F477206
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 406 | 647 | 249 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2966598605|2966604224 |
| Length | 257 |
| Sequence | RDFEGLSALVTGGASGIGAAVAAQLLTRGARVAVLDLDPEGAPAGCLALRADVTDDDAVRDAVERAAAGLGGLHTVVSNAGIGSIGTVEDNADEEWTRVLDLNVLGMVRTARHALPHLRRAAAARPGAVSITQTCSIAATAGLPQRALYSASKGAVLSLTLAMAADHVREGIRVNCVNPGTADTPWIGRLLGQAEDPAAERAALDARQPLGRLVSADEVAAAVLYLASPAAASVTGTALAVDGGMQGLRLRPAPPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 2 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 3 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 4 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 5 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 6 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 7 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 8 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 9 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 10 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 11 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 12 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 13 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 14 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 15 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 16 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 17 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 18 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 19 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 20 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 21 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 22 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 23 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 24 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 25 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 26 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 27 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 28 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 29 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 30 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 31 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 32 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 33 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 34 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 35 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 36 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 37 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 38 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 39 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 40 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 41 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 42 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 43 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 44 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 45 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 46 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 47 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 48 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 49 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 50 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 51 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 52 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 53 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 54 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 55 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 56 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 57 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 58 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 59 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 60 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 61 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 62 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 63 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 64 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 65 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 67 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 68 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 69 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 101 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 102 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 103 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 111 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 126 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 174 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 175 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 197 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 216 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 217 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 218 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 219 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 224 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 227 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 228 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 229 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 230 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 231 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 232 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 233 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 234 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 235 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 236 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 237 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 238 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 239 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 240 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 241 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 339 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 340 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 341 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 342 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 343 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 370 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 378 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 381 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 382 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 385 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 386 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 387 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 388 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 389 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 390 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 391 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 392 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 394 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 395 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 396 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 397 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 399 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 401 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 402 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 403 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 404 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 405 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 406 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.83 |
| Metatranscriptomes | 0.28 |
| Isolates | 9.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.55 |
| Nodule | 0.42 |
| Rhizoplane | 3.48 |
| Rhizosphere | 78.97 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 10.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10017128 | 3300001989 | Bacteria | 2617 |
| 2 | JGI24739J22299_10042956 | 3300001989 | Bacteria | 1497 |
| 3 | JGI24739J22299_10049648 | 3300001989 | Bacteria | 1360 |
| 4 | JGI24738J21930_10009736 | 3300002075 | Bacteria | 2155 |
| 5 | JGI25152J39213_1000109 | 3300002773 | Bacteria | 57724 |
| 6 | JGI25406J46586_10041231 | 3300003203 | Bacteria | 1627 |
| 7 | JGI25406J46586_10059721 | 3300003203 | Bacteria | 1237 |
| 8 | rootH1_10005650 | 3300003316 | Bacteria | 2366 |
| 9 | rootH1_10026697 | 3300003316 | Bacteria | 4176 |
| 10 | rootH1_10055768 | 3300003316 | Bacteria | 7296 |
| 11 | rootL2_10001330 | 3300003322 | Bacteria | 4188 |
| 12 | rootH1_10015077 | 3300003323 | Bacteria | 5583 |
| 13 | rootH1_10015078 | 3300003323 | Bacteria | 3268 |
| 14 | Ga0070683_100115720 | 3300005329 | Bacteria | 2531 |
| 15 | Ga0070683_100370914 | 3300005329 | Bacteria | 1363 |
| 16 | Ga0070683_100846362 | 3300005329 | Bacteria | 877 |
| 17 | Ga0068869_100123209 | 3300005334 | Bacteria | 1985 |
| 18 | Ga0070680_100018278 | 3300005336 | Bacteria | 5537 |
| 19 | Ga0070680_100065815 | 3300005336 | Bacteria | 2971 |
| 20 | Ga0070682_100051982 | 3300005337 | Bacteria | 2563 |
| 21 | Ga0070682_100268051 | 3300005337 | Bacteria | 1239 |
| 22 | Ga0070660_100044202 | 3300005339 | Bacteria | 3406 |
| 23 | Ga0070675_100392966 | 3300005354 | Bacteria | 1236 |
| 24 | Ga0070709_10012890 | 3300005434 | Bacteria | 4685 |
| 25 | Ga0070709_10052893 | 3300005434 | Bacteria | 2555 |
| 26 | Ga0070709_10167460 | 3300005434 | Bacteria | 1533 |
| 27 | Ga0070714_100051600 | 3300005435 | Bacteria | 3507 |
| 28 | Ga0070714_100090715 | 3300005435 | Bacteria | 2677 |
| 29 | Ga0070714_100226882 | 3300005435 | Bacteria | 1719 |
| 30 | Ga0070713_100014860 | 3300005436 | Bacteria | 5795 |
| 31 | Ga0070713_100103696 | 3300005436 | Bacteria | 2468 |
| 32 | Ga0070713_100157475 | 3300005436 | Bacteria | 2025 |
| 33 | Ga0070713_100236426 | 3300005436 | Bacteria | 1662 |
| 34 | Ga0070713_100504083 | 3300005436 | Bacteria | 1142 |
| 35 | Ga0070710_10004386 | 3300005437 | Bacteria | 6683 |
| 36 | Ga0070710_10032628 | 3300005437 | Unclassified | 2822 |
| 37 | Ga0070710_10064158 | 3300005437 | Unclassified | 2100 |
| 38 | Ga0070711_100016186 | 3300005439 | Bacteria | 4732 |
| 39 | Ga0070678_100075137 | 3300005456 | Bacteria | 2542 |
| 40 | Ga0070681_10073741 | 3300005458 | Bacteria | 3375 |
| 41 | Ga0070706_100262720 | 3300005467 | Bacteria | 1611 |
| 42 | Ga0070707_100066294 | 3300005468 | Bacteria | 3470 |
| 43 | Ga0070698_100009228 | 3300005471 | Bacteria | 10585 |
| 44 | Ga0070699_100076467 | 3300005518 | Bacteria | 2914 |
| 45 | Ga0070684_100065285 | 3300005535 | Bacteria | 3194 |
| 46 | Ga0070684_100321456 | 3300005535 | Bacteria | 1421 |
| 47 | Ga0068853_100095691 | 3300005539 | Bacteria | 2619 |
| 48 | Ga0068853_100170450 | 3300005539 | Bacteria | 1969 |
| 49 | Ga0068853_100302113 | 3300005539 | Bacteria | 1480 |
| 50 | Ga0070672_100122245 | 3300005543 | Bacteria | 2132 |
| 51 | Ga0070665_100111970 | 3300005548 | Bacteria | 2732 |
| 52 | Ga0070665_100217797 | 3300005548 | Bacteria | 1910 |
| 53 | Ga0068855_100009579 | 3300005563 | Bacteria | 11688 |
| 54 | Ga0068855_100439186 | 3300005563 | Bacteria | 1425 |
| 55 | Ga0068857_100627876 | 3300005577 | Bacteria | 1017 |
| 56 | Ga0068857_100687266 | 3300005577 | Bacteria | 972 |
| 57 | Ga0068854_100000781 | 3300005578 | Bacteria | 18916 |
| 58 | Ga0068854_100054481 | 3300005578 | Bacteria | 2876 |
| 59 | Ga0068856_100213535 | 3300005614 | Bacteria | 1945 |
| 60 | Ga0068856_100502046 | 3300005614 | Bacteria | 1234 |
| 61 | Ga0068856_100505448 | 3300005614 | Bacteria | 1230 |
| 62 | Ga0068852_100113891 | 3300005616 | Bacteria | 2463 |
| 63 | Ga0068852_100150038 | 3300005616 | Bacteria | 2167 |
| 64 | Ga0068852_100197985 | 3300005616 | Bacteria | 1900 |
| 65 | Ga0068851_10297548 | 3300005834 | Bacteria | 927 |
| 66 | Ga0081455_10001079 | 3300005937 | Bacteria | 34337 |
| 67 | Ga0081540_1002232 | 3300005983 | Bacteria | 15955 |
| 68 | Ga0081539_10001103 | 3300005985 | Bacteria | 49011 |
| 69 | Ga0081539_10003736 | 3300005985 | Bacteria | 18107 |
| 70 | Ga0081539_10022636 | 3300005985 | Bacteria | 4148 |
| 71 | Ga0081539_10038322 | 3300005985 | Bacteria | 2842 |
| 72 | Ga0081539_10064219 | 3300005985 | Bacteria | 1999 |
| 73 | Ga0070717_10241001 | 3300006028 | Bacteria | 1595 |
| 74 | Ga0070717_10288394 | 3300006028 | Bacteria | 1457 |
| 75 | Ga0075365_10101617 | 3300006038 | Bacteria | 1969 |
| 76 | Ga0075368_10005280 | 3300006042 | Bacteria | 4434 |
| 77 | Ga0075363_100123438 | 3300006048 | Bacteria | 1448 |
| 78 | Ga0075363_100141625 | 3300006048 | Bacteria | 1354 |
