
1025 Ga0207664_10312546
1026 Ga0207664_10335251
1027 Ga0207664_10373554
1028 Ga0207664_10890943
1029 Ga0207644_10563525
1030 Ga0207690_10006808
1031 Ga0207690_10432208
1032 Ga0207706_10002917
1033 Ga0207706_10074467
1034 Ga0207706_10137817
1035 Ga0207686_10006569
1036 Ga0207686_10159561
1037 Ga0207709_10027984
1038 Ga0207709_10086541
1039 Ga0207670_11540512
1040 Ga0207669_10015953
1041 Ga0207669_10193461
1042 Ga0207669_10270640
1043 Ga0207704_10053704
1044 Ga0207704_10075682
1045 Ga0207704_10094267
1046 Ga0207665_10004807
1047 Ga0207665_10313215
1048 Ga0207665_10720204
1049 Ga0207691_10004695
1050 Ga0207691_10010964
1051 Ga0207691_10602969
1052 Ga0207691_10935459
1053 Ga0207711_10108875
1054 Ga0207711_10364345
1055 Ga0207711_10767671
1056 Ga0207689_10041019
1057 Ga0207689_10046265
1058 Ga0207689_10083185
1059 Ga0207661_10048769
1060 Ga0207661_10146828
1061 Ga0207661_10186627
1062 Ga0207661_10808270
1063 Ga0207679_10030896
1064 Ga0207679_10541165
1065 Ga0207667_10014022
1066 Ga0207667_10040461
1067 Ga0207667_10119352
1068 Ga0207667_10375747
1069 Ga0207651_10128463
1070 Ga0207712_10042163
1071 Ga0207712_10107180
1072 Ga0207668_10102769
1073 Ga0207668_10824780
1074 Ga0207640_10698400
1075 Ga0207677_10003865
1076 Ga0207677_10029217
1077 Ga0207677_10787539
1078 Ga0207703_10269003
1079 Ga0207703_10480508
1080 Ga0207639_10325133
1081 Ga0207678_10040053
1082 Ga0207678_10063597
1083 Ga0207678_10747377
1084 Ga0207708_10039650
1085 Ga0207702_10844312
1086 Ga0207702_10977782
1087 Ga0207641_10310849
1088 Ga0207648_10024835
1089 Ga0207648_10047368
1090 Ga0207648_10135286
1091 Ga0207676_10050731
1092 Ga0207676_10429659
1093 Ga0207674_10089443
1094 Ga0207674_10106894
1095 Ga0207674_10603539
1096 Ga0207675_100028123
1097 Ga0207675_100054500
1098 Ga0207675_100085094
1099 Ga0207675_100299894
1100 Ga0207683_10010150
1101 Ga0207683_10023897
1102 Ga0207683_10024814
1103 Ga0207698_10006255
1104 Ga0207698_10132067
1105 Ga0207698_10649106
1106 Ga0207428_10047959
1107 Ga0268266_10186488
1108 Ga0268266_11139863
1109 Ga0268265_10408104
1110 Ga0268264_10511461
1111 Ga0265337_1017963
1112 Ga0265326_10003428
1113 Ga0265319_1002436
1114 Ga0265334_10001479
1115 Ga0265318_10028191
1116 Ga0265322_10116896
1117 Ga0265336_10002607
1118 Ga0265338_10007032
1119 Ga0265324_10002584
1120 Ga0265332_10004978
1121 Ga0265320_10124094
1122 Ga0265325_10016011
1123 Ga0265340_10001964
1124 Ga0265331_10384920
1125 Ga0265327_10185018
1126 Ga0265316_10015673
1127 Ga0265313_10006404
1128 Ga0265314_10007900
1129 Ga0265342_10063193
1130 Ga0373948_0073060
1131 Ga0373926_0048807
1132 Ga0373934_0192845
1133 Ga0373951_0217998
1134 Ga0373936_0038842
1135 Ga0373941_0009412
1136 Ga0373945_0004091
1137 Ga0373953_0100612