| 79 | Ga0075364_10130113 | 3300006051 | Bacteria | 1689 |
| 80 | Ga0070716_100034547 | 3300006173 | Bacteria | 2773 |
| 81 | Ga0070712_100005494 | 3300006175 | Bacteria | 7847 |
| 82 | Ga0075367_10005258 | 3300006178 | Bacteria | 6399 |
| 83 | Ga0075367_10078717 | 3300006178 | Bacteria | 1991 |
| 84 | Ga0075430_100035704 | 3300006846 | Bacteria | 4216 |
| 85 | Ga0075431_100005354 | 3300006847 | Bacteria | 12664 |
| 86 | Ga0075431_100258992 | 3300006847 | Bacteria | 1766 |
| 87 | Ga0075431_100485878 | 3300006847 | Bacteria | 1227 |
| 88 | Ga0075429_100035883 | 3300006880 | Bacteria | 4312 |
| 89 | Ga0099826_10049670 | 3300006948 | Bacteria | 2828 |
| 90 | Ga0105244_10006177 | 3300009036 | Bacteria | 7813 |
| 91 | Ga0105244_10054056 | 3300009036 | Bacteria | 2038 |
| 92 | Ga0105240_10011484 | 3300009093 | Bacteria | 12333 |
| 93 | Ga0114129_10000681 | 3300009147 | Bacteria | 42861 |
| 94 | Ga0105243_10009399 | 3300009148 | Bacteria | 7450 |
| 95 | Ga0105241_10003035 | 3300009174 | Bacteria | 12527 |
| 96 | Ga0105249_10264363 | 3300009553 | Bacteria | 1711 |
| 97 | Ga0105239_10014794 | 3300010375 | Bacteria | 8654 |
| 98 | Ga0105239_10131203 | 3300010375 | Bacteria | 2787 |
| 99 | Ga0105246_10043073 | 3300011119 | Bacteria | 3061 |
| 100 | Ga0105246_10531960 | 3300011119 | Bacteria | 1004 |
| 101 | Ga0105246_10602434 | 3300011119 | Bacteria | 950 |
| 102 | Ga0157370_10057608 | 3300013104 | Bacteria | 3693 |
| 103 | Ga0157369_10114233 | 3300013105 | Bacteria | 2868 |
| 104 | Ga0157369_10129576 | 3300013105 | Bacteria | 2674 |
| 105 | Ga0157369_10457542 | 3300013105 | Bacteria | 1321 |
| 106 | Ga0157374_10122188 | 3300013296 | Bacteria | 2514 |
| 107 | Ga0157372_10137066 | 3300013307 | Bacteria | 2819 |
| 108 | Ga0157372_10360691 | 3300013307 | Bacteria | 1693 |
| 109 | Ga0182008_10000552 | 3300014497 | Bacteria | 27794 |
| 110 | Ga0182008_10000777 | 3300014497 | Bacteria | 22348 |
| 111 | Ga0182007_10000554 | 3300015262 | Bacteria | 22069 |
| 112 | Ga0182007_10000661 | 3300015262 | Bacteria | 19773 |
| 113 | Ga0183367_1011 | 3300015688 | Bacteria | 397353 |
| 114 | Ga0183367_1016 | 3300015688 | Bacteria | 290198 |
| 115 | Ga0206356_10357540 | 3300020070 | Bacteria | 1423 |
| 116 | Ga0224712_10091684 | 3300022467 | Bacteria | 1274 |
| 117 | Ga0209129_1000180 | 3300025258 | Bacteria | 90882 |
| 118 | Ga0209025_1001362 | 3300025294 | Bacteria | 32778 |
| 119 | Ga0209051_1004857 | 3300025303 | Bacteria | 8079 |
| 120 | Ga0207697_10004439 | 3300025315 | Bacteria | 6702 |
| 121 | Ga0207692_10005516 | 3300025898 | Bacteria | 5075 |
| 122 | Ga0207692_10121735 | 3300025898 | Unclassified | 1462 |
| 123 | Ga0207647_10005581 | 3300025904 | Bacteria | 9201 |
| 124 | Ga0207647_10005686 | 3300025904 | Bacteria | 9103 |
| 125 | Ga0207647_10010531 | 3300025904 | Bacteria | 6527 |
| 126 | Ga0207647_10013528 | 3300025904 | Bacteria | 5651 |
| 127 | Ga0207647_10032455 | 3300025904 | Bacteria | 3354 |
| 128 | Ga0207647_10090575 | 3300025904 | Bacteria | 1824 |
| 129 | Ga0207647_10096689 | 3300025904 | Bacteria | 1757 |
| 130 | Ga0207699_10003554 | 3300025906 | Bacteria | 7436 |
| 131 | Ga0207699_10281098 | 3300025906 | Bacteria | 1156 |
| 132 | Ga0207705_10313041 | 3300025909 | Bacteria | 1205 |
| 133 | Ga0207654_10003921 | 3300025911 | Bacteria | 7491 |
| 134 | Ga0207707_10050349 | 3300025912 | Bacteria | 3629 |
| 135 | Ga0207695_10003004 | 3300025913 | Bacteria | 24248 |
| 136 | Ga0207671_10000488 | 3300025914 | Bacteria | 53807 |
| 137 | Ga0207693_10012884 | 3300025915 | Bacteria | 6748 |
| 138 | Ga0207693_10022336 | 3300025915 | Bacteria | 5028 |
| 139 | Ga0207693_10051422 | 3300025915 | Bacteria | 3233 |
| 140 | Ga0207663_10060410 | 3300025916 | Bacteria | 2402 |
| 141 | Ga0207663_10214767 | 3300025916 | Bacteria | 1396 |
| 142 | Ga0207660_10064154 | 3300025917 | Bacteria | 2650 |
| 143 | Ga0207657_10025688 | 3300025919 | Bacteria | 5425 |
| 144 | Ga0207657_10112922 | 3300025919 | Bacteria | 2242 |
| 145 | Ga0207646_10106023 | 3300025922 | Bacteria | 2521 |
| 146 | Ga0207694_10001572 | 3300025924 | Bacteria | 19329 |
| 147 | Ga0207700_10007329 | 3300025928 | Bacteria | 6735 |
| 148 | Ga0207700_10046153 | 3300025928 | Bacteria | 3220 |
| 149 | Ga0207700_10078808 | 3300025928 | Bacteria | 2564 |
| 150 | Ga0207700_10086278 | 3300025928 | Bacteria | 2466 |
| 151 | Ga0207700_10138432 | 3300025928 | Bacteria | 1997 |
| 152 | Ga0207664_10012624 | 3300025929 | Bacteria | 6044 |
| 153 | Ga0207664_10125027 | 3300025929 | Bacteria | 2158 |
| 154 | Ga0207664_10342427 | 3300025929 | Bacteria | 1322 |
| 155 | Ga0207664_10731517 | 3300025929 | Bacteria | 890 |
| 156 | Ga0207690_10098864 | 3300025932 | Bacteria | 2079 |
| 157 | Ga0207706_10051112 | 3300025933 | Bacteria | 3651 |
| 158 | Ga0207665_10045607 | 3300025939 | Bacteria | 2935 |
| 159 | Ga0207665_10135810 | 3300025939 | Bacteria | 1750 |
| 160 | Ga0207689_10180457 | 3300025942 | Bacteria | 1741 |
| 161 | Ga0207689_10621902 | 3300025942 | Bacteria | 909 |
| 162 | Ga0207661_10027634 | 3300025944 | Bacteria | 4336 |
| 163 | Ga0207661_10188297 | 3300025944 | Bacteria | 1808 |
| 164 | Ga0207661_10250823 | 3300025944 | Bacteria | 1573 |
| 165 | Ga0207667_10293489 | 3300025949 | Bacteria | 1661 |
| 166 | Ga0207640_10010341 | 3300025981 | Bacteria | 5254 |
| 167 | Ga0207640_10121888 | 3300025981 | Bacteria | 1870 |
| 168 | Ga0207640_10145475 | 3300025981 | Bacteria | 1734 |
| 169 | Ga0207677_10217350 | 3300026023 | Bacteria | 1530 |
| 170 | Ga0207639_10136666 | 3300026041 | Bacteria | 2037 |
| 171 | Ga0207639_10146051 | 3300026041 | Bacteria | 1976 |
| 172 | Ga0207639_10177159 | 3300026041 | Bacteria | 1811 |
| 173 | Ga0207678_10007418 | 3300026067 | Bacteria | 9711 |
| 174 | Ga0207678_10081725 | 3300026067 | Bacteria | 2766 |
| 175 | Ga0207678_10149752 | 3300026067 | Bacteria | 1992 |
| 176 | Ga0207678_10564727 | 3300026067 | Bacteria | 996 |
| 177 | Ga0207708_10107363 | 3300026075 | Bacteria | 2165 |
| 178 | Ga0207702_10266430 | 3300026078 | Bacteria | 1615 |
| 179 | Ga0207702_10525361 | 3300026078 | Bacteria | 1156 |
| 180 | Ga0207674_10037961 | 3300026116 | Bacteria | 5003 |
| 181 | Ga0207674_10298506 | 3300026116 | Bacteria | 1560 |
| 182 | Ga0207674_10479038 | 3300026116 | Bacteria | 1203 |
| 183 | Ga0207675_100702086 | 3300026118 | Bacteria | 1021 |
| 184 | Ga0207683_10054399 | 3300026121 | Bacteria | 3510 |
| 185 | Ga0207698_10028688 | 3300026142 | Bacteria | 3973 |
| 186 | Ga0207698_10152830 | 3300026142 | Bacteria | 2006 |
| 187 | Ga0207698_10632428 | 3300026142 | Bacteria | 1058 |
| 188 | Ga0209371_1021303 | 3300027312 | Bacteria | 1574 |
| 189 | Ga0209813_10120765 | 3300027866 | Bacteria | 912 |
| 190 | Ga0268266_10090348 | 3300028379 | Bacteria | 2684 |
| 191 | Ga0268266_10094709 | 3300028379 | Bacteria | 2622 |
| 192 | Ga0268266_10532855 | 3300028379 | Bacteria | 1124 |
| 193 | Ga0265337_1000230 | 3300028556 | Bacteria | 30116 |
| 194 | Ga0265326_10001838 | 3300028558 | Bacteria | 7291 |
| 195 | Ga0265319_1001673 | 3300028563 | Bacteria | 12805 |
| 196 | Ga0265334_10000178 | 3300028573 | Bacteria | 37532 |
| 197 | Ga0265334_10041226 | 3300028573 | Bacteria | 1805 |
| 198 | Ga0265322_10014316 | 3300028654 | Bacteria | 2292 |
| 199 | Ga0265336_10003119 | 3300028666 | Bacteria | 6590 |
| 200 | Ga0265336_10003740 | 3300028666 | Bacteria | 5890 |
| 201 | Ga0307517_10018152 | 3300028786 | Bacteria | 9117 |
| 202 | Ga0307515_10010304 | 3300028794 | Bacteria | 17938 |
| 203 | Ga0307515_10074461 | 3300028794 | Bacteria | 4542 |
| 204 | Ga0307515_10250021 | 3300028794 | Bacteria | 1527 |
| 205 | Ga0265338_10000683 | 3300028800 | Bacteria | 58337 |
| 206 | Ga0265338_10054900 | 3300028800 | Bacteria | 3548 |
| 207 | Ga0265324_10006327 | 3300029957 | Bacteria | 4962 |
| 208 | Ga0265324_10009973 | 3300029957 | Bacteria | 3688 |
| 209 | Ga0307511_10000672 | 3300030521 | Bacteria | 36429 |
| 210 | Ga0307512_10000801 | 3300030522 | Bacteria | 46484 |
| 211 | Ga0307512_10022842 | 3300030522 | Bacteria | 5605 |
| 212 | Ga0265332_10020655 | 3300031238 | Bacteria | 2907 |
| 213 | Ga0265332_10050673 | 3300031238 | Bacteria | 1784 |
| 214 | Ga0265320_10007740 | 3300031240 | Bacteria | 6640 |
| 215 | Ga0265325_10034084 | 3300031241 | Bacteria | 2712 |
| 216 | Ga0265340_10001938 | 3300031247 | Bacteria | 11824 |
| 217 | Ga0265340_10002640 | 3300031247 | Bacteria | 10187 |
| 218 | Ga0265339_10005353 | 3300031249 | Bacteria | 8546 |
| 219 | Ga0265339_10196402 | 3300031249 | Bacteria | 997 |
| 220 | Ga0265331_10014814 | 3300031250 | Bacteria | 4137 |
| 221 | Ga0265316_10015012 | 3300031344 | Bacteria | 6791 |
| 222 | Ga0307513_10001986 | 3300031456 | Bacteria | 28948 |
| 223 | Ga0307513_10010977 | 3300031456 | Bacteria | 11301 |
| 224 | Ga0307513_10031680 | 3300031456 | Bacteria | 5983 |
| 225 | Ga0307509_10006518 | 3300031507 | Bacteria | 15655 |
| 226 | Ga0307509_10011002 | 3300031507 | Bacteria | 11025 |
| 227 | Ga0307509_10024641 | 3300031507 | Bacteria | 6734 |
| 228 | Ga0307509_10035479 | 3300031507 | Bacteria | 5473 |
| 229 | Ga0307509_10138169 | 3300031507 | Bacteria | 2378 |
| 230 | Ga0265313_10004009 | 3300031595 | Bacteria | 11526 |
| 231 | Ga0307508_10004718 | 3300031616 | Bacteria | 13199 |
| 232 | Ga0307508_10013835 | 3300031616 | Bacteria | 7363 |
| 233 | Ga0307508_10030536 | 3300031616 | Bacteria | 4871 |
| 234 | Ga0307514_10005174 | 3300031649 | Bacteria | 11764 |
| 235 | Ga0307514_10008786 | 3300031649 | Bacteria | 8554 |
| 236 | Ga0307514_10101916 | 3300031649 | Bacteria | 2059 |
| 237 | Ga0307514_10164558 | 3300031649 | Bacteria | 1462 |
| 238 | Ga0265314_10010641 | 3300031711 | Bacteria | 7654 |
| 239 | Ga0265342_10001496 | 3300031712 | Bacteria | 21649 |
| 240 | Ga0265342_10049373 | 3300031712 | Bacteria | 2518 |
| 241 | Ga0307516_10000841 | 3300031730 | Bacteria | 42119 |
| 242 | Ga0307516_10059569 | 3300031730 | Bacteria | 3713 |
| 243 | Ga0307516_10402392 | 3300031730 | Bacteria | 1028 |
| 244 | Ga0307405_10049965 | 3300031731 | Bacteria | 2587 |
| 245 | Ga0307413_10023094 | 3300031824 | Bacteria | 3366 |
| 246 | Ga0307413_10113689 | 3300031824 | Bacteria | 1818 |
| 247 | Ga0307518_10092157 | 3300031838 | Bacteria | 2179 |
| 248 | Ga0307410_10295621 | 3300031852 | Bacteria | 1276 |
| 249 | Ga0307410_10545948 | 3300031852 | Bacteria | 960 |
| 250 | Ga0307410_10693820 | 3300031852 | Bacteria | 857 |
| 251 | Ga0307409_100237851 | 3300031995 | Bacteria | 1656 |
| 252 | Ga0307409_100247022 | 3300031995 | Bacteria | 1629 |
| 253 | Ga0307409_100302300 | 3300031995 | Bacteria | 1489 |
| 254 | Ga0307409_100532770 | 3300031995 | Bacteria | 1150 |
| 255 | Ga0307409_100770785 | 3300031995 | Bacteria | 967 |
| 256 | Ga0307416_100192175 | 3300032002 | Bacteria | 1927 |
| 257 | Ga0307415_100025726 | 3300032126 | Bacteria | 3700 |
| 258 | Ga0307415_100266671 | 3300032126 | Bacteria | 1400 |
| 259 | Ga0307507_10030151 | 3300033179 | Bacteria | 5726 |
| 260 | Ga0307507_10060126 | 3300033179 | Bacteria | 3550 |
| 261 | Ga0307507_10094661 | 3300033179 | Bacteria | 2537 |
| 262 | Ga0307507_10163834 | 3300033179 | Bacteria | 1635 |
| 263 | Ga0307510_10006065 | 3300033180 | Bacteria | 14405 |
| 264 | Ga0307510_10057502 | 3300033180 | Bacteria | 4036 |
| 265 | Ga0307510_10075977 | 3300033180 | Bacteria | 3307 |
| 266 | Ga0307510_10130210 | 3300033180 | Bacteria | 2192 |
| 267 | Ga0307510_10141332 | 3300033180 | Bacteria | 2050 |
| 268 | Ga0373934_0031420 | 3300035086 | Bacteria | 2079 |
| 269 | Ga0373944_0073491 | 3300035089 | Bacteria | 1118 |
| 270 | Ga0373936_0010500 | 3300035113 | Bacteria | 3495 |
| 271 | Ga0373954_0057351 | 3300035118 | Bacteria | 1834 |
| 272 | Ga0373957_0085254 | 3300035120 | Bacteria | 1250 |
| 273 | Ga0373955_0029602 | 3300035172 | Bacteria | 2849 |
| 274 | Ga0373924_0011618 | 3300035410 | Bacteria | 3274 |
| 275 | Ga0373935_0146614 | 3300035692 | Bacteria | 1598 |
| 276 | Ga0373933_0016144 | 3300035724 | Bacteria | 4172 |
| 277 | Ga0373925_0006443 | 3300037068 | Bacteria | 8639 |
| 278 | Ga0395900_0231452 | 3300037418 | Bacteria | 1858 |
| 279 | Ga0395898_0007719 | 3300037466 | Bacteria | 11421 |
| 280 | Ga0395898_0036977 | 3300037466 | Bacteria | 4845 |
| 281 | Ga0439436_0003837 | 3300041404 | Bacteria | 4602 |
| 282 | Ga0439436_0004109 | 3300041404 | Bacteria | 4461 |
| 283 | Ga0439436_0005195 | 3300041404 | Bacteria | 3991 |
| 284 | Ga0439436_0015754 | 3300041404 | Bacteria | 2271 |
| 285 | Ga0439438_071793 | 3300041405 | Bacteria | 856 |