1138 Ga0373954_0299611
1139 Ga0373954_0395143
1140 Ga0373957_0033740
1141 Ga0373957_0203680
1142 Ga0373943_0000611
1143 Ga0373943_0261021
1144 Ga0373943_0756986
1145 Ga0373946_0164232
1146 Ga0373946_0369083
1147 Ga0373955_0033908
1148 Ga0373955_0131637
1149 Ga0373961_0009456
1150 Ga0373924_0111947
1151 Ga0373931_0164644
1152 Ga0373935_0104722
1153 Ga0373927_0114463
1154 Ga0373927_0274219
1155 Ga0373933_0437941
1156 Ga0373947_0001645
1157 Ga0373947_0087902
1158 Ga0373947_0346439
1159 Ga0373937_0157455
1160 Ga0373937_0680894
1161 Ga0373925_0339387
1162 Ga0373925_0656828
1163 Ga0395899_0025098
1164 Ga0395900_0091819
1165 Ga0395898_0058910
1166 Ga0395905_0097984
1167 Ga0395901_0003793
1168 Ga0395901_0575323
1169 Ga0395901_0699094
1170 Ga0451807_1927123
1171 Ga0451845_0748284
1172 Ga0451853_0563705
1173 Ga0466963_0003664
1174 Ga0466963_0040113
1175 Ga0466957_0026204
1176 Ga0466960_0000027
1177 Ga0466967_0006427
1178 Ga0466967_0087600
1179 Ga0495592_0059959
1180 Ga0495592_0082504
1181 Ga0495592_0229130
1182 Ga0495603_0009699
1183 Ga0495603_0055713
1184 Ga0495603_0086118
1185 Ga0495629_0061713
1186 Ga0495641_0030785
1187 Ga0495641_0067290
1188 Ga0495641_0206453
1189 Ga0495651_0031320
1190 Ga0495651_0316939
1191 Ga0495651_0741065
1192 Ga0495653_0008743
1193 Ga0495653_0078383
1194 Ga0495653_0177430
1195 Ga0495653_0566533
1196 Ga0495580_0079968
1197 Ga0495580_0246627
1198 Ga0495582_0013511
1199 Ga0495582_0043040
1200 Ga0495582_0106495
1201 Ga0495582_0178019
1202 Ga0495639_0001364
1203 Ga0495639_0017211
1204 Ga0495662_0006680
1205 Ga0495664_0068435
1206 Ga0495594_0009395
1207 Ga0495608_0020534
1208 Ga0495608_0028561
1209 Ga0495608_0137970
1210 Ga0495608_0306635
1211 Ga0495618_0134430
1212 Ga0495618_0141853
1213 Ga0495618_0470033
1214 Ga0495628_0477827
1215 Ga0495630_0118348
1216 Ga0495630_0309434
1217 Ga0495630_0349583
1218 Ga0495666_0019124
1219 Ga0495652_0158711
1220 Ga0495665_0001660
1221 Ga0495640_0014567
1222 Ga0495640_0059573
1223 Ga0495640_0236361
1224 Ga0495586_0054620
1225 Ga0495587_0013545
1226 Ga0495587_0188631
1227 Ga0495645_0192403
1228 Ga0495667_0014578
1229 Ga0495667_0015837
1230 Ga0495634_0005671
1231 Ga0495634_0146171
1232 Ga0495634_0417507
1233 Ga0495635_0006524
1234 Ga0495635_0105594
1235 Ga0495635_0251835
1236 Ga0495588_0083604
1237 Ga0495588_0283161
1238 Ga0495657_0025027
1239 Ga0495657_0108013
1240 Ga0495599_0107826
1241 Ga0495599_0418090
1242 Ga0495623_0022529
1243 Ga0495623_0186644
1244 Ga0495646_0215162
1245 Ga0495646_0268827
1246 Ga0495647_0016582
1247 Ga0495647_0240562
1248 Ga0495658_0003162
1249 Ga0495658_0203352
1250 Ga0495658_0517770
1251 Ga0495613_0024274
1252 Ga0495624_0003459
1253 Ga0495624_0259846
1254 Ga0495624_0508609
1255 Ga0495600_0002467
1256 Ga0495600_0013142