| 286 | Ga0439439_0000121 | 3300041406 | Bacteria | 10896 |
| 287 | Ga0439439_0003420 | 3300041406 | Bacteria | 3500 |
| 288 | Ga0439439_0010864 | 3300041406 | Bacteria | 2183 |
| 289 | Ga0439439_0072405 | 3300041406 | Bacteria | 924 |
| 290 | Ga0451797_0640309 | 3300041453 | Bacteria | 1371 |
| 291 | Ga0451795_1034354 | 3300041456 | Bacteria | 3727 |
| 292 | Ga0451800_0421651 | 3300041459 | Bacteria | 2013 |
| 293 | Ga0451802_1768030 | 3300041460 | Bacteria | 1004 |
| 294 | Ga0451853_1223826 | 3300041512 | Bacteria | 2013 |
| 295 | Ga0451853_1833064 | 3300041512 | Bacteria | 2049 |
| 296 | Ga0439433_0003165 | 3300041999 | Bacteria | 3525 |
| 297 | Ga0439433_0007013 | 3300041999 | Bacteria | 2432 |
| 298 | Ga0439448_0011705 | 3300042005 | Bacteria | 2616 |
| 299 | Ga0439448_0017640 | 3300042005 | Bacteria | 2181 |
| 300 | Ga0439448_0090220 | 3300042005 | Bacteria | 1035 |
| 301 | Ga0439449_0007982 | 3300042007 | Bacteria | 4021 |
| 302 | Ga0439449_0012598 | 3300042007 | Bacteria | 3181 |
| 303 | Ga0439449_0015988 | 3300042007 | Bacteria | 2820 |
| 304 | Ga0439450_067692 | 3300042008 | Bacteria | 872 |
| 305 | Ga0439457_000111 | 3300042014 | Bacteria | 19558 |
| 306 | Ga0439457_000307 | 3300042014 | Bacteria | 13539 |
| 307 | Ga0439457_000998 | 3300042014 | Bacteria | 8532 |
| 308 | Ga0439462_0017760 | 3300042015 | Bacteria | 1843 |
| 309 | Ga0450890_006837 | 3300042127 | Bacteria | 1455 |
| 310 | Ga0450894_000148 | 3300042131 | Bacteria | 12360 |
| 311 | Ga0450894_000258 | 3300042131 | Bacteria | 9518 |
| 312 | Ga0450894_000894 | 3300042131 | Bacteria | 4749 |
| 313 | Ga0450895_006859 | 3300042132 | Bacteria | 937 |
| 314 | Ga0450896_000218 | 3300042133 | Bacteria | 5111 |
| 315 | Ga0450898_000150 | 3300042134 | Bacteria | 7018 |
| 316 | Ga0450898_000188 | 3300042134 | Bacteria | 6552 |
| 317 | Ga0450898_002540 | 3300042134 | Bacteria | 2555 |
| 318 | Ga0450899_000083 | 3300042135 | Bacteria | 7979 |
| 319 | Ga0450900_012551 | 3300042136 | Bacteria | 1112 |
| 320 | Ga0450903_000204 | 3300042138 | Bacteria | 13059 |
| 321 | Ga0450903_011561 | 3300042138 | Bacteria | 1420 |
| 322 | Ga0450906_000040 | 3300042145 | Bacteria | 21045 |
| 323 | Ga0450906_000331 | 3300042145 | Bacteria | 9635 |
| 324 | Ga0450906_000521 | 3300042145 | Bacteria | 8089 |
| 325 | Ga0439458_0000476 | 3300042157 | Bacteria | 10265 |
| 326 | Ga0439458_0003238 | 3300042157 | Bacteria | 3849 |
| 327 | Ga0439458_0009838 | 3300042157 | Bacteria | 2129 |
| 328 | Ga0450908_003549 | 3300042184 | Bacteria | 3039 |
| 329 | Ga0450908_010342 | 3300042184 | Bacteria | 1722 |
| 330 | Ga0439440_0016019 | 3300042993 | Bacteria | 1635 |
| 331 | Ga0466969_0002669 | 3300044656 | Bacteria | 9533 |
| 332 | Ga0466972_0000744 | 3300044658 | Bacteria | 15520 |
| 333 | Ga0466972_0036878 | 3300044658 | Bacteria | 2390 |
| 334 | Ga0466965_0001152 | 3300044683 | Bacteria | 10396 |
| 335 | Ga0466966_0006589 | 3300044684 | Bacteria | 7690 |
| 336 | Ga0466966_0011651 | 3300044684 | Bacteria | 5828 |
| 337 | Ga0466961_0001075 | 3300044693 | Bacteria | 16849 |
| 338 | Ga0466961_0009383 | 3300044693 | Bacteria | 6234 |
| 339 | Ga0466961_0527404 | 3300044693 | Bacteria | 712 |
| 340 | Ga0466963_0010946 | 3300044694 | Bacteria | 5512 |
| 341 | Ga0466963_0036954 | 3300044694 | Bacteria | 3187 |
| 342 | Ga0466963_0037174 | 3300044694 | Bacteria | 3178 |
| 343 | Ga0466963_0078485 | 3300044694 | Bacteria | 2232 |
| 344 | Ga0466963_0122264 | 3300044694 | Bacteria | 1792 |
| 345 | Ga0466964_0002075 | 3300044706 | Bacteria | 7048 |
| 346 | Ga0466964_0150537 | 3300044706 | Bacteria | 1078 |
| 347 | Ga0466971_0000151 | 3300044719 | Bacteria | 25764 |
| 348 | Ga0466971_0010618 | 3300044719 | Bacteria | 4026 |
| 349 | Ga0466971_0032982 | 3300044719 | Bacteria | 2320 |
| 350 | Ga0466971_0088403 | 3300044719 | Bacteria | 1417 |
| 351 | Ga0466968_0033531 | 3300044735 | Bacteria | 2140 |
| 352 | Ga0466970_0025639 | 3300044765 | Bacteria | 3088 |
| 353 | Ga0466970_0078037 | 3300044765 | Bacteria | 1786 |
| 354 | Ga0466957_0102866 | 3300044842 | Bacteria | 1802 |
| 355 | Ga0466960_0009435 | 3300044901 | Bacteria | 4022 |
| 356 | Ga0466960_0144681 | 3300044901 | Bacteria | 1265 |
| 357 | Ga0466959_0002709 | 3300045049 | Bacteria | 11383 |
| 358 | Ga0466959_0008239 | 3300045049 | Bacteria | 7357 |
| 359 | Ga0466959_0049610 | 3300045049 | Bacteria | 3084 |
| 360 | Ga0466959_0089831 | 3300045049 | Bacteria | 2207 |
| 361 | Ga0466959_0108116 | 3300045049 | Bacteria | 1987 |
| 362 | Ga0466958_0008107 | 3300045836 | Bacteria | 5812 |
| 363 | Ga0466958_0027439 | 3300045836 | Bacteria | 3370 |
| 364 | Ga0466958_0058276 | 3300045836 | Bacteria | 2348 |
| 365 | Ga0466967_0002421 | 3300045976 | Bacteria | 11598 |
| 366 | Ga0466967_0041393 | 3300045976 | Bacteria | 3972 |
| 367 | Ga0466967_0063721 | 3300045976 | Bacteria | 3276 |
| 368 | Ga0466967_0087334 | 3300045976 | Bacteria | 2827 |
| 369 | Ga0466967_0255378 | 3300045976 | Bacteria | 1675 |
| 370 | Ga0466967_0621733 | 3300045976 | Bacteria | 1067 |
| 371 | Ga0495627_026909 | 3300046453 | Bacteria | 1850 |
| 372 | Ga0495592_0011446 | 3300046454 | Bacteria | 6712 |
| 373 | Ga0495592_0012776 | 3300046454 | Bacteria | 6383 |
| 374 | Ga0495592_0130734 | 3300046454 | Bacteria | 1756 |
| 375 | Ga0495603_0012311 | 3300046455 | Bacteria | 5177 |
| 376 | Ga0495629_0014036 | 3300046459 | Bacteria | 5772 |
| 377 | Ga0495629_0015196 | 3300046459 | Bacteria | 5531 |
| 378 | Ga0495629_0025807 | 3300046459 | Bacteria | 4175 |
| 379 | Ga0495629_0131760 | 3300046459 | Bacteria | 1741 |
| 380 | Ga0495629_0371008 | 3300046459 | Bacteria | 975 |
| 381 | Ga0495638_0075194 | 3300046460 | Bacteria | 2059 |
| 382 | Ga0495651_0001705 | 3300046462 | Bacteria | 16969 |
| 383 | Ga0495651_0002959 | 3300046462 | Bacteria | 13126 |
| 384 | Ga0495651_0004042 | 3300046462 | Bacteria | 11214 |
| 385 | Ga0495653_0021618 | 3300046463 | Bacteria | 5211 |
| 386 | Ga0495650_0028062 | 3300046471 | Bacteria | 2591 |
| 387 | Ga0495650_0028239 | 3300046471 | Bacteria | 2580 |
| 388 | Ga0495650_0107007 | 3300046471 | Bacteria | 1043 |
| 389 | Ga0495580_0046716 | 3300046472 | Bacteria | 3071 |
| 390 | Ga0495580_0182859 | 3300046472 | Bacteria | 1447 |
| 391 | Ga0495582_0057870 | 3300046473 | Bacteria | 2137 |
| 392 | Ga0495605_0120762 | 3300046474 | Bacteria | 1188 |
| 393 | Ga0495639_0126083 | 3300046475 | Bacteria | 1224 |
| 394 | Ga0495639_0136025 | 3300046475 | Bacteria | 1179 |
| 395 | Ga0495662_0000534 | 3300046476 | Bacteria | 17425 |
| 396 | Ga0495662_0011551 | 3300046476 | Bacteria | 4316 |
| 397 | Ga0495662_0090320 | 3300046476 | Bacteria | 1493 |
| 398 | Ga0495662_0092381 | 3300046476 | Bacteria | 1476 |
| 399 | Ga0495664_0000617 | 3300046477 | Bacteria | 18040 |
| 400 | Ga0495664_0003610 | 3300046477 | Bacteria | 8435 |
| 401 | Ga0495664_0159761 | 3300046477 | Bacteria | 1367 |
| 402 | Ga0495585_0022960 | 3300046492 | Bacteria | 3580 |
| 403 | Ga0495585_0153112 | 3300046492 | Bacteria | 1201 |
| 404 | Ga0495594_0008240 | 3300046499 | Bacteria | 5363 |
| 405 | Ga0495594_0034337 | 3300046499 | Bacteria | 2759 |
| 406 | Ga0495594_0062842 | 3300046499 | Bacteria | 2056 |
| 407 | Ga0495596_0014822 | 3300046500 | Bacteria | 3279 |
| 408 | Ga0495596_0035274 | 3300046500 | Bacteria | 1984 |
| 409 | Ga0495583_0006789 | 3300046506 | Bacteria | 7397 |
| 410 | Ga0495583_0064824 | 3300046506 | Bacteria | 1619 |
| 411 | Ga0495583_0072513 | 3300046506 | Bacteria | 1511 |
| 412 | Ga0495606_0007389 | 3300046507 | Bacteria | 9853 |
| 413 | Ga0495608_0036891 | 3300046511 | Bacteria | 3288 |
| 414 | Ga0495608_0211865 | 3300046511 | Bacteria | 1218 |
| 415 | Ga0495610_0059901 | 3300046512 | Bacteria | 1815 |
| 416 | Ga0495616_0018556 | 3300046513 | Bacteria | 3816 |
| 417 | Ga0495618_0218426 | 3300046514 | Bacteria | 1203 |
| 418 | Ga0495620_0010158 | 3300046515 | Bacteria | 4973 |
| 419 | Ga0495628_0004349 | 3300046516 | Bacteria | 12569 |
| 420 | Ga0495628_0036786 | 3300046516 | Bacteria | 3926 |
| 421 | Ga0495628_0071763 | 3300046516 | Bacteria | 2698 |
| 422 | Ga0495628_0100719 | 3300046516 | Bacteria | 2230 |
| 423 | Ga0495628_0220511 | 3300046516 | Bacteria | 1424 |
| 424 | Ga0495630_0169651 | 3300046517 | Bacteria | 1662 |
| 425 | Ga0495630_0400598 | 3300046517 | Bacteria | 1051 |
| 426 | Ga0495630_0413688 | 3300046517 | Bacteria | 1033 |
| 427 | Ga0495631_0003534 | 3300046518 | Bacteria | 8542 |
| 428 | Ga0495637_0019780 | 3300046520 | Bacteria | 3108 |
| 429 | Ga0495643_0005450 | 3300046522 | Bacteria | 8605 |
| 430 | Ga0495643_0010819 | 3300046522 | Bacteria | 5593 |
| 431 | Ga0495648_0037742 | 3300046524 | Bacteria | 3100 |
| 432 | Ga0495648_0070367 | 3300046524 | Bacteria | 2033 |
| 433 | Ga0495652_0001214 | 3300046529 | Bacteria | 28869 |
| 434 | Ga0495652_0004196 | 3300046529 | Bacteria | 13871 |
| 435 | Ga0495652_0031801 | 3300046529 | Bacteria | 4619 |
| 436 | Ga0495654_0162063 | 3300046530 | Bacteria | 981 |
| 437 | Ga0495665_0199212 | 3300046531 | Bacteria | 1038 |
| 438 | Ga0495640_0014013 | 3300046533 | Bacteria | 6084 |
| 439 | Ga0495640_0040118 | 3300046533 | Bacteria | 3279 |
| 440 | Ga0495586_0020844 | 3300046535 | Bacteria | 3492 |
| 441 | Ga0495586_0039468 | 3300046535 | Bacteria | 2538 |
| 442 | Ga0495586_0067886 | 3300046535 | Bacteria | 1945 |
| 443 | Ga0495587_0003123 | 3300046536 | Bacteria | 11081 |
| 444 | Ga0495587_0037947 | 3300046536 | Bacteria | 2891 |
| 445 | Ga0495587_0067962 | 3300046536 | Bacteria | 2076 |
| 446 | Ga0495609_0006276 | 3300046538 | Bacteria | 6090 |
| 447 | Ga0495597_0114070 | 3300046542 | Bacteria | 1131 |
| 448 | Ga0495645_0005263 | 3300046543 | Bacteria | 8862 |
| 449 | Ga0495645_0027092 | 3300046543 | Bacteria | 4162 |
| 450 | Ga0495645_0035747 | 3300046543 | Bacteria | 3621 |
| 451 | Ga0495633_0019430 | 3300046558 | Bacteria | 3436 |
| 452 | Ga0495656_0042467 | 3300046615 | Bacteria | 1904 |
| 453 | Ga0495668_0047568 | 3300046616 | Bacteria | 2381 |
| 454 | Ga0495668_0064320 | 3300046616 | Bacteria | 2019 |
| 455 | Ga0495634_0005064 | 3300046642 | Bacteria | 10178 |
| 456 | Ga0495634_0015110 | 3300046642 | Bacteria | 5548 |
| 457 | Ga0495634_0095421 | 3300046642 | Bacteria | 1926 |
| 458 | Ga0495611_0040066 | 3300046648 | Bacteria | 2087 |
| 459 | Ga0495611_0108677 | 3300046648 | Bacteria | 1290 |
| 460 | Ga0495625_0022762 | 3300046660 | Bacteria | 4796 |
| 461 | Ga0495625_0050603 | 3300046660 | Bacteria | 2981 |
| 462 | Ga0495625_0221413 | 3300046660 | Bacteria | 1240 |
| 463 | Ga0495635_0001004 | 3300046663 | Bacteria | 18654 |
| 464 | Ga0495635_0006399 | 3300046663 | Bacteria | 8207 |
| 465 | Ga0495635_0008784 | 3300046663 | Bacteria | 7054 |
| 466 | Ga0495635_0122104 | 3300046663 | Bacteria | 1776 |
| 467 | Ga0495661_0015013 | 3300046665 | Bacteria | 5176 |
| 468 | Ga0495588_0005143 | 3300046674 | Bacteria | 5811 |
| 469 | Ga0495588_0007950 | 3300046674 | Bacteria | 4848 |
| 470 | Ga0495657_0007012 | 3300046675 | Bacteria | 8742 |
| 471 | Ga0495657_0007655 | 3300046675 | Bacteria | 8315 |
| 472 | Ga0495657_0046225 | 3300046675 | Bacteria | 2949 |
| 473 | Ga0495657_0056586 | 3300046675 | Bacteria | 2610 |
| 474 | Ga0495599_0263107 | 3300046678 | Bacteria | 1047 |
| 475 | Ga0495623_0038419 | 3300046679 | Unclassified | 3061 |
| 476 | Ga0495623_0140009 | 3300046679 | Bacteria | 1440 |
| 477 | Ga0495646_0027436 | 3300046680 | Bacteria | 3573 |
| 478 | Ga0495646_0057201 | 3300046680 | Bacteria | 2335 |
| 479 | Ga0495646_0126822 | 3300046680 | Bacteria | 1439 |
| 480 | Ga0495647_0034238 | 3300046681 | Bacteria | 1902 |
| 481 | Ga0495658_0008782 | 3300046683 | Bacteria | 5021 |
| 482 | Ga0495658_0009802 | 3300046683 | Bacteria | 4776 |
| 483 | Ga0495658_0025901 | 3300046683 | Bacteria | 3139 |
| 484 | Ga0495613_0017227 | 3300046689 | Bacteria | 5382 |
| 485 | Ga0495613_0017594 | 3300046689 | Bacteria | 5322 |
| 486 | Ga0495613_0039155 | 3300046689 | Bacteria | 3514 |
| 487 | Ga0495613_0097823 | 3300046689 | Bacteria | 2120 |
| 488 | Ga0495671_0027920 | 3300046692 | Bacteria | 2910 |
| 489 | Ga0495589_0017853 | 3300046794 | Bacteria | 3639 |
| 490 | Ga0495589_0056999 | 3300046794 | Bacteria | 1922 |
| 491 | Ga0495589_0174134 | 3300046794 | Bacteria | 1022 |
| 492 | Ga0495600_0017891 | 3300046809 | Bacteria | 4510 |
| 493 | Ga0495660_0102664 | 3300046810 | Bacteria | 1469 |
| 494 | Ga0495581_0021486 | 3300047315 | Bacteria | 3740 |
| 495 | Ga0495581_0038159 | 3300047315 | Bacteria | 2780 |
| 496 | Ga0495581_0063538 | 3300047315 | Bacteria | 2133 |
| 497 | Ga0495581_0075144 | 3300047315 | Bacteria | 1955 |
| 498 | Ga0495604_0003200 | 3300047317 | Bacteria | 13084 |
| 499 | Ga0495604_0004760 | 3300047317 | Bacteria | 10752 |
| 500 | Ga0495604_0045322 | 3300047317 | Bacteria | 3432 |
| 501 | Ga0495604_0066312 | 3300047317 | Bacteria | 2746 |
| 502 | Ga0495604_0239144 | 3300047317 | Bacteria | 1242 |
| 503 | Ga0495636_0018692 | 3300047318 | Bacteria | 2781 |
| 504 | Ga0495636_0024149 | 3300047318 | Bacteria | 2463 |
| 505 | Ga0495636_0072794 | 3300047318 | Bacteria | 1469 |
| 506 | Ga0495674_0069192 | 3300047319 | Bacteria | 3053 |
| 507 | Ga0495674_0334491 | 3300047319 | Bacteria | 1231 |
| 508 | Ga0495674_0518661 | 3300047319 | Bacteria | 952 |
| 509 | Ga0495676_0012001 | 3300047321 | Bacteria | 7815 |
| 510 | Ga0495676_0017146 | 3300047321 | Bacteria | 6408 |
| 511 | Ga0495676_0021121 | 3300047321 | Bacteria | 5697 |
| 512 | Ga0495676_0072134 | 3300047321 | Bacteria | 2652 |
| 513 | Ga0495676_0084970 | 3300047321 | Bacteria | 2385 |
| 514 | Ga0495680_0010905 | 3300047322 | Bacteria | 8076 |
| 515 | Ga0495680_0158276 | 3300047322 | Bacteria | 1646 |
| 516 | Ga0495683_0042719 | 3300047323 | Bacteria | 2285 |
| 517 | Ga0495687_001648 | 3300047443 | Bacteria | 20081 |
| 518 | Ga0495687_005720 | 3300047443 | Bacteria | 7830 |
| 519 | Ga0495687_012644 | 3300047443 | Bacteria | 4449 |
| 520 | Ga0495687_061924 | 3300047443 | Bacteria | 1537 |
| 521 | Ga0495687_068479 | 3300047443 | Bacteria | 1433 |
| 522 | Ga0495687_082509 | 3300047443 | Bacteria | 1254 |
| 523 | Ga0495687_127269 | 3300047443 | Bacteria | 908 |
| 524 | Ga0495685_004021 | 3300047447 | Bacteria | 4728 |
| 525 | Ga0495685_042950 | 3300047447 | Bacteria | 1542 |
| 526 | Ga0495681_0001693 | 3300047470 | Bacteria | 16334 |
| 527 | Ga0495681_0003555 | 3300047470 | Bacteria | 10848 |
| 528 | Ga0495681_0018274 | 3300047470 | Bacteria | 3866 |
| 529 | Ga0495684_0172801 | 3300047471 | Bacteria | 1606 |
| 530 | Ga0495686_0126084 | 3300047472 | Bacteria | 1522 |
| 531 | Ga0495593_0003639 | 3300047673 | Bacteria | 9204 |
| 532 | Ga0495593_0005185 | 3300047673 | Bacteria | 7702 |
| 533 | Ga0495602_0044426 | 3300048088 | Bacteria | 4030 |
| 534 | Ga0495602_0048087 | 3300048088 | Bacteria | 3838 |
| 535 | Ga0495602_0112008 | 3300048088 | Bacteria | 2215 |
| 536 | Ga0495614_0000841 | 3300048089 | Bacteria | 12989 |
| 537 | Ga0495614_0124692 | 3300048089 | Bacteria | 1137 |
| 538 | Ga0495626_0031029 | 3300048091 | Bacteria | 2575 |
| 539 | Ga0496100_0320045 | 3300048903 | Bacteria | 1165 |
| 540 | Ga0496101_0203665 | 3300048904 | Bacteria | 1530 |
| 541 | Ga0496103_0048374 | 3300048906 | Bacteria | 2628 |
| 542 | Ga0496104_0001344 | 3300048907 | Bacteria | 21277 |
| 543 | Ga0496105_0015905 | 3300048908 | Bacteria | 6001 |
| 544 | Ga0496105_0104975 | 3300048908 | Bacteria | 2332 |
| 545 | Ga0496108_0003880 | 3300048911 | Bacteria | 12006 |
| 546 | Ga0496108_0276214 | 3300048911 | Bacteria | 1463 |
| 547 | Ga0496109_0009141 | 3300048912 | Bacteria | 8437 |
| 548 | Ga0496110_0077753 | 3300048913 | Bacteria | 2952 |
| 549 | Ga0496111_0000184 | 3300048914 | Bacteria | 28609 |
| 550 | Ga0496111_0646386 | 3300048914 | Bacteria | 772 |
| 551 | Ga0496112_0789927 | 3300048915 | Bacteria | 874 |
| 552 | Ga0496113_0383910 | 3300048916 | Bacteria | 1127 |
| 553 | Ga0496114_0045997 | 3300048917 | Bacteria | 3626 |
| 554 | Ga0496114_0087355 | 3300048917 | Bacteria | 2644 |
| 555 | Ga0496114_0204771 | 3300048917 | Bacteria | 1729 |
| 556 | Ga0496114_0240856 | 3300048917 | Bacteria | 1591 |
| 557 | Ga0496114_0468784 | 3300048917 | Bacteria | 1114 |
| 558 | Ga0496115_0058151 | 3300048918 | Bacteria | 3111 |
| 559 | Ga0496115_0106671 | 3300048918 | Bacteria | 2300 |
| 560 | Ga0496126_0040528 | 3300048929 | Bacteria | 4317 |
| 561 | Ga0496126_0052562 | 3300048929 | Bacteria | 3701 |
| 562 | Ga0496126_0189384 | 3300048929 | Bacteria | 1743 |
| 563 | Ga0495678_040733 | 3300049459 | Bacteria | 1864 |
| 564 | Ga0501031_0026720 | 3300049568 | Bacteria | 3763 |
| 565 | Ga0501032_0159857 | 3300049569 | Bacteria | 1479 |
| 566 | Ga0501033_0016410 | 3300049570 | Bacteria | 5609 |
| 567 | Ga0501033_0124749 | 3300049570 | Bacteria | 1867 |
| 568 | Ga0501038_0004886 | 3300049574 | Bacteria | 12455 |
| 569 | Ga0501038_0056791 | 3300049574 | Bacteria | 3362 |
| 570 | Ga0501039_0012962 | 3300049575 | Bacteria | 6374 |
| 571 | Ga0501039_0038797 | 3300049575 | Bacteria | 3678 |
| 572 | Ga0501040_0022715 | 3300049576 | Bacteria | 4202 |
| 573 | Ga0501040_0129682 | 3300049576 | Bacteria | 1772 |
| 574 | Ga0501041_0027512 | 3300049577 | Bacteria | 3427 |
| 575 | Ga0501042_0025091 | 3300049578 | Bacteria | 4185 |
| 576 | Ga0501043_0234243 | 3300049579 | Bacteria | 1417 |
| 577 | Ga0501046_0115301 | 3300049580 | Bacteria | 2049 |
| 578 | Ga0501048_0027173 | 3300049582 | Bacteria | 4161 |
| 579 | Ga0501048_0203577 | 3300049582 | Bacteria | 1403 |
| 580 | Ga0501069_0234904 | 3300049585 | Bacteria | 1068 |
| 581 | Ga0501070_0334905 | 3300049586 | Bacteria | 1230 |
| 582 | Ga0501070_0642175 | 3300049586 | Bacteria | 843 |
| 583 | Ga0501071_0106982 | 3300049587 | Bacteria | 2065 |
| 584 | Ga0501071_0107270 | 3300049587 | Bacteria | 2062 |
| 585 | Ga0501071_0528061 | 3300049587 | Bacteria | 906 |
| 586 | Ga0501072_0016239 | 3300049588 | Bacteria | 5711 |
| 587 | Ga0501076_0052533 | 3300049592 | Bacteria | 3228 |
| 588 | Ga0501079_0153950 | 3300049741 | Bacteria | 1792 |
| 589 | Ga0501079_0273516 | 3300049741 | Bacteria | 1320 |
| 590 | Ga0501081_0105440 | 3300049743 | Bacteria | 1997 |
| 591 | Ga0501035_0789158 | 3300049822 | Bacteria | 759 |
| 592 | Ga0501044_0129950 | 3300049823 | Bacteria | 2513 |
| 593 | Ga0501045_0150440 | 3300049824 | Bacteria | 1732 |
| 594 | nmdc:mga03n38_113996_c1 | 3300050490 | Bacteria | 1320 |
| 595 | nmdc:mga03n38_59632_c1 | 3300050490 | Bacteria | 1732 |
| 596 | nmdc:mga0yw44_9998_c1 | 3300050492 | Bacteria | 4826 |
| 597 | nmdc:mga06z11_3522_c1 | 3300050494 | Bacteria | 6065 |
| 598 | nmdc:mga06z11_79061_c1 | 3300050494 | Bacteria | 1760 |
| 599 | nmdc:mga04h51_141831_c1 | 3300050495 | Bacteria | 912 |
| 600 | nmdc:mga05p37_190442_c1 | 3300050507 | Bacteria | 2491 |
| 601 | nmdc:mga0qj67_177337_c1 | 3300050509 | Bacteria | 1731 |
| 602 | nmdc:mga06r32_517459_c1 | 3300050510 | Bacteria | 1169 |
| 603 | nmdc:mga08y16_481470_c1 | 3300050511 | Bacteria | 1263 |
| 604 | Ga0495601_0046889 | 3300053077 | Bacteria | 2720 |
| 605 | Ga0495601_0080219 | 3300053077 | Bacteria | 2093 |
| 606 | Ga0495601_0257853 | 3300053077 | Bacteria | 1138 |
| 607 | Ga0495612_0030361 | 3300053078 | Bacteria | 2176 |
| 608 | Ga0495612_0052942 | 3300053078 | Bacteria | 1671 |
| 609 | Ga0500635_0000006 | 3300053080 | Bacteria | 187108 |
| 610 | Ga0495655_0009402 | 3300053083 | Bacteria | 1894 |
| 611 | Ga0495655_0043695 | 3300053083 | Bacteria | 1156 |
| 612 | Ga0495619_0236981 | 3300053085 | Bacteria | 1264 |
| 613 | Ga0495619_0254160 | 3300053085 | Bacteria | 1218 |
| 614 | Ga0495619_0347717 | 3300053085 | Bacteria | 1026 |
| 615 | Ga0500578_0028597 | 3300053086 | Bacteria | 3580 |
| 616 | Ga0500578_0095711 | 3300053086 | Bacteria | 1883 |
| 617 | Ga0500583_0077922 | 3300053092 | Bacteria | 1597 |
| 618 | Ga0500640_001432 | 3300053095 | Bacteria | 7238 |
| 619 | Ga0500640_090474 | 3300053095 | Bacteria | 1282 |
| 620 | Ga0500654_093215 | 3300053099 | Bacteria | 1328 |
| 621 | Ga0500660_090749 | 3300053100 | Bacteria | 1366 |
| 622 | Ga0500553_082981 | 3300053101 | Bacteria | 1435 |
| 623 | Ga0500553_099182 | 3300053101 | Bacteria | 1258 |
| 624 | Ga0500553_101657 | 3300053101 | Bacteria | 1235 |
| 625 | Ga0500560_005769 | 3300053107 | Bacteria | 2771 |
| 626 | Ga0500560_108310 | 3300053107 | Bacteria | 931 |
| 627 | Ga0500569_001328 | 3300053109 | Bacteria | 4631 |
| 628 | Ga0500580_047549 | 3300053113 | Bacteria | 1810 |
| 629 | Ga0500621_091258 | 3300053126 | Bacteria | 1211 |
| 630 | Ga0500628_000785 | 3300053129 | Bacteria | 5659 |
| 631 | Ga0500652_012391 | 3300053131 | Bacteria | 2989 |
| 632 | Ga0500658_0011811 | 3300053134 | Bacteria | 3219 |
| 633 | Ga0500561_0009872 | 3300053137 | Bacteria | 1952 |
| 634 | Ga0500573_0017609 | 3300053140 | Bacteria | 4069 |
| 635 | Ga0500573_0069670 | 3300053140 | Bacteria | 2007 |
| 636 | Ga0500579_029352 | 3300053143 | Bacteria | 3536 |
| 637 | Ga0500600_0027671 | 3300053149 | Bacteria | 3358 |
| 638 | Ga0500616_0004587 | 3300053153 | Bacteria | 9771 |
| 639 | Ga0500616_0011605 | 3300053153 | Bacteria | 5192 |
| 640 | Ga0500633_0026027 | 3300053160 | Bacteria | 1836 |
| 641 | Ga0500634_0041823 | 3300053161 | Bacteria | 2487 |
| 642 | Ga0500587_001195 | 3300053739 | Bacteria | 3598 |
| 643 | Ga0466962_0000203 | 3300061719 | Bacteria | 24833 |
| 644 | Ga0466962_0009988 | 3300061719 | Bacteria | 4554 |
| 645 | Ga0466962_0013923 | 3300061719 | Bacteria | 3873 |
| 646 | Ga0530510_0049948 | 3300061734 | Bacteria | 3021 |
| 647 | Ga0530510_0145979 | 3300061734 | Bacteria | 1745 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025944 | Ga0207661_10188297 | Ga0207661_101882972 | 213 |
| 2 | 3300031995 | Ga0307409_100770785 | Ga0307409_1007707851 | 214 |
| 3 | 3300041460 | Ga0451802_1768030 | Ga0451802_1768030_176_832 | 216 |
| 4 | 3300044693 | Ga0466961_0527404 | Ga0466961_0527404_28_681 | 217 |
| 5 | 3300048904 | Ga0496101_0203665 | Ga0496101_0203665_19_672 | 217 |
| 6 | 3300031456 | Ga0307513_10031680 | Ga0307513_100316804 | 218 |
| 7 | 3300041453 | Ga0451797_0640309 | Ga0451797_0640309_680_1339 | 219 |
| 8 | 3300046516 | Ga0495628_0004349 | Ga0495628_0004349_19_681 | 219 |
| 9 | 3300048914 | Ga0496111_0646386 | Ga0496111_0646386_25_684 | 219 |
| 10 | 3300032126 | Ga0307415_100266671 | Ga0307415_1002666712 | 220 |
| 11 | 3300049569 | Ga0501032_0159857 | Ga0501032_0159857_666_1445 | 220 |
| 12 | 3300010375 | Ga0105239_10131203 | Ga0105239_101312032 | 221 |
| 13 | 3300033179 | Ga0307507_10163834 | Ga0307507_101638342 | 222 |
| 14 | 3300005577 | Ga0068857_100627876 | Ga0068857_1006278762 | 223 |
| 15 | 3300025932 | Ga0207690_10098864 | Ga0207690_100988643 | 223 |
| 16 | 3300026075 | Ga0207708_10107363 | Ga0207708_101073632 | 223 |
| 17 | 3300026116 | Ga0207674_10298506 | Ga0207674_102985062 | 223 |
| 18 | 3300046511 | Ga0495608_0211865 | Ga0495608_0211865_26_697 | 223 |
| 19 | 3300005437 | Ga0070710_10004386 | Ga0070710_100043864 | 224 |
| 20 | 3300025898 | Ga0207692_10005516 | Ga0207692_100055163 | 224 |
| 21 | 3300044765 | Ga0466970_0078037 | Ga0466970_0078037_899_1708 | 224 |
| 22 | 3300045049 | Ga0466959_0089831 | Ga0466959_0089831_505_1314 | 224 |
| 23 | 3300053085 | Ga0495619_0347717 | Ga0495619_0347717_53_730 | 225 |
| 24 | 3300005616 | Ga0068852_100197985 | Ga0068852_1001979853 | 226 |
| 25 | 3300025919 | Ga0207657_10112922 | Ga0207657_101129222 | 226 |
| 26 | 3300025981 | Ga0207640_10145475 | Ga0207640_101454752 | 226 |
| 27 | 3300026142 | Ga0207698_10632428 | Ga0207698_106324282 | 226 |
| 28 | 3300049570 | Ga0501033_0124749 | Ga0501033_0124749_337_1101 | 226 |
| 29 | 3300042005 | Ga0439448_0011705 | Ga0439448_0011705_632_1321 | 228 |
| 30 | 3300042993 | Ga0439440_0016019 | Ga0439440_0016019_146_904 | 228 |
| 31 | 3300050511 | nmdc:mga08y16_481470_c1 | nmdc:mga08y16_481470_c1_108_866 | 228 |
| 32 | 3300037068 | Ga0373925_0006443 | Ga0373925_0006443_7811_8572 | 230 |
| 33 | 3300045049 | Ga0466959_0049610 | Ga0466959_0049610_2099_2854 | 230 |
| 34 | 3300031995 | Ga0307409_100237851 | Ga0307409_1002378512 | 233 |
| 35 | 3300042138 | Ga0450903_011561 | Ga0450903_011561_676_1377 | 233 |
| 36 | 3300049568 | Ga0501031_0026720 | Ga0501031_0026720_1018_1719 | 233 |
| 37 | 3300049575 | Ga0501039_0012962 | Ga0501039_0012962_5369_6070 | 233 |
| 38 | 3300049576 | Ga0501040_0129682 | Ga0501040_0129682_221_922 | 233 |
| 39 | 3300049582 | Ga0501048_0203577 | Ga0501048_0203577_641_1342 | 233 |
| 40 | 3300049587 | Ga0501071_0106982 | Ga0501071_0106982_343_1044 | 233 |
| 41 | 3300049741 | Ga0501079_0273516 | Ga0501079_0273516_257_958 | 233 |
| 42 | 3300049743 | Ga0501081_0105440 | Ga0501081_0105440_696_1397 | 233 |
| 43 | 3300049822 | Ga0501035_0789158 | Ga0501035_0789158_21_722 | 233 |
| 44 | 3300049824 | Ga0501045_0150440 | Ga0501045_0150440_80_781 | 233 |
| 45 | 3300061734 | Ga0530510_0145979 | Ga0530510_0145979_675_1376 | 233 |
| 46 | 3300005937 | Ga0081455_10001079 | Ga0081455_100010792 | 234 |
| 47 | 3300014497 | Ga0182008_10000777 | Ga0182008_100007778 | 234 |
| 48 | 3300015262 | Ga0182007_10000661 | Ga0182007_100006617 | 234 |