1257 Ga0495600_0030486
1258 Ga0495581_0002705
1259 Ga0495581_0034298
1260 Ga0495604_0511195
1261 Ga0495674_0030120
1262 Ga0495674_0046818
1263 Ga0495674_0175193
1264 Ga0495674_0236194
1265 Ga0495674_0292720
1266 Ga0495674_0315489
1267 Ga0495676_0062029
1268 Ga0495676_0093232
1269 Ga0495676_0668626
1270 Ga0495676_0713650
1271 Ga0495680_0007344
1272 Ga0495680_0017518
1273 Ga0495680_0114235
1274 Ga0495675_0071944
1275 Ga0495684_0118853
1276 Ga0495684_0157267
1277 Ga0495684_0161729
1278 Ga0495684_0168252
1279 Ga0495684_0442851
1280 Ga0495593_0000565
1281 Ga0495593_0063917
1282 Ga0495602_0046738
1283 Ga0495602_0084063
1284 Ga0495602_0372677
1285 Ga0495614_0016330
1286 Ga0496100_0014311
1287 Ga0496100_0123503
1288 Ga0496100_0131543
1289 Ga0496100_0138809
1290 Ga0496100_0158035
1291 Ga0496100_0621115
1292 Ga0496100_0855944
1293 Ga0496101_0034801
1294 Ga0496101_0041291
1295 Ga0496101_0060979
1296 Ga0496101_0279130
1297 Ga0496102_0007138
1298 Ga0496102_0322318
1299 Ga0496102_0534447
1300 Ga0496102_0848783
1301 Ga0496102_0851294
1302 Ga0496103_0003608
1303 Ga0496103_0778956
1304 Ga0496104_0001928
1305 Ga0496104_0037003
1306 Ga0496104_0086929
1307 Ga0496104_0091702
1308 Ga0496104_0365161
1309 Ga0496104_1388879
1310 Ga0496105_0004932
1311 Ga0496105_0009958
1312 Ga0496105_0019382
1313 Ga0496105_0078859
1314 Ga0496105_0428181
1315 Ga0496105_0488256
1316 Ga0496106_0000267
1317 Ga0496106_0015438
1318 Ga0496106_0199299
1319 Ga0496106_0227276
1320 Ga0496106_0388930
1321 Ga0496106_0699103
1322 Ga0496106_1046613
1323 Ga0496107_0010706
1324 Ga0496107_0266171
1325 Ga0496107_0321745
1326 Ga0496108_0002523
1327 Ga0496108_0011624
1328 Ga0496108_0019450
1329 Ga0496108_0029748
1330 Ga0496108_0104245
1331 Ga0496108_0666052
1332 Ga0496108_0788825
1333 Ga0496108_0867802
1334 Ga0496109_0005242
1335 Ga0496109_0027254
1336 Ga0496109_0192034
1337 Ga0496109_0236811
1338 Ga0496109_0237571
1339 Ga0496109_0448832
1340 Ga0496109_1743924
1341 Ga0496110_0007349
1342 Ga0496110_0047805
1343 Ga0496110_0057578
1344 Ga0496110_0072025
1345 Ga0496110_0140880
1346 Ga0496110_0284137
1347 Ga0496110_0993166
1348 Ga0496111_0002443
1349 Ga0496111_0006525
1350 Ga0496111_0193486
1351 Ga0496111_0280656
1352 Ga0496112_0000999
1353 Ga0496112_0197750
1354 Ga0496112_0484225
1355 Ga0496112_0514949
1356 Ga0496112_0887956
1357 Ga0496113_0001652
1358 Ga0496113_0166760
1359 Ga0496114_0087378
1360 Ga0496114_0121830
1361 Ga0496114_0145600
1362 Ga0496114_0183247
1363 Ga0496114_0554194
1364 Ga0496114_0663763
1365 Ga0496114_1109651
1366 Ga0496115_0008805
1367 Ga0496115_0112062
1368 Ga0496115_0302107
1369 Ga0496124_0639714
1370 Ga0501032_0016957
1371 Ga0501033_0025189
1372 Ga0501034_0344083
1373 Ga0501038_0081702
1374 Ga0501039_0011391