| 49 | 3300005329 | Ga0070683_100115720 | Ga0070683_1001157202 | 235 |
| 50 | 3300005535 | Ga0070684_100065285 | Ga0070684_1000652855 | 235 |
| 51 | 3300025944 | Ga0207661_10027634 | Ga0207661_100276345 | 235 |
| 52 | 3300025944 | Ga0207661_10250823 | Ga0207661_102508233 | 235 |
| 53 | 3300005337 | Ga0070682_100268051 | Ga0070682_1002680512 | 237 |
| 54 | 3300026067 | Ga0207678_10564727 | Ga0207678_105647272 | 237 |
| 55 | 3300044901 | Ga0466960_0144681 | Ga0466960_0144681_511_1224 | 237 |
| 56 | 3300048929 | Ga0496126_0189384 | Ga0496126_0189384_94_873 | 237 |
| 57 | 3300042005 | Ga0439448_0017640 | Ga0439448_0017640_886_1659 | 238 |
| 58 | 3300005329 | Ga0070683_100846362 | Ga0070683_1008463621 | 239 |
| 59 | 3300025933 | Ga0207706_10051112 | Ga0207706_100511125 | 239 |
| 60 | 3300031852 | Ga0307410_10693820 | Ga0307410_106938201 | 239 |
| 61 | 3300046500 | Ga0495596_0035274 | Ga0495596_0035274_958_1677 | 239 |
| 62 | 3300046462 | Ga0495651_0002959 | Ga0495651_0002959_8995_9762 | 240 |
| 63 | 3300046529 | Ga0495652_0004196 | Ga0495652_0004196_4526_5293 | 240 |
| 64 | 3300046543 | Ga0495645_0035747 | Ga0495645_0035747_1458_2225 | 240 |
| 65 | 3300047317 | Ga0495604_0045322 | Ga0495604_0045322_2636_3403 | 240 |
| 66 | iso_pu_bacteria | 2884693830 | 2884702668 | 240 |
| 67 | iso_pu_bacteria | 2895427314 | 2895429477 | 240 |
| 68 | iso_pu_bacteria | 2895442618 | 2895452168 | 240 |
| 69 | 3300028794 | Ga0307515_10074461 | Ga0307515_100744614 | 241 |
| 70 | 3300045976 | Ga0466967_0621733 | Ga0466967_0621733_173_898 | 241 |
| 71 | 3300003316 | rootH1_10005650 | rootH1_100056502 | 242 |
| 72 | iso_pu_bacteria | 8003314358 | 8003322633 | 242 |
| 73 | 3300026023 | Ga0207677_10217350 | Ga0207677_102173502 | 243 |
| 74 | 3300035089 | Ga0373944_0073491 | Ga0373944_0073491_314_1045 | 243 |
| 75 | 3300046472 | Ga0495580_0046716 | Ga0495580_0046716_26_760 | 243 |
| 76 | 3300046475 | Ga0495639_0126083 | Ga0495639_0126083_319_1053 | 243 |
| 77 | 3300047321 | Ga0495676_0072134 | Ga0495676_0072134_1379_2113 | 243 |
| 78 | 3300005329 | Ga0070683_100370914 | Ga0070683_1003709142 | 244 |
| 79 | 3300005336 | Ga0070680_100018278 | Ga0070680_1000182782 | 244 |
| 80 | 3300005336 | Ga0070680_100065815 | Ga0070680_1000658153 | 244 |
| 81 | 3300005337 | Ga0070682_100051982 | Ga0070682_1000519822 | 244 |
| 82 | 3300005339 | Ga0070660_100044202 | Ga0070660_1000442023 | 244 |
| 83 | 3300005434 | Ga0070709_10012890 | Ga0070709_100128904 | 244 |
| 84 | 3300005435 | Ga0070714_100090715 | Ga0070714_1000907152 | 244 |
| 85 | 3300005435 | Ga0070714_100226882 | Ga0070714_1002268823 | 244 |
| 86 | 3300005436 | Ga0070713_100103696 | Ga0070713_1001036962 | 244 |
| 87 | 3300005436 | Ga0070713_100157475 | Ga0070713_1001574753 | 244 |
| 88 | 3300005437 | Ga0070710_10032628 | Ga0070710_100326283 | 244 |
| 89 | 3300005458 | Ga0070681_10073741 | Ga0070681_100737413 | 244 |
| 90 | 3300005468 | Ga0070707_100066294 | Ga0070707_1000662943 | 244 |
| 91 | 3300005471 | Ga0070698_100009228 | Ga0070698_1000092283 | 244 |
| 92 | 3300005518 | Ga0070699_100076467 | Ga0070699_1000764672 | 244 |
| 93 | 3300005535 | Ga0070684_100321456 | Ga0070684_1003214562 | 244 |
| 94 | 3300005548 | Ga0070665_100111970 | Ga0070665_1001119702 | 244 |
| 95 | 3300005577 | Ga0068857_100687266 | Ga0068857_1006872662 | 244 |
| 96 | 3300005616 | Ga0068852_100150038 | Ga0068852_1001500383 | 244 |
| 97 | 3300006028 | Ga0070717_10241001 | Ga0070717_102410012 | 244 |
| 98 | 3300006028 | Ga0070717_10288394 | Ga0070717_102883942 | 244 |
| 99 | 3300006173 | Ga0070716_100034547 | Ga0070716_1000345472 | 244 |
| 100 | 3300006175 | Ga0070712_100005494 | Ga0070712_1000054948 | 244 |
| 101 | 3300013104 | Ga0157370_10057608 | Ga0157370_100576085 | 244 |
| 102 | 3300013105 | Ga0157369_10129576 | Ga0157369_101295764 | 244 |
| 103 | 3300020070 | Ga0206356_10357540 | Ga0206356_103575403 | 244 |
| 104 | 3300022467 | Ga0224712_10091684 | Ga0224712_100916842 | 244 |
| 105 | 3300025904 | Ga0207647_10090575 | Ga0207647_100905751 | 244 |
| 106 | 3300025906 | Ga0207699_10003554 | Ga0207699_100035547 | 244 |
| 107 | 3300025909 | Ga0207705_10313041 | Ga0207705_103130413 | 244 |
| 108 | 3300025912 | Ga0207707_10050349 | Ga0207707_100503492 | 244 |
| 109 | 3300025915 | Ga0207693_10012884 | Ga0207693_100128843 | 244 |
| 110 | 3300025915 | Ga0207693_10022336 | Ga0207693_100223365 | 244 |
| 111 | 3300025917 | Ga0207660_10064154 | Ga0207660_100641543 | 244 |
| 112 | 3300025919 | Ga0207657_10025688 | Ga0207657_100256886 | 244 |
| 113 | 3300025922 | Ga0207646_10106023 | Ga0207646_101060233 | 244 |
| 114 | 3300025928 | Ga0207700_10007329 | Ga0207700_100073297 | 244 |
| 115 | 3300025928 | Ga0207700_10086278 | Ga0207700_100862783 | 244 |
| 116 | 3300025928 | Ga0207700_10138432 | Ga0207700_101384322 | 244 |
| 117 | 3300025929 | Ga0207664_10012624 | Ga0207664_100126243 | 244 |
| 118 | 3300025929 | Ga0207664_10125027 | Ga0207664_101250273 | 244 |
| 119 | 3300025929 | Ga0207664_10342427 | Ga0207664_103424271 | 244 |
| 120 | 3300025929 | Ga0207664_10731517 | Ga0207664_107315171 | 244 |
| 121 | 3300025939 | Ga0207665_10045607 | Ga0207665_100456074 | 244 |
| 122 | 3300025939 | Ga0207665_10135810 | Ga0207665_101358102 | 244 |
| 123 | 3300026067 | Ga0207678_10007418 | Ga0207678_100074187 | 244 |
| 124 | 3300026067 | Ga0207678_10081725 | Ga0207678_100817251 | 244 |
| 125 | 3300026116 | Ga0207674_10037961 | Ga0207674_100379613 | 244 |
| 126 | 3300026116 | Ga0207674_10479038 | Ga0207674_104790382 | 244 |
| 127 | 3300026142 | Ga0207698_10152830 | Ga0207698_101528302 | 244 |
| 128 | 3300028379 | Ga0268266_10094709 | Ga0268266_100947093 | 244 |
| 129 | 3300031731 | Ga0307405_10049965 | Ga0307405_100499651 | 244 |
| 130 | 3300031824 | Ga0307413_10023094 | Ga0307413_100230942 | 244 |
| 131 | 3300031995 | Ga0307409_100302300 | Ga0307409_1003023002 | 244 |
| 132 | 3300032126 | Ga0307415_100025726 | Ga0307415_1000257264 | 244 |
| 133 | 3300035086 | Ga0373934_0031420 | Ga0373934_0031420_290_1033 | 244 |
| 134 | 3300035113 | Ga0373936_0010500 | Ga0373936_0010500_2046_2789 | 244 |
| 135 | 3300035118 | Ga0373954_0057351 | Ga0373954_0057351_354_1097 | 244 |
| 136 | 3300035120 | Ga0373957_0085254 | Ga0373957_0085254_452_1195 | 244 |
| 137 | 3300035172 | Ga0373955_0029602 | Ga0373955_0029602_45_788 | 244 |
| 138 | 3300035410 | Ga0373924_0011618 | Ga0373924_0011618_545_1288 | 244 |
| 139 | 3300035692 | Ga0373935_0146614 | Ga0373935_0146614_457_1200 | 244 |
| 140 | 3300035724 | Ga0373933_0016144 | Ga0373933_0016144_56_799 | 244 |
| 141 | 3300037466 | Ga0395898_0036977 | Ga0395898_0036977_132_875 | 244 |
| 142 | 3300044694 | Ga0466963_0122264 | Ga0466963_0122264_663_1400 | 244 |
| 143 | 3300045836 | Ga0466958_0058276 | Ga0466958_0058276_754_1491 | 244 |
| 144 | 3300046463 | Ga0495653_0021618 | Ga0495653_0021618_1210_1953 | 244 |
| 145 | 3300046516 | Ga0495628_0220511 | Ga0495628_0220511_130_873 | 244 |
| 146 | 3300046517 | Ga0495630_0413688 | Ga0495630_0413688_14_757 | 244 |
| 147 | 3300046533 | Ga0495640_0014013 | Ga0495640_0014013_4823_5566 | 244 |
| 148 | 3300046535 | Ga0495586_0020844 | Ga0495586_0020844_672_1415 | 244 |
| 149 | 3300046536 | Ga0495587_0067962 | Ga0495587_0067962_936_1679 | 244 |
| 150 | 3300046543 | Ga0495645_0027092 | Ga0495645_0027092_3034_3777 | 244 |
| 151 | 3300046642 | Ga0495634_0095421 | Ga0495634_0095421_367_1110 | 244 |
| 152 | 3300046663 | Ga0495635_0122104 | Ga0495635_0122104_68_811 | 244 |
| 153 | 3300046675 | Ga0495657_0046225 | Ga0495657_0046225_250_993 | 244 |
| 154 | 3300046678 | Ga0495599_0263107 | Ga0495599_0263107_293_1036 | 244 |
| 155 | 3300046679 | Ga0495623_0038419 | Ga0495623_0038419_323_1066 | 244 |
| 156 | 3300046680 | Ga0495646_0027436 | Ga0495646_0027436_2134_2877 | 244 |
| 157 | 3300047317 | Ga0495604_0066312 | Ga0495604_0066312_1749_2492 | 244 |
| 158 | 3300047319 | Ga0495674_0334491 | Ga0495674_0334491_51_794 | 244 |
| 159 | 3300047322 | Ga0495680_0158276 | Ga0495680_0158276_398_1141 | 244 |
| 160 | 3300048088 | Ga0495602_0112008 | Ga0495602_0112008_506_1249 | 244 |
| 161 | 3300048915 | Ga0496112_0789927 | Ga0496112_0789927_81_824 | 244 |
| 162 | 3300048918 | Ga0496115_0058151 | Ga0496115_0058151_1979_2722 | 244 |
| 163 | 3300048929 | Ga0496126_0040528 | Ga0496126_0040528_2059_2802 | 244 |
| 164 | 3300048929 | Ga0496126_0052562 | Ga0496126_0052562_2264_3007 | 244 |
| 165 | 3300005354 | Ga0070675_100392966 | Ga0070675_1003929661 | 245 |
| 166 | 3300005543 | Ga0070672_100122245 | Ga0070672_1001222452 | 245 |
| 167 | 3300009036 | Ga0105244_10006177 | Ga0105244_100061775 | 245 |
| 168 | 3300011119 | Ga0105246_10043073 | Ga0105246_100430733 | 245 |
| 169 | 3300025303 | Ga0209051_1004857 | Ga0209051_10048573 | 245 |
| 170 | 3300025315 | Ga0207697_10004439 | Ga0207697_100044392 | 245 |
| 171 | 3300028573 | Ga0265334_10041226 | Ga0265334_100412261 | 245 |
| 172 | 3300028654 | Ga0265322_10014316 | Ga0265322_100143163 | 245 |
| 173 | 3300028666 | Ga0265336_10003740 | Ga0265336_100037405 | 245 |
| 174 | 3300029957 | Ga0265324_10009973 | Ga0265324_100099733 | 245 |
| 175 | 3300031238 | Ga0265332_10050673 | Ga0265332_100506731 | 245 |
| 176 | 3300031250 | Ga0265331_10014814 | Ga0265331_100148143 | 245 |
| 177 | 3300031456 | Ga0307513_10001986 | Ga0307513_1000198613 | 245 |
| 178 | 3300031712 | Ga0265342_10049373 | Ga0265342_100493733 | 245 |
| 179 | 3300031995 | Ga0307409_100532770 | Ga0307409_1005327701 | 245 |
| 180 | 3300041456 | Ga0451795_1034354 | Ga0451795_1034354_2452_3198 | 245 |
| 181 | 3300041459 | Ga0451800_0421651 | Ga0451800_0421651_79_825 | 245 |
| 182 | 3300046475 | Ga0495639_0136025 | Ga0495639_0136025_382_1131 | 245 |
| 183 | 3300046681 | Ga0495647_0034238 | Ga0495647_0034238_952_1701 | 245 |
| 184 | 3300048903 | Ga0496100_0320045 | Ga0496100_0320045_33_782 | 245 |
| 185 | 3300048906 | Ga0496103_0048374 | Ga0496103_0048374_1371_2120 | 245 |
| 186 | 3300048907 | Ga0496104_0001344 | Ga0496104_0001344_12349_13098 | 245 |
| 187 | 3300048908 | Ga0496105_0015905 | Ga0496105_0015905_3250_3999 | 245 |
| 188 | 3300048911 | Ga0496108_0003880 | Ga0496108_0003880_8638_9387 | 245 |
| 189 | 3300048912 | Ga0496109_0009141 | Ga0496109_0009141_3747_4496 | 245 |
| 190 | 3300048913 | Ga0496110_0077753 | Ga0496110_0077753_451_1200 | 245 |
| 191 | 3300048914 | Ga0496111_0000184 | Ga0496111_0000184_14870_15619 | 245 |
| 192 | 3300048917 | Ga0496114_0045997 | Ga0496114_0045997_1181_1930 | 245 |
| 193 | 3300048917 | Ga0496114_0468784 | Ga0496114_0468784_107_856 | 245 |
| 194 | 3300048918 | Ga0496115_0106671 | Ga0496115_0106671_320_1069 | 245 |
| 195 | 3300053153 | Ga0500616_0011605 | Ga0500616_0011605_2181_2930 | 245 |
| 196 | iso_pu_bacteria | 2675903060 | 2676489056 | 245 |
| 197 | iso_pu_bacteria | 2816332119 | 2816427009 | 245 |
| 198 | iso_pu_bacteria | 2844849076 | 2844850581 | 245 |
| 199 | iso_pu_bacteria | 2857740372 | 2857744859 | 245 |
| 200 | iso_pu_bacteria | 2899370129 | 2899371203 | 245 |
| 201 | iso_pu_bacteria | 2904497146 | 2904499108 | 245 |
| 202 | iso_pu_bacteria | 2910809715 | 2910811428 | 245 |
| 203 | iso_pu_bacteria | 2919059106 | 2919060911 | 245 |
| 204 | iso_pu_bacteria | 2933418574 | 2933422151 | 245 |
| 205 | iso_pu_bacteria | 2939647034 | 2939651234 | 245 |
| 206 | 3300003203 | JGI25406J46586_10059721 | JGI25406J46586_100597211 | 246 |
| 207 | 3300005548 | Ga0070665_100217797 | Ga0070665_1002177972 | 246 |
| 208 | 3300005614 | Ga0068856_100502046 | Ga0068856_1005020462 | 246 |
| 209 | 3300005985 | Ga0081539_10001103 | Ga0081539_100011037 | 246 |
| 210 | 3300006048 | Ga0075363_100141625 | Ga0075363_1001416252 | 246 |
| 211 | 3300006051 | Ga0075364_10130113 | Ga0075364_101301131 | 246 |
| 212 | 3300006178 | Ga0075367_10078717 | Ga0075367_100787172 | 246 |
| 213 | 3300009553 | Ga0105249_10264363 | Ga0105249_102643632 | 246 |
| 214 | 3300013307 | Ga0157372_10137066 | Ga0157372_101370661 | 246 |
| 215 | 3300013307 | Ga0157372_10360691 | Ga0157372_103606912 | 246 |
| 216 | 3300026078 | Ga0207702_10525361 | Ga0207702_105253611 | 246 |
| 217 | 3300027866 | Ga0209813_10120765 | Ga0209813_101207651 | 246 |
| 218 | 3300028379 | Ga0268266_10532855 | Ga0268266_105328552 | 246 |
| 219 | 3300031507 | Ga0307509_10011002 | Ga0307509_100110028 | 246 |
| 220 | 3300044694 | Ga0466963_0010946 | Ga0466963_0010946_82_825 | 246 |
| 221 | 3300045976 | Ga0466967_0041393 | Ga0466967_0041393_2677_3417 | 246 |
| 222 | 3300045976 | Ga0466967_0063721 | Ga0466967_0063721_90_833 | 246 |
| 223 | 3300046660 | Ga0495625_0050603 | Ga0495625_0050603_567_1316 | 246 |
| 224 | 3300048908 | Ga0496105_0104975 | Ga0496105_0104975_444_1187 | 246 |
| 225 | 3300048917 | Ga0496114_0204771 | Ga0496114_0204771_552_1295 | 246 |
| 226 | 3300048917 | Ga0496114_0240856 | Ga0496114_0240856_793_1536 | 246 |
| 227 | 3300050490 | nmdc:mga03n38_113996_c1 | nmdc:mga03n38_113996_c1_382_1125 | 246 |
| 228 | 3300050492 | nmdc:mga0yw44_9998_c1 | nmdc:mga0yw44_9998_c1_1266_2009 | 246 |
| 229 | 3300050494 | nmdc:mga06z11_79061_c1 | nmdc:mga06z11_79061_c1_924_1667 | 246 |
| 230 | 3300050495 | nmdc:mga04h51_141831_c1 | nmdc:mga04h51_141831_c1_136_879 | 246 |
| 231 | iso_pu_bacteria | 2731639228 | 2731909369 | 246 |
| 232 | iso_pu_bacteria | 2887443736 | 2887446781 | 246 |
| 233 | iso_pu_bacteria | 2912715099 | 2912715776 | 246 |
| 234 | 3300005434 | Ga0070709_10167460 | Ga0070709_101674602 | 247 |
| 235 | 3300005435 | Ga0070714_100051600 | Ga0070714_1000516003 | 247 |
| 236 | 3300005436 | Ga0070713_100236426 | Ga0070713_1002364262 | 247 |
| 237 | 3300005436 | Ga0070713_100504083 | Ga0070713_1005040832 | 247 |
| 238 | 3300005467 | Ga0070706_100262720 | Ga0070706_1002627202 | 247 |
| 239 | 3300005985 | Ga0081539_10022636 | Ga0081539_100226363 | 247 |
| 240 | 3300025904 | Ga0207647_10013528 | Ga0207647_100135284 | 247 |
| 241 | 3300025915 | Ga0207693_10051422 | Ga0207693_100514224 | 247 |
| 242 | 3300025916 | Ga0207663_10060410 | Ga0207663_100604102 | 247 |
| 243 | 3300025928 | Ga0207700_10078808 | Ga0207700_100788082 | 247 |
| 244 | 3300026118 | Ga0207675_100702086 | Ga0207675_1007020862 | 247 |
| 245 | 3300028556 | Ga0265337_1000230 | Ga0265337_100023019 | 247 |
| 246 | 3300028558 | Ga0265326_10001838 | Ga0265326_100018387 | 247 |
| 247 | 3300028563 | Ga0265319_1001673 | Ga0265319_100167312 | 247 |
| 248 | 3300028573 | Ga0265334_10000178 | Ga0265334_1000017813 | 247 |
| 249 | 3300028666 | Ga0265336_10003119 | Ga0265336_100031192 | 247 |
| 250 | 3300028800 | Ga0265338_10000683 | Ga0265338_1000068342 | 247 |
| 251 | 3300029957 | Ga0265324_10006327 | Ga0265324_100063272 | 247 |
| 252 | 3300031238 | Ga0265332_10020655 | Ga0265332_100206551 | 247 |
| 253 | 3300031240 | Ga0265320_10007740 | Ga0265320_100077403 | 247 |
| 254 | 3300031247 | Ga0265340_10001938 | Ga0265340_100019383 | 247 |
| 255 | 3300031249 | Ga0265339_10196402 | Ga0265339_101964022 | 247 |
| 256 | 3300031344 | Ga0265316_10015012 | Ga0265316_100150123 | 247 |
| 257 | 3300031595 | Ga0265313_10004009 | Ga0265313_100040093 | 247 |
| 258 | 3300031711 | Ga0265314_10010641 | Ga0265314_100106419 | 247 |
| 259 | 3300031712 | Ga0265342_10001496 | Ga0265342_100014965 | 247 |
| 260 | 3300032002 | Ga0307416_100192175 | Ga0307416_1001921752 | 247 |
| 261 | 3300046476 | Ga0495662_0090320 | Ga0495662_0090320_160_906 | 247 |
| 262 | 3300048911 | Ga0496108_0276214 | Ga0496108_0276214_339_1091 | 247 |
| 263 | 3300048917 | Ga0496114_0087355 | Ga0496114_0087355_1502_2245 | 247 |
| 264 | 3300049574 | Ga0501038_0056791 | Ga0501038_0056791_43_789 | 247 |
| 265 | 3300049575 | Ga0501039_0038797 | Ga0501039_0038797_165_911 | 247 |
| 266 | 3300049576 | Ga0501040_0022715 | Ga0501040_0022715_544_1290 | 247 |
| 267 | 3300049577 | Ga0501041_0027512 | Ga0501041_0027512_2655_3401 | 247 |
| 268 | 3300049578 | Ga0501042_0025091 | Ga0501042_0025091_730_1476 | 247 |
| 269 | 3300049580 | Ga0501046_0115301 | Ga0501046_0115301_437_1183 | 247 |
| 270 | 3300049582 | Ga0501048_0027173 | Ga0501048_0027173_913_1659 | 247 |
| 271 | 3300049586 | Ga0501070_0334905 | Ga0501070_0334905_198_944 | 247 |
| 272 | 3300049587 | Ga0501071_0107270 | Ga0501071_0107270_430_1176 | 247 |
| 273 | 3300049588 | Ga0501072_0016239 | Ga0501072_0016239_2211_2957 | 247 |
| 274 | 3300049592 | Ga0501076_0052533 | Ga0501076_0052533_1973_2719 | 247 |
| 275 | 3300049741 | Ga0501079_0153950 | Ga0501079_0153950_317_1063 | 247 |
| 276 | 3300061734 | Ga0530510_0049948 | Ga0530510_0049948_2127_2873 | 247 |
| 277 | iso_pu_bacteria | 2582581313 | 2585304325 | 247 |
| 278 | iso_pu_bacteria | 2582581314 | 2585314956 | 247 |
| 279 | iso_pu_bacteria | 2643221548 | 2643760014 | 247 |
| 280 | iso_pu_bacteria | 2643221678 | 2644440778 | 247 |
| 281 | iso_pu_bacteria | 2643221682 | 2644460290 | 247 |
| 282 | iso_pu_bacteria | 2784746763 | 2785346268 | 247 |
| 283 | iso_pu_bacteria | 2784746763 | 2785346826 | 247 |
| 284 | iso_pu_bacteria | 2784746768 | 2785373391 | 247 |
| 285 | iso_pu_bacteria | 2786546132 | 2786674605 | 247 |
| 286 | iso_pu_bacteria | 2808606359 | 2808845504 | 247 |
| 287 | iso_pu_bacteria | 2808606375 | 2808915210 | 247 |
| 288 | iso_pu_bacteria | 2811994879 | 2812354187 | 247 |
| 289 | iso_pu_bacteria | 2852635781 | 2852635863 | 247 |
| 290 | iso_pu_bacteria | 2862281513 | 2862282898 | 247 |
| 291 | iso_pu_bacteria | 2863404153 | 2863407847 | 247 |
| 292 | iso_pu_bacteria | 2867428634 | 2867431623 | 247 |
| 293 | iso_pu_bacteria | 2877676314 | 2877677527 | 247 |
| 294 | iso_pu_bacteria | 2919468124 | 2919472853 | 247 |
| 295 | iso_pu_bacteria | 2932426870 | 2932430161 | 247 |
| 296 | iso_pu_bacteria | 2939674588 | 2939678959 | 247 |
| 297 | iso_pu_bacteria | 2946064051 | 2946071511 | 247 |
| 298 | iso_pu_bacteria | 2947224130 | 2947225267 | 247 |
| 299 | iso_pu_bacteria | 2954002825 | 2954009434 | 247 |
| 300 | iso_pu_bacteria | 2954380949 | 2954382258 | 247 |
| 301 | iso_pu_bacteria | 2954673503 | 2954680798 | 247 |
| 302 | iso_pu_bacteria | 2954682443 | 2954683357 | 247 |
| 303 | iso_pu_bacteria | 2954691527 | 2954693085 | 247 |
| 304 | iso_pu_bacteria | 2954701450 | 2954708159 | 247 |
| 305 | iso_pu_bacteria | 2954711539 | 2954712758 | 247 |
| 306 | iso_pu_bacteria | 2954721474 | 2954722717 | 247 |
| 307 | iso_pu_bacteria | 2954731030 | 2954739143 | 247 |
| 308 | iso_pu_bacteria | 2954740390 | 2954741597 | 247 |
| 309 | iso_pu_bacteria | 2954749733 | 2954757972 | 247 |
| 310 | iso_pu_bacteria | 2954759201 | 2954760608 | 247 |
| 311 | iso_pu_bacteria | 2997600082 | 2997608423 | 247 |
| 312 | iso_pu_bacteria | 8048406513 | 8048410554 | 247 |
| 313 | iso_pu_bacteria | 8056829672 | 8056836320 | 247 |
| 314 | 3300002773 | JGI25152J39213_1000109 | JGI25152J39213_10001095 | 248 |
| 315 | 3300005334 | Ga0068869_100123209 | Ga0068869_1001232091 | 248 |
| 316 | 3300009036 | Ga0105244_10054056 | Ga0105244_100540562 | 248 |
| 317 | 3300009148 | Ga0105243_10009399 | Ga0105243_100093995 | 248 |
| 318 | 3300011119 | Ga0105246_10602434 | Ga0105246_106024341 | 248 |
| 319 | 3300025258 | Ga0209129_1000180 | Ga0209129_100018019 | 248 |
| 320 | 3300025294 | Ga0209025_1001362 | Ga0209025_100136227 | 248 |
| 321 | 3300025942 | Ga0207689_10180457 | Ga0207689_101804572 | 248 |
| 322 | 3300031824 | Ga0307413_10113689 | Ga0307413_101136892 | 248 |
| 323 | 3300031852 | Ga0307410_10295621 | Ga0307410_102956212 | 248 |
| 324 | 3300031852 | Ga0307410_10545948 | Ga0307410_105459481 | 248 |
| 325 | 3300031995 | Ga0307409_100247022 | Ga0307409_1002470221 | 248 |
| 326 | 3300044658 | Ga0466972_0036878 | Ga0466972_0036878_159_908 | 248 |
| 327 | 3300044683 | Ga0466965_0001152 | Ga0466965_0001152_5447_6196 | 248 |
| 328 | 3300044694 | Ga0466963_0036954 | Ga0466963_0036954_407_1156 | 248 |
| 329 | 3300044694 | Ga0466963_0078485 | Ga0466963_0078485_62_811 | 248 |
| 330 | 3300044706 | Ga0466964_0002075 | Ga0466964_0002075_4817_5566 | 248 |
| 331 | 3300044719 | Ga0466971_0010618 | Ga0466971_0010618_3159_3908 | 248 |
| 332 | 3300044735 | Ga0466968_0033531 | Ga0466968_0033531_100_849 | 248 |
| 333 | 3300044765 | Ga0466970_0025639 | Ga0466970_0025639_2116_2865 | 248 |
| 334 | 3300044842 | Ga0466957_0102866 | Ga0466957_0102866_894_1643 | 248 |
| 335 | 3300044901 | Ga0466960_0009435 | Ga0466960_0009435_2247_2996 | 248 |
| 336 | 3300045049 | Ga0466959_0108116 | Ga0466959_0108116_426_1175 | 248 |
| 337 | 3300045836 | Ga0466958_0008107 | Ga0466958_0008107_3180_3929 | 248 |
| 338 | 3300045976 | Ga0466967_0002421 | Ga0466967_0002421_4494_5243 | 248 |
| 339 | 3300045976 | Ga0466967_0255378 | Ga0466967_0255378_895_1644 | 248 |
| 340 | 3300046471 | Ga0495650_0028239 | Ga0495650_0028239_711_1460 | 248 |
| 341 | 3300061719 | Ga0466962_0013923 | Ga0466962_0013923_2061_2810 | 248 |
| 342 | iso_pu_bacteria | 2585428094 | 2587864724 | 248 |
| 343 | iso_pu_bacteria | 2616644814 | 2616698793 | 248 |
| 344 | iso_pu_bacteria | 2643221578 | 2643904984 | 248 |
| 345 | iso_pu_bacteria | 2643221673 | 2644403043 | 248 |
| 346 | iso_pu_bacteria | 2643221714 | 2644631094 | 248 |
| 347 | iso_pu_bacteria | 2784746763 | 2785346317 | 248 |
| 348 | iso_pu_bacteria | 2784746768 | 2785373451 | 248 |
| 349 | iso_pu_bacteria | 2852635781 | 2852642595 | 248 |
| 350 | iso_pu_bacteria | 2877676314 | 2877677032 | 248 |
| 351 | iso_pu_bacteria | 2946045630 | 2946052410 | 248 |
| 352 | iso_pu_bacteria | 2946072368 | 2946079871 | 248 |
| 353 | iso_pu_bacteria | 2954380949 | 2954390056 | 248 |
| 354 | 3300003203 | JGI25406J46586_10041231 | JGI25406J46586_100412312 | 249 |
| 355 | 3300005434 | Ga0070709_10052893 | Ga0070709_100528932 | 249 |
| 356 | 3300005436 | Ga0070713_100014860 | Ga0070713_1000148605 | 249 |
| 357 | 3300005439 | Ga0070711_100016186 | Ga0070711_1000161862 | 249 |
| 358 | 3300005983 | Ga0081540_1002232 | Ga0081540_10022324 | 249 |
| 359 | 3300005985 | Ga0081539_10003736 | Ga0081539_1000373616 | 249 |
| 360 | 3300005985 | Ga0081539_10038322 | Ga0081539_100383224 | 249 |
| 361 | 3300006847 | Ga0075431_100485878 | Ga0075431_1004858782 | 249 |
| 362 | 3300025906 | Ga0207699_10281098 | Ga0207699_102810982 | 249 |
| 363 | 3300025916 | Ga0207663_10214767 | Ga0207663_102147671 | 249 |
| 364 | 3300025928 | Ga0207700_10046153 | Ga0207700_100461534 | 249 |
| 365 | 3300031507 | Ga0307509_10024641 | Ga0307509_100246413 | 249 |
| 366 | 3300044656 | Ga0466969_0002669 | Ga0466969_0002669_3040_3798 | 249 |
| 367 | 3300044684 | Ga0466966_0006589 | Ga0466966_0006589_2354_3112 | 249 |
| 368 | 3300044693 | Ga0466961_0001075 | Ga0466961_0001075_15419_16177 | 249 |
| 369 | 3300044719 | Ga0466971_0000151 | Ga0466971_0000151_551_1309 | 249 |
| 370 | 3300045049 | Ga0466959_0002709 | Ga0466959_0002709_2371_3129 | 249 |
| 371 | 3300045836 | Ga0466958_0027439 | Ga0466958_0027439_1125_1883 | 249 |
| 372 | 3300046454 | Ga0495592_0130734 | Ga0495592_0130734_883_1641 | 249 |
| 373 | 3300046462 | Ga0495651_0001705 | Ga0495651_0001705_7806_8564 | 249 |
| 374 | 3300046477 | Ga0495664_0159761 | Ga0495664_0159761_391_1149 | 249 |
| 375 | 3300046529 | Ga0495652_0001214 | Ga0495652_0001214_14758_15516 | 249 |
| 376 | 3300046535 | Ga0495586_0039468 | Ga0495586_0039468_66_824 | 249 |
| 377 | 3300046663 | Ga0495635_0001004 | Ga0495635_0001004_6439_7197 | 249 |
| 378 | 3300046680 | Ga0495646_0126822 | Ga0495646_0126822_607_1365 | 249 |
| 379 | 3300050510 | nmdc:mga06r32_517459_c1 | nmdc:mga06r32_517459_c1_53_829 | 249 |
| 380 | 3300053077 | Ga0495601_0046889 | Ga0495601_0046889_1356_2114 | 249 |
| 381 | 3300053077 | Ga0495601_0080219 | Ga0495601_0080219_103_861 | 249 |
| 382 | 3300053078 | Ga0495612_0030361 | Ga0495612_0030361_1233_1991 | 249 |
| 383 | 3300053080 | Ga0500635_0000006 | Ga0500635_0000006_99438_100190 | 249 |
| 384 | 3300061719 | Ga0466962_0000203 | Ga0466962_0000203_15375_16133 | 249 |
| 385 | iso_pu_bacteria | 2811994917 | 2812482928 | 249 |
| 386 | iso_pu_bacteria | 2966598605 | 2966604224 | 249 |
| 387 | 3300001989 | JGI24739J22299_10042956 | JGI24739J22299_100429562 | 250 |
| 388 | 3300001989 | JGI24739J22299_10049648 | JGI24739J22299_100496481 | 250 |
| 389 | 3300003316 | rootH1_10055768 | rootH1_100557685 | 250 |
| 390 | 3300003322 | rootL2_10001330 | rootL2_100013304 | 250 |
| 391 | 3300003323 | rootH1_10015077 | rootH1_100150771 | 250 |
| 392 | 3300003323 | rootH1_10015078 | rootH1_100150782 | 250 |
| 393 | 3300005437 | Ga0070710_10064158 | Ga0070710_100641582 | 250 |
| 394 | 3300005456 | Ga0070678_100075137 | Ga0070678_1000751373 | 250 |
| 395 | 3300005563 | Ga0068855_100439186 | Ga0068855_1004391862 | 250 |
| 396 | 3300005985 | Ga0081539_10064219 | Ga0081539_100642193 | 250 |
| 397 | 3300006038 | Ga0075365_10101617 | Ga0075365_101016172 | 250 |
| 398 | 3300006042 | Ga0075368_10005280 | Ga0075368_100052805 | 250 |
| 399 | 3300006178 | Ga0075367_10005258 | Ga0075367_100052582 | 250 |
| 400 | 3300006846 | Ga0075430_100035704 | Ga0075430_1000357043 | 250 |
| 401 | 3300006847 | Ga0075431_100005354 | Ga0075431_10000535412 | 250 |
| 402 | 3300006880 | Ga0075429_100035883 | Ga0075429_1000358833 | 250 |
| 403 | 3300006948 | Ga0099826_10049670 | Ga0099826_100496703 | 250 |
| 404 | 3300009147 | Ga0114129_10000681 | Ga0114129_100006814 | 250 |