1375 Ga0501041_0072993
1376 Ga0501042_0146021
1377 Ga0501046_0214263
1378 Ga0501048_0036051
1379 Ga0501067_0011369
1380 Ga0501067_0018117
1381 Ga0501067_0068142
1382 Ga0501067_0118681
1383 Ga0501067_0130336
1384 Ga0501068_0077050
1385 Ga0501068_0105611
1386 Ga0501069_0020441
1387 Ga0501069_0022054
1388 Ga0501070_0035918
1389 Ga0501071_0016220
1390 Ga0501072_0028620
1391 Ga0501074_0052534
1392 Ga0501075_0156324
1393 Ga0501076_0025411
1394 Ga0501077_0025222
1395 Ga0501079_0089795
1396 Ga0501080_0020358
1397 Ga0501081_0003439
1398 Ga0501083_0017148
1399 Ga0501044_0215088
1400 Ga0501045_0006588
1401 Ga0501045_0690826
1402 Ga0501045_1044059
1403 nmdc:mga05p37_13738_c1
1404 nmdc:mga05p37_1437006_c1
1405 nmdc:mga05p37_161533_c1
1406 nmdc:mga05p37_347448_c1
1407 nmdc:mga05p37_55719_c1
1408 nmdc:mga09592_313304_c1
1409 nmdc:mga06r32_432874_c1
1410 nmdc:mga06r32_747909_c1
1411 nmdc:mga08y16_36275_c1
1412 nmdc:mga08y16_538225_c1
1413 nmdc:mga08y16_55053_c1
1414 nmdc:mga0n895_16510_c1
1415 nmdc:mga0a205_140087_c1
1416 nmdc:mga0a205_183177_c1
1417 nmdc:mga0a205_708412_c1
1418 Ga0495601_0011602
1419 Ga0495601_0050872
1420 Ga0495601_0099689
1421 Ga0495612_0019518
1422 Ga0495612_0272438
1423 Ga0495595_0017686
1424 Ga0495595_0021737
1425 Ga0495595_0032166
1426 Ga0495595_0227660
1427 Ga0495595_0323647
1428 Ga0495619_0034435
1429 Ga0495619_0040196
1430 Ga0495619_0098459
1431 Ga0495619_0204205
1432 Ga0495619_0529357
1433 Ga0501084_0118766
1434 Ga0501084_0210234
1435 Ga0501082_0946871
1436 Ga0501082_1224192
1437 Ga0530510_0027347
1438 Ga0530510_0039801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

13

77

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.9124 9 154
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.9121 20 152
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.8885 4 154
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8867 5 159
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.8851 4 155
ID Description Score Start End Superfamily
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8881 16 140 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8764 36 154 1.20.1290.10
af_O53377_388_550_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8629 13 148 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8439 36 154 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8382 24 148 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A221SUX8-F1-model_v4 Peroxidase 0.9807 10 172 GO:0051920
AF-A0A6L5F588-F1-model_v4 Peroxidase 0.9803 9 170 GO:0051920
AF-A0A538CJI4-F1-model_v4 Peroxidase 0.9766 9 170 GO:0051920
AF-A0A561W221-F1-model_v4 Putative peroxidase-related enzyme 0.9723 9 167 GO:0004601
AF-A0A5D0P2S8-F1-model_v4 deleted 0.9645 7 163

Map