| 405 | 3300013105 | Ga0157369_10114233 | Ga0157369_101142332 | 250 |
| 406 | 3300013105 | Ga0157369_10457542 | Ga0157369_104575422 | 250 |
| 407 | 3300014497 | Ga0182008_10000552 | Ga0182008_100005529 | 250 |
| 408 | 3300015262 | Ga0182007_10000554 | Ga0182007_100005543 | 250 |
| 409 | 3300015688 | Ga0183367_1016 | Ga0183367_1016239 | 250 |
| 410 | 3300025898 | Ga0207692_10121735 | Ga0207692_101217352 | 250 |
| 411 | 3300025904 | Ga0207647_10032455 | Ga0207647_100324553 | 250 |
| 412 | 3300025904 | Ga0207647_10096689 | Ga0207647_100966892 | 250 |
| 413 | 3300025949 | Ga0207667_10293489 | Ga0207667_102934892 | 250 |
| 414 | 3300026121 | Ga0207683_10054399 | Ga0207683_100543994 | 250 |
| 415 | 3300027312 | Ga0209371_1021303 | Ga0209371_10213032 | 250 |
| 416 | 3300028786 | Ga0307517_10018152 | Ga0307517_100181524 | 250 |
| 417 | 3300028794 | Ga0307515_10010304 | Ga0307515_100103048 | 250 |
| 418 | 3300030521 | Ga0307511_10000672 | Ga0307511_1000067228 | 250 |
| 419 | 3300030522 | Ga0307512_10000801 | Ga0307512_1000080123 | 250 |
| 420 | 3300031507 | Ga0307509_10006518 | Ga0307509_100065185 | 250 |
| 421 | 3300031507 | Ga0307509_10035479 | Ga0307509_100354794 | 250 |
| 422 | 3300031507 | Ga0307509_10138169 | Ga0307509_101381692 | 250 |
| 423 | 3300031616 | Ga0307508_10004718 | Ga0307508_100047183 | 250 |
| 424 | 3300031649 | Ga0307514_10005174 | Ga0307514_100051745 | 250 |
| 425 | 3300031649 | Ga0307514_10008786 | Ga0307514_100087864 | 250 |
| 426 | 3300031649 | Ga0307514_10101916 | Ga0307514_101019163 | 250 |
| 427 | 3300031730 | Ga0307516_10000841 | Ga0307516_100008415 | 250 |
| 428 | 3300031730 | Ga0307516_10059569 | Ga0307516_100595695 | 250 |
| 429 | 3300031838 | Ga0307518_10092157 | Ga0307518_100921572 | 250 |
| 430 | 3300033179 | Ga0307507_10030151 | Ga0307507_100301515 | 250 |
| 431 | 3300033179 | Ga0307507_10060126 | Ga0307507_100601263 | 250 |
| 432 | 3300033179 | Ga0307507_10094661 | Ga0307507_100946612 | 250 |
| 433 | 3300033180 | Ga0307510_10006065 | Ga0307510_100060657 | 250 |
| 434 | 3300033180 | Ga0307510_10057502 | Ga0307510_100575025 | 250 |
| 435 | 3300033180 | Ga0307510_10075977 | Ga0307510_100759775 | 250 |
| 436 | 3300033180 | Ga0307510_10130210 | Ga0307510_101302102 | 250 |
| 437 | 3300033180 | Ga0307510_10141332 | Ga0307510_101413322 | 250 |
| 438 | 3300037418 | Ga0395900_0231452 | Ga0395900_0231452_458_1213 | 250 |
| 439 | 3300037466 | Ga0395898_0007719 | Ga0395898_0007719_2484_3239 | 250 |
| 440 | 3300041404 | Ga0439436_0004109 | Ga0439436_0004109_1755_2510 | 250 |
| 441 | 3300041404 | Ga0439436_0015754 | Ga0439436_0015754_800_1555 | 250 |
| 442 | 3300041405 | Ga0439438_071793 | Ga0439438_071793_19_774 | 250 |
| 443 | 3300041406 | Ga0439439_0010864 | Ga0439439_0010864_619_1374 | 250 |
| 444 | 3300041406 | Ga0439439_0072405 | Ga0439439_0072405_61_816 | 250 |
| 445 | 3300041512 | Ga0451853_1223826 | Ga0451853_1223826_1017_1772 | 250 |
| 446 | 3300041999 | Ga0439433_0007013 | Ga0439433_0007013_963_1718 | 250 |
| 447 | 3300042005 | Ga0439448_0090220 | Ga0439448_0090220_72_827 | 250 |
| 448 | 3300042007 | Ga0439449_0012598 | Ga0439449_0012598_1859_2614 | 250 |
| 449 | 3300042007 | Ga0439449_0015988 | Ga0439449_0015988_1102_1857 | 250 |
| 450 | 3300042008 | Ga0439450_067692 | Ga0439450_067692_21_776 | 250 |
| 451 | 3300042014 | Ga0439457_000998 | Ga0439457_000998_3428_4183 | 250 |
| 452 | 3300042131 | Ga0450894_000148 | Ga0450894_000148_783_1538 | 250 |
| 453 | 3300042132 | Ga0450895_006859 | Ga0450895_006859_137_892 | 250 |
| 454 | 3300042134 | Ga0450898_000188 | Ga0450898_000188_1040_1795 | 250 |
| 455 | 3300042138 | Ga0450903_000204 | Ga0450903_000204_8684_9439 | 250 |
| 456 | 3300042145 | Ga0450906_000040 | Ga0450906_000040_2996_3751 | 250 |
| 457 | 3300042157 | Ga0439458_0000476 | Ga0439458_0000476_5022_5777 | 250 |
| 458 | 3300042157 | Ga0439458_0003238 | Ga0439458_0003238_1160_1915 | 250 |
| 459 | 3300042184 | Ga0450908_010342 | Ga0450908_010342_310_1065 | 250 |
| 460 | 3300044658 | Ga0466972_0000744 | Ga0466972_0000744_11320_12075 | 250 |
| 461 | 3300044684 | Ga0466966_0011651 | Ga0466966_0011651_3501_4256 | 250 |
| 462 | 3300044693 | Ga0466961_0009383 | Ga0466961_0009383_738_1493 | 250 |
| 463 | 3300044694 | Ga0466963_0037174 | Ga0466963_0037174_1497_2252 | 250 |
| 464 | 3300044706 | Ga0466964_0150537 | Ga0466964_0150537_283_1038 | 250 |
| 465 | 3300044719 | Ga0466971_0032982 | Ga0466971_0032982_816_1571 | 250 |
| 466 | 3300045976 | Ga0466967_0087334 | Ga0466967_0087334_2030_2785 | 250 |
| 467 | 3300046454 | Ga0495592_0011446 | Ga0495592_0011446_244_1002 | 250 |
| 468 | 3300046454 | Ga0495592_0012776 | Ga0495592_0012776_4561_5316 | 250 |
| 469 | 3300046459 | Ga0495629_0014036 | Ga0495629_0014036_654_1412 | 250 |
| 470 | 3300046459 | Ga0495629_0015196 | Ga0495629_0015196_2464_3219 | 250 |
| 471 | 3300046459 | Ga0495629_0025807 | Ga0495629_0025807_1261_2016 | 250 |
| 472 | 3300046459 | Ga0495629_0371008 | Ga0495629_0371008_197_955 | 250 |
| 473 | 3300046460 | Ga0495638_0075194 | Ga0495638_0075194_1096_1851 | 250 |
| 474 | 3300046462 | Ga0495651_0004042 | Ga0495651_0004042_4169_4924 | 250 |
| 475 | 3300046472 | Ga0495580_0182859 | Ga0495580_0182859_466_1224 | 250 |
| 476 | 3300046474 | Ga0495605_0120762 | Ga0495605_0120762_401_1156 | 250 |
| 477 | 3300046476 | Ga0495662_0000534 | Ga0495662_0000534_6991_7746 | 250 |
| 478 | 3300046476 | Ga0495662_0092381 | Ga0495662_0092381_43_801 | 250 |
| 479 | 3300046477 | Ga0495664_0000617 | Ga0495664_0000617_9912_10670 | 250 |
| 480 | 3300046477 | Ga0495664_0003610 | Ga0495664_0003610_6168_6923 | 250 |
| 481 | 3300046492 | Ga0495585_0022960 | Ga0495585_0022960_49_807 | 250 |
| 482 | 3300046499 | Ga0495594_0008240 | Ga0495594_0008240_1522_2280 | 250 |
| 483 | 3300046499 | Ga0495594_0034337 | Ga0495594_0034337_666_1421 | 250 |
| 484 | 3300046500 | Ga0495596_0014822 | Ga0495596_0014822_602_1360 | 250 |
| 485 | 3300046506 | Ga0495583_0006789 | Ga0495583_0006789_156_914 | 250 |
| 486 | 3300046506 | Ga0495583_0064824 | Ga0495583_0064824_171_929 | 250 |
| 487 | 3300046506 | Ga0495583_0072513 | Ga0495583_0072513_327_1082 | 250 |
| 488 | 3300046507 | Ga0495606_0007389 | Ga0495606_0007389_4375_5133 | 250 |
| 489 | 3300046511 | Ga0495608_0036891 | Ga0495608_0036891_885_1643 | 250 |
| 490 | 3300046512 | Ga0495610_0059901 | Ga0495610_0059901_407_1165 | 250 |
| 491 | 3300046513 | Ga0495616_0018556 | Ga0495616_0018556_3007_3765 | 250 |
| 492 | 3300046514 | Ga0495618_0218426 | Ga0495618_0218426_350_1108 | 250 |
| 493 | 3300046515 | Ga0495620_0010158 | Ga0495620_0010158_3584_4342 | 250 |
| 494 | 3300046516 | Ga0495628_0036786 | Ga0495628_0036786_887_1645 | 250 |
| 495 | 3300046516 | Ga0495628_0071763 | Ga0495628_0071763_553_1308 | 250 |
| 496 | 3300046516 | Ga0495628_0100719 | Ga0495628_0100719_917_1675 | 250 |
| 497 | 3300046517 | Ga0495630_0169651 | Ga0495630_0169651_470_1225 | 250 |
| 498 | 3300046518 | Ga0495631_0003534 | Ga0495631_0003534_130_888 | 250 |
| 499 | 3300046520 | Ga0495637_0019780 | Ga0495637_0019780_2075_2833 | 250 |
| 500 | 3300046522 | Ga0495643_0010819 | Ga0495643_0010819_2307_3065 | 250 |
| 501 | 3300046524 | Ga0495648_0037742 | Ga0495648_0037742_1347_2105 | 250 |
| 502 | 3300046524 | Ga0495648_0070367 | Ga0495648_0070367_410_1168 | 250 |
| 503 | 3300046529 | Ga0495652_0031801 | Ga0495652_0031801_1570_2325 | 250 |
| 504 | 3300046530 | Ga0495654_0162063 | Ga0495654_0162063_35_793 | 250 |
| 505 | 3300046531 | Ga0495665_0199212 | Ga0495665_0199212_16_774 | 250 |
| 506 | 3300046533 | Ga0495640_0040118 | Ga0495640_0040118_1298_2056 | 250 |
| 507 | 3300046535 | Ga0495586_0067886 | Ga0495586_0067886_499_1257 | 250 |
| 508 | 3300046536 | Ga0495587_0003123 | Ga0495587_0003123_9377_10132 | 250 |
| 509 | 3300046536 | Ga0495587_0037947 | Ga0495587_0037947_1922_2680 | 250 |
| 510 | 3300046538 | Ga0495609_0006276 | Ga0495609_0006276_378_1136 | 250 |
| 511 | 3300046542 | Ga0495597_0114070 | Ga0495597_0114070_112_870 | 250 |
| 512 | 3300046543 | Ga0495645_0005263 | Ga0495645_0005263_3795_4550 | 250 |
| 513 | 3300046558 | Ga0495633_0019430 | Ga0495633_0019430_2390_3148 | 250 |
| 514 | 3300046616 | Ga0495668_0047568 | Ga0495668_0047568_1348_2106 | 250 |
| 515 | 3300046616 | Ga0495668_0064320 | Ga0495668_0064320_159_917 | 250 |
| 516 | 3300046642 | Ga0495634_0005064 | Ga0495634_0005064_9170_9925 | 250 |
| 517 | 3300046642 | Ga0495634_0015110 | Ga0495634_0015110_2806_3564 | 250 |
| 518 | 3300046648 | Ga0495611_0040066 | Ga0495611_0040066_500_1258 | 250 |
| 519 | 3300046648 | Ga0495611_0108677 | Ga0495611_0108677_132_890 | 250 |
| 520 | 3300046660 | Ga0495625_0022762 | Ga0495625_0022762_1733_2488 | 250 |
| 521 | 3300046663 | Ga0495635_0006399 | Ga0495635_0006399_7147_7902 | 250 |
| 522 | 3300046663 | Ga0495635_0008784 | Ga0495635_0008784_4819_5577 | 250 |
| 523 | 3300046665 | Ga0495661_0015013 | Ga0495661_0015013_2288_3046 | 250 |
| 524 | 3300046674 | Ga0495588_0007950 | Ga0495588_0007950_1806_2561 | 250 |
| 525 | 3300046675 | Ga0495657_0007012 | Ga0495657_0007012_2134_2892 | 250 |
| 526 | 3300046675 | Ga0495657_0007655 | Ga0495657_0007655_189_944 | 250 |
| 527 | 3300046679 | Ga0495623_0140009 | Ga0495623_0140009_58_816 | 250 |
| 528 | 3300046680 | Ga0495646_0057201 | Ga0495646_0057201_1479_2234 | 250 |
| 529 | 3300046683 | Ga0495658_0008782 | Ga0495658_0008782_2313_3071 | 250 |
| 530 | 3300046683 | Ga0495658_0025901 | Ga0495658_0025901_1108_1863 | 250 |
| 531 | 3300046689 | Ga0495613_0017227 | Ga0495613_0017227_295_1050 | 250 |
| 532 | 3300046689 | Ga0495613_0097823 | Ga0495613_0097823_1135_1893 | 250 |
| 533 | 3300046692 | Ga0495671_0027920 | Ga0495671_0027920_497_1252 | 250 |
| 534 | 3300046794 | Ga0495589_0017853 | Ga0495589_0017853_1779_2537 | 250 |
| 535 | 3300046794 | Ga0495589_0056999 | Ga0495589_0056999_62_820 | 250 |
| 536 | 3300046809 | Ga0495600_0017891 | Ga0495600_0017891_295_1050 | 250 |
| 537 | 3300046810 | Ga0495660_0102664 | Ga0495660_0102664_80_838 | 250 |
| 538 | 3300047315 | Ga0495581_0021486 | Ga0495581_0021486_1478_2233 | 250 |
| 539 | 3300047315 | Ga0495581_0075144 | Ga0495581_0075144_21_779 | 250 |
| 540 | 3300047317 | Ga0495604_0003200 | Ga0495604_0003200_779_1534 | 250 |
| 541 | 3300047317 | Ga0495604_0004760 | Ga0495604_0004760_4354_5112 | 250 |
| 542 | 3300047317 | Ga0495604_0239144 | Ga0495604_0239144_29_787 | 250 |
| 543 | 3300047318 | Ga0495636_0018692 | Ga0495636_0018692_31_786 | 250 |
| 544 | 3300047318 | Ga0495636_0072794 | Ga0495636_0072794_298_1056 | 250 |
| 545 | 3300047319 | Ga0495674_0069192 | Ga0495674_0069192_712_1470 | 250 |
| 546 | 3300047319 | Ga0495674_0518661 | Ga0495674_0518661_30_788 | 250 |
| 547 | 3300047321 | Ga0495676_0012001 | Ga0495676_0012001_1557_2312 | 250 |
| 548 | 3300047321 | Ga0495676_0017146 | Ga0495676_0017146_650_1408 | 250 |
| 549 | 3300047321 | Ga0495676_0021121 | Ga0495676_0021121_4549_5307 | 250 |
| 550 | 3300047321 | Ga0495676_0084970 | Ga0495676_0084970_1220_1978 | 250 |
| 551 | 3300047322 | Ga0495680_0010905 | Ga0495680_0010905_2591_3349 | 250 |
| 552 | 3300047443 | Ga0495687_001648 | Ga0495687_001648_7630_8385 | 250 |
| 553 | 3300047443 | Ga0495687_061924 | Ga0495687_061924_24_782 | 250 |
| 554 | 3300047443 | Ga0495687_082509 | Ga0495687_082509_263_1018 | 250 |
| 555 | 3300047447 | Ga0495685_042950 | Ga0495685_042950_563_1321 | 250 |
| 556 | 3300047470 | Ga0495681_0001693 | Ga0495681_0001693_7231_7986 | 250 |
| 557 | 3300047470 | Ga0495681_0018274 | Ga0495681_0018274_501_1259 | 250 |
| 558 | 3300047471 | Ga0495684_0172801 | Ga0495684_0172801_649_1407 | 250 |
| 559 | 3300047673 | Ga0495593_0003639 | Ga0495593_0003639_6791_7546 | 250 |
| 560 | 3300047673 | Ga0495593_0005185 | Ga0495593_0005185_1963_2721 | 250 |
| 561 | 3300048088 | Ga0495602_0044426 | Ga0495602_0044426_552_1310 | 250 |
| 562 | 3300048088 | Ga0495602_0048087 | Ga0495602_0048087_1260_2015 | 250 |
| 563 | 3300048089 | Ga0495614_0000841 | Ga0495614_0000841_35_790 | 250 |
| 564 | 3300048089 | Ga0495614_0124692 | Ga0495614_0124692_76_834 | 250 |
| 565 | 3300048091 | Ga0495626_0031029 | Ga0495626_0031029_45_803 | 250 |
| 566 | 3300049459 | Ga0495678_040733 | Ga0495678_040733_621_1379 | 250 |
| 567 | 3300049570 | Ga0501033_0016410 | Ga0501033_0016410_3497_4252 | 250 |
| 568 | 3300049574 | Ga0501038_0004886 | Ga0501038_0004886_8317_9072 | 250 |
| 569 | 3300049579 | Ga0501043_0234243 | Ga0501043_0234243_586_1341 | 250 |
| 570 | 3300049585 | Ga0501069_0234904 | Ga0501069_0234904_208_963 | 250 |
| 571 | 3300049587 | Ga0501071_0528061 | Ga0501071_0528061_125_880 | 250 |
| 572 | 3300049823 | Ga0501044_0129950 | Ga0501044_0129950_606_1361 | 250 |
| 573 | 3300050494 | nmdc:mga06z11_3522_c1 | nmdc:mga06z11_3522_c1_467_1222 | 250 |
| 574 | 3300050507 | nmdc:mga05p37_190442_c1 | nmdc:mga05p37_190442_c1_195_971 | 250 |
| 575 | 3300050509 | nmdc:mga0qj67_177337_c1 | nmdc:mga0qj67_177337_c1_417_1193 | 250 |
| 576 | 3300053078 | Ga0495612_0052942 | Ga0495612_0052942_301_1056 | 250 |
| 577 | 3300053083 | Ga0495655_0043695 | Ga0495655_0043695_82_837 | 250 |
| 578 | 3300053085 | Ga0495619_0236981 | Ga0495619_0236981_464_1219 | 250 |
| 579 | 3300053085 | Ga0495619_0254160 | Ga0495619_0254160_373_1128 | 250 |
| 580 | 3300053086 | Ga0500578_0095711 | Ga0500578_0095711_440_1195 | 250 |
| 581 | 3300053092 | Ga0500583_0077922 | Ga0500583_0077922_468_1223 | 250 |
| 582 | 3300053095 | Ga0500640_001432 | Ga0500640_001432_1496_2254 | 250 |
| 583 | 3300053095 | Ga0500640_090474 | Ga0500640_090474_234_989 | 250 |
| 584 | 3300053101 | Ga0500553_082981 | Ga0500553_082981_553_1308 | 250 |
| 585 | 3300053101 | Ga0500553_099182 | Ga0500553_099182_211_969 | 250 |
| 586 | 3300053107 | Ga0500560_108310 | Ga0500560_108310_53_808 | 250 |
| 587 | 3300053140 | Ga0500573_0069670 | Ga0500573_0069670_201_956 | 250 |
| 588 | iso_pu_bacteria | 2862382967 | 2862386815 | 250 |
| 589 | iso_pu_bacteria | 8008558824 | 8008560421 | 250 |
| 590 | 3300005539 | Ga0068853_100170450 | Ga0068853_1001704502 | 251 |
| 591 | 3300005539 | Ga0068853_100302113 | Ga0068853_1003021132 | 251 |
| 592 | 3300005563 | Ga0068855_100009579 | Ga0068855_10000957911 | 251 |
| 593 | 3300005578 | Ga0068854_100000781 | Ga0068854_1000007814 | 251 |
| 594 | 3300005614 | Ga0068856_100505448 | Ga0068856_1005054482 | 251 |
| 595 | 3300005616 | Ga0068852_100113891 | Ga0068852_1001138913 | 251 |
| 596 | 3300006847 | Ga0075431_100258992 | Ga0075431_1002589922 | 251 |
| 597 | 3300009093 | Ga0105240_10011484 | Ga0105240_100114845 | 251 |
| 598 | 3300009174 | Ga0105241_10003035 | Ga0105241_100030358 | 251 |
| 599 | 3300010375 | Ga0105239_10014794 | Ga0105239_100147944 | 251 |
| 600 | 3300013296 | Ga0157374_10122188 | Ga0157374_101221882 | 251 |
| 601 | 3300025904 | Ga0207647_10005686 | Ga0207647_100056867 | 251 |
| 602 | 3300025911 | Ga0207654_10003921 | Ga0207654_100039217 | 251 |
| 603 | 3300025913 | Ga0207695_10003004 | Ga0207695_100030046 | 251 |
| 604 | 3300025914 | Ga0207671_10000488 | Ga0207671_1000048835 | 251 |
| 605 | 3300025924 | Ga0207694_10001572 | Ga0207694_100015729 | 251 |
| 606 | 3300025942 | Ga0207689_10621902 | Ga0207689_106219022 | 251 |
| 607 | 3300025981 | Ga0207640_10010341 | Ga0207640_100103413 | 251 |
| 608 | 3300026041 | Ga0207639_10136666 | Ga0207639_101366662 | 251 |
| 609 | 3300026041 | Ga0207639_10146051 | Ga0207639_101460512 | 251 |
| 610 | 3300026067 | Ga0207678_10149752 | Ga0207678_101497522 | 251 |
| 611 | 3300026142 | Ga0207698_10028688 | Ga0207698_100286882 | 251 |
| 612 | 3300028379 | Ga0268266_10090348 | Ga0268266_100903482 | 251 |
| 613 | 3300028800 | Ga0265338_10054900 | Ga0265338_100549002 | 251 |
| 614 | 3300031241 | Ga0265325_10034084 | Ga0265325_100340843 | 251 |
| 615 | 3300031247 | Ga0265340_10002640 | Ga0265340_100026402 | 251 |
| 616 | 3300031249 | Ga0265339_10005353 | Ga0265339_100053539 | 251 |
| 617 | 3300041404 | Ga0439436_0005195 | Ga0439436_0005195_2410_3165 | 251 |
| 618 | 3300041406 | Ga0439439_0003420 | Ga0439439_0003420_2728_3483 | 251 |
| 619 | 3300042014 | Ga0439457_000307 | Ga0439457_000307_11760_12515 | 251 |
| 620 | 3300042131 | Ga0450894_000894 | Ga0450894_000894_2519_3328 | 251 |
| 621 | 3300042134 | Ga0450898_002540 | Ga0450898_002540_1021_1830 | 251 |
| 622 | 3300042145 | Ga0450906_000521 | Ga0450906_000521_741_1550 | 251 |
| 623 | 3300046455 | Ga0495603_0012311 | Ga0495603_0012311_3229_3993 | 251 |
| 624 | 3300046459 | Ga0495629_0131760 | Ga0495629_0131760_706_1470 | 251 |
| 625 | 3300046471 | Ga0495650_0028062 | Ga0495650_0028062_1455_2213 | 251 |
| 626 | 3300046471 | Ga0495650_0107007 | Ga0495650_0107007_69_827 | 251 |
| 627 | 3300046473 | Ga0495582_0057870 | Ga0495582_0057870_273_1037 | 251 |
| 628 | 3300046476 | Ga0495662_0011551 | Ga0495662_0011551_1341_2105 | 251 |
| 629 | 3300046499 | Ga0495594_0062842 | Ga0495594_0062842_1228_1992 | 251 |
| 630 | 3300046517 | Ga0495630_0400598 | Ga0495630_0400598_103_867 | 251 |
| 631 | 3300046660 | Ga0495625_0221413 | Ga0495625_0221413_99_872 | 251 |
| 632 | 3300046674 | Ga0495588_0005143 | Ga0495588_0005143_2768_3532 | 251 |
| 633 | 3300046675 | Ga0495657_0056586 | Ga0495657_0056586_1208_1972 | 251 |
| 634 | 3300046689 | Ga0495613_0017594 | Ga0495613_0017594_2535_3299 | 251 |
| 635 | 3300046689 | Ga0495613_0039155 | Ga0495613_0039155_2655_3419 | 251 |
| 636 | 3300047315 | Ga0495581_0038159 | Ga0495581_0038159_1229_1993 | 251 |
| 637 | 3300047315 | Ga0495581_0063538 | Ga0495581_0063538_565_1329 | 251 |
| 638 | 3300047318 | Ga0495636_0024149 | Ga0495636_0024149_360_1133 | 251 |
| 639 | 3300047443 | Ga0495687_068479 | Ga0495687_068479_543_1307 | 251 |
| 640 | 3300047472 | Ga0495686_0126084 | Ga0495686_0126084_566_1324 | 251 |
| 641 | 3300053077 | Ga0495601_0257853 | Ga0495601_0257853_17_784 | 251 |
| 642 | iso_pu_bacteria | 2990059506 | 2990066967 | 251 |
| 643 | 3300001989 | JGI24739J22299_10017128 | JGI24739J22299_100171282 | 252 |
| 644 | 3300002075 | JGI24738J21930_10009736 | JGI24738J21930_100097362 | 252 |
| 645 | 3300003316 | rootH1_10026697 | rootH1_100266973 | 252 |
| 646 | 3300005539 | Ga0068853_100095691 | Ga0068853_1000956914 | 252 |
| 647 | 3300005578 | Ga0068854_100054481 | Ga0068854_1000544813 | 252 |
| 648 | 3300005614 | Ga0068856_100213535 | Ga0068856_1002135352 | 252 |
| 649 | 3300005834 | Ga0068851_10297548 | Ga0068851_102975482 | 252 |
| 650 | 3300006048 | Ga0075363_100123438 | Ga0075363_1001234382 | 252 |
| 651 | 3300011119 | Ga0105246_10531960 | Ga0105246_105319602 | 252 |
| 652 | 3300015688 | Ga0183367_1011 | Ga0183367_101145 | 252 |
| 653 | 3300025904 | Ga0207647_10005581 | Ga0207647_100055814 | 252 |
| 654 | 3300025904 | Ga0207647_10010531 | Ga0207647_100105316 | 252 |
| 655 | 3300025981 | Ga0207640_10121888 | Ga0207640_101218882 | 252 |
| 656 | 3300026041 | Ga0207639_10177159 | Ga0207639_101771592 | 252 |
| 657 | 3300026078 | Ga0207702_10266430 | Ga0207702_102664302 | 252 |
| 658 | 3300028794 | Ga0307515_10250021 | Ga0307515_102500211 | 252 |
| 659 | 3300030522 | Ga0307512_10022842 | Ga0307512_100228425 | 252 |
| 660 | 3300031456 | Ga0307513_10010977 | Ga0307513_100109774 | 252 |
| 661 | 3300031616 | Ga0307508_10013835 | Ga0307508_100138354 | 252 |
| 662 | 3300031616 | Ga0307508_10030536 | Ga0307508_100305364 | 252 |
| 663 | 3300031649 | Ga0307514_10164558 | Ga0307514_101645582 | 252 |
| 664 | 3300031730 | Ga0307516_10402392 | Ga0307516_104023922 | 252 |
| 665 | 3300041404 | Ga0439436_0003837 | Ga0439436_0003837_324_1082 | 252 |
| 666 | 3300041406 | Ga0439439_0000121 | Ga0439439_0000121_817_1575 | 252 |
| 667 | 3300041512 | Ga0451853_1833064 | Ga0451853_1833064_512_1324 | 252 |
| 668 | 3300041999 | Ga0439433_0003165 | Ga0439433_0003165_543_1301 | 252 |
| 669 | 3300042007 | Ga0439449_0007982 | Ga0439449_0007982_2399_3157 | 252 |
| 670 | 3300042014 | Ga0439457_000111 | Ga0439457_000111_2263_3021 | 252 |
| 671 | 3300042015 | Ga0439462_0017760 | Ga0439462_0017760_812_1570 | 252 |
| 672 | 3300042127 | Ga0450890_006837 | Ga0450890_006837_676_1434 | 252 |
| 673 | 3300042131 | Ga0450894_000258 | Ga0450894_000258_5217_5975 | 252 |
| 674 | 3300042133 | Ga0450896_000218 | Ga0450896_000218_2349_3107 | 252 |
| 675 | 3300042134 | Ga0450898_000150 | Ga0450898_000150_5534_6292 | 252 |
| 676 | 3300042135 | Ga0450899_000083 | Ga0450899_000083_4660_5418 | 252 |
| 677 | 3300042136 | Ga0450900_012551 | Ga0450900_012551_143_901 | 252 |
| 678 | 3300042145 | Ga0450906_000331 | Ga0450906_000331_6193_6951 | 252 |
| 679 | 3300042157 | Ga0439458_0009838 | Ga0439458_0009838_1151_1924 | 252 |
| 680 | 3300042184 | Ga0450908_003549 | Ga0450908_003549_1519_2277 | 252 |
| 681 | 3300044719 | Ga0466971_0088403 | Ga0466971_0088403_288_1097 | 252 |
| 682 | 3300045049 | Ga0466959_0008239 | Ga0466959_0008239_1560_2369 | 252 |
| 683 | 3300046453 | Ga0495627_026909 | Ga0495627_026909_797_1603 | 252 |
| 684 | 3300046492 | Ga0495585_0153112 | Ga0495585_0153112_104_910 | 252 |
| 685 | 3300046522 | Ga0495643_0005450 | Ga0495643_0005450_5571_6377 | 252 |
| 686 | 3300046615 | Ga0495656_0042467 | Ga0495656_0042467_222_1028 | 252 |
| 687 | 3300046683 | Ga0495658_0009802 | Ga0495658_0009802_1163_1924 | 252 |
| 688 | 3300046794 | Ga0495589_0174134 | Ga0495589_0174134_13_819 | 252 |
| 689 | 3300047323 | Ga0495683_0042719 | Ga0495683_0042719_1260_2066 | 252 |
| 690 | 3300047443 | Ga0495687_005720 | Ga0495687_005720_2131_2892 | 252 |
| 691 | 3300047443 | Ga0495687_012644 | Ga0495687_012644_2580_3386 | 252 |
| 692 | 3300047443 | Ga0495687_127269 | Ga0495687_127269_65_871 | 252 |
| 693 | 3300047447 | Ga0495685_004021 | Ga0495685_004021_14_820 | 252 |
| 694 | 3300047470 | Ga0495681_0003555 | Ga0495681_0003555_1994_2800 | 252 |
| 695 | 3300048916 | Ga0496113_0383910 | Ga0496113_0383910_346_1104 | 252 |
| 696 | 3300049586 | Ga0501070_0642175 | Ga0501070_0642175_21_833 | 252 |
| 697 | 3300050490 | nmdc:mga03n38_59632_c1 | nmdc:mga03n38_59632_c1_430_1188 | 252 |
| 698 | 3300053083 | Ga0495655_0009402 | Ga0495655_0009402_971_1732 | 252 |
| 699 | 3300053086 | Ga0500578_0028597 | Ga0500578_0028597_2312_3118 | 252 |
| 700 | 3300053099 | Ga0500654_093215 | Ga0500654_093215_440_1246 | 252 |
| 701 | 3300053100 | Ga0500660_090749 | Ga0500660_090749_176_982 | 252 |
| 702 | 3300053101 | Ga0500553_101657 | Ga0500553_101657_374_1135 | 252 |
| 703 | 3300053107 | Ga0500560_005769 | Ga0500560_005769_573_1334 | 252 |
| 704 | 3300053109 | Ga0500569_001328 | Ga0500569_001328_995_1801 | 252 |
| 705 | 3300053113 | Ga0500580_047549 | Ga0500580_047549_969_1730 | 252 |
| 706 | 3300053126 | Ga0500621_091258 | Ga0500621_091258_87_893 | 252 |
| 707 | 3300053129 | Ga0500628_000785 | Ga0500628_000785_3860_4666 | 252 |
| 708 | 3300053131 | Ga0500652_012391 | Ga0500652_012391_586_1392 | 252 |
| 709 | 3300053134 | Ga0500658_0011811 | Ga0500658_0011811_1827_2633 | 252 |
| 710 | 3300053137 | Ga0500561_0009872 | Ga0500561_0009872_13_819 | 252 |
| 711 | 3300053140 | Ga0500573_0017609 | Ga0500573_0017609_2681_3442 | 252 |
| 712 | 3300053143 | Ga0500579_029352 | Ga0500579_029352_1765_2571 | 252 |
| 713 | 3300053149 | Ga0500600_0027671 | Ga0500600_0027671_1068_1874 | 252 |
| 714 | 3300053153 | Ga0500616_0004587 | Ga0500616_0004587_3461_4267 | 252 |
| 715 | 3300053160 | Ga0500633_0026027 | Ga0500633_0026027_586_1392 | 252 |
| 716 | 3300053161 | Ga0500634_0041823 | Ga0500634_0041823_459_1265 | 252 |
| 717 | 3300053739 | Ga0500587_001195 | Ga0500587_001195_42_848 | 252 |
| 718 | 3300061719 | Ga0466962_0009988 | Ga0466962_0009988_1322_2131 | 252 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4dqx-assembly1.cif.gz_A | crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 | 0.9649 | 1 | 242 |
| 2d1y-assembly1.cif.gz_C | crystal structure of tt0321 from thermus thermophilus hb8 | 0.959 | 3 | 241 |
| 3sju-assembly1.cif.gz_A | hedamycin polyketide ketoreductase bound to nadph | 0.9572 | 8 | 244 |
| 6ffb-assembly1.cif.gz_A | 17beta-hydroxysteroid dehydrogenase 14 variant s205 - mutant q148a - in complex with a nonsteroidal inhibitor | 0.9541 | 1 | 245 |
| 4yqz-assembly1.cif.gz_B | crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form | 0.9539 | 1 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.959 | 4 | 174 | 3.40.50.720 |
| 2d1yC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.959 | 3 | 241 | 3.40.50.720 |
| af_Q54N15_5_159_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9577 | 50 | 169 | 3.40.50.720 |
| 4yqzB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9523 | 4 | 241 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9518 | 4 | 186 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X4HYD4-F1-model_v4 | Short-chain dehydrogenase | 0.9987 | 1 | 222 |
GO:0016491
|
| AF-A0A6I3FNJ5-F1-model_v4 | SDR family oxidoreductase | 0.997 | 74 | 248 |
GO:0016491
|
| AF-A0A345XXH1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9969 | 2 | 252 |
GO:0016491
|
| AF-A0A2N0EMC4-F1-model_v4 | deleted | 0.9967 | 1 | 249 |
|
| AF-A0A367EHH1-F1-model_v4 | SDR family NAD(P)-dependent oxidoreductase | 0.9954 | 3 | 251 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar