F477206

General Info

Members Datasets Scaffolds Average Seq Length
718 406 647 249

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2966598605|2966604224
Length 257
Sequence RDFEGLSALVTGGASGIGAAVAAQLLTRGARVAVLDLDPEGAPAGCLALRADVTDDDAVRDAVERAAAGLGGLHTVVSNAGIGSIGTVEDNADEEWTRVLDLNVLGMVRTARHALPHLRRAAAARPGAVSITQTCSIAATAGLPQRALYSASKGAVLSLTLAMAADHVREGIRVNCVNPGTADTPWIGRLLGQAEDPAAERAALDARQPLGRLVSADEVAAAVLYLASPAAASVTGTALAVDGGMQGLRLRPAPPRG

Samples

Sample ID Description Type Environment
1 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
2 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
3 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
4 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
5 2643221548 Streptomyces sp. Root55 Isolate Unclassified
6 2643221578 Streptomyces sp. Root63 Isolate Unclassified
7 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
10 2643221714 Streptomyces sp. Root264 Isolate Unclassified
11 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
12 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
17 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
18 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
19 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
20 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
21 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
22 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
23 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
24 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
25 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
26 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
27 2867428634 Streptomyces sp. RP5T Isolate Unclassified
28 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
29 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
30 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
31 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
32 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
33 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
34 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
35 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
36 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
37 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
38 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
39 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
40 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
41 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
42 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
43 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
44 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
45 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
46 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
47 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
48 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
49 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
50 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
51 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
52 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
53 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
54 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
55 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
56 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
57 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
58 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
59 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
60 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
61 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
62 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
63 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
64 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
65 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
67 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
68 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
73 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
74 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
75 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
76 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
111 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
126 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
168 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
172 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
197 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
216 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
217 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
218 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
219 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
220 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
227 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
228 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
229 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
230 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
231 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
232 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
233 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
234 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
235 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
236 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
237 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
238 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
241 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
264 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
274 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
279 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
280 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
292 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
293 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
294 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
322 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
323 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
324 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
327 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
328 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
337 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
338 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
339 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
340 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
341 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
342 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
343 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
367 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
370 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
378 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
381 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
382 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
383 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
384 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
385 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
386 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
387 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
388 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
389 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
390 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
391 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
392 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
393 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
394 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
395 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
396 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
397 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
398 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
399 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
400 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
403 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
404 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
405 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
406 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.83
Metatranscriptomes 0.28
Isolates 9.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 0.42
Rhizoplane 3.48
Rhizosphere 78.97
Stem 0
Stem Tuber 0.14
Unclassified 10.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017128 3300001989 Bacteria 2617
2 JGI24739J22299_10042956 3300001989 Bacteria 1497
3 JGI24739J22299_10049648 3300001989 Bacteria 1360
4 JGI24738J21930_10009736 3300002075 Bacteria 2155
5 JGI25152J39213_1000109 3300002773 Bacteria 57724
6 JGI25406J46586_10041231 3300003203 Bacteria 1627
7 JGI25406J46586_10059721 3300003203 Bacteria 1237
8 rootH1_10005650 3300003316 Bacteria 2366
9 rootH1_10026697 3300003316 Bacteria 4176
10 rootH1_10055768 3300003316 Bacteria 7296
11 rootL2_10001330 3300003322 Bacteria 4188
12 rootH1_10015077 3300003323 Bacteria 5583
13 rootH1_10015078 3300003323 Bacteria 3268
14 Ga0070683_100115720 3300005329 Bacteria 2531
15 Ga0070683_100370914 3300005329 Bacteria 1363
16 Ga0070683_100846362 3300005329 Bacteria 877
17 Ga0068869_100123209 3300005334 Bacteria 1985
18 Ga0070680_100018278 3300005336 Bacteria 5537
19 Ga0070680_100065815 3300005336 Bacteria 2971
20 Ga0070682_100051982 3300005337 Bacteria 2563
21 Ga0070682_100268051 3300005337 Bacteria 1239
22 Ga0070660_100044202 3300005339 Bacteria 3406
23 Ga0070675_100392966 3300005354 Bacteria 1236
24 Ga0070709_10012890 3300005434 Bacteria 4685
25 Ga0070709_10052893 3300005434 Bacteria 2555
26 Ga0070709_10167460 3300005434 Bacteria 1533
27 Ga0070714_100051600 3300005435 Bacteria 3507
28 Ga0070714_100090715 3300005435 Bacteria 2677
29 Ga0070714_100226882 3300005435 Bacteria 1719
30 Ga0070713_100014860 3300005436 Bacteria 5795
31 Ga0070713_100103696 3300005436 Bacteria 2468
32 Ga0070713_100157475 3300005436 Bacteria 2025
33 Ga0070713_100236426 3300005436 Bacteria 1662
34 Ga0070713_100504083 3300005436 Bacteria 1142
35 Ga0070710_10004386 3300005437 Bacteria 6683
36 Ga0070710_10032628 3300005437 Unclassified 2822
37 Ga0070710_10064158 3300005437 Unclassified 2100
38 Ga0070711_100016186 3300005439 Bacteria 4732
39 Ga0070678_100075137 3300005456 Bacteria 2542
40 Ga0070681_10073741 3300005458 Bacteria 3375
41 Ga0070706_100262720 3300005467 Bacteria 1611
42 Ga0070707_100066294 3300005468 Bacteria 3470
43 Ga0070698_100009228 3300005471 Bacteria 10585
44 Ga0070699_100076467 3300005518 Bacteria 2914
45 Ga0070684_100065285 3300005535 Bacteria 3194
46 Ga0070684_100321456 3300005535 Bacteria 1421
47 Ga0068853_100095691 3300005539 Bacteria 2619
48 Ga0068853_100170450 3300005539 Bacteria 1969
49 Ga0068853_100302113 3300005539 Bacteria 1480
50 Ga0070672_100122245 3300005543 Bacteria 2132
51 Ga0070665_100111970 3300005548 Bacteria 2732
52 Ga0070665_100217797 3300005548 Bacteria 1910
53 Ga0068855_100009579 3300005563 Bacteria 11688
54 Ga0068855_100439186 3300005563 Bacteria 1425
55 Ga0068857_100627876 3300005577 Bacteria 1017
56 Ga0068857_100687266 3300005577 Bacteria 972
57 Ga0068854_100000781 3300005578 Bacteria 18916
58 Ga0068854_100054481 3300005578 Bacteria 2876
59 Ga0068856_100213535 3300005614 Bacteria 1945
60 Ga0068856_100502046 3300005614 Bacteria 1234
61 Ga0068856_100505448 3300005614 Bacteria 1230
62 Ga0068852_100113891 3300005616 Bacteria 2463
63 Ga0068852_100150038 3300005616 Bacteria 2167
64 Ga0068852_100197985 3300005616 Bacteria 1900
65 Ga0068851_10297548 3300005834 Bacteria 927
66 Ga0081455_10001079 3300005937 Bacteria 34337
67 Ga0081540_1002232 3300005983 Bacteria 15955
68 Ga0081539_10001103 3300005985 Bacteria 49011
69 Ga0081539_10003736 3300005985 Bacteria 18107
70 Ga0081539_10022636 3300005985 Bacteria 4148
71 Ga0081539_10038322 3300005985 Bacteria 2842
72 Ga0081539_10064219 3300005985 Bacteria 1999
73 Ga0070717_10241001 3300006028 Bacteria 1595
74 Ga0070717_10288394 3300006028 Bacteria 1457
75 Ga0075365_10101617 3300006038 Bacteria 1969
76 Ga0075368_10005280 3300006042 Bacteria 4434
77 Ga0075363_100123438 3300006048 Bacteria 1448
78 Ga0075363_100141625 3300006048 Bacteria 1354
79 Ga0075364_10130113 3300006051 Bacteria 1689
80 Ga0070716_100034547 3300006173 Bacteria 2773
81 Ga0070712_100005494 3300006175 Bacteria 7847
82 Ga0075367_10005258 3300006178 Bacteria 6399
83 Ga0075367_10078717 3300006178 Bacteria 1991
84 Ga0075430_100035704 3300006846 Bacteria 4216
85 Ga0075431_100005354 3300006847 Bacteria 12664
86 Ga0075431_100258992 3300006847 Bacteria 1766
87 Ga0075431_100485878 3300006847 Bacteria 1227
88 Ga0075429_100035883 3300006880 Bacteria 4312
89 Ga0099826_10049670 3300006948 Bacteria 2828
90 Ga0105244_10006177 3300009036 Bacteria 7813
91 Ga0105244_10054056 3300009036 Bacteria 2038
92 Ga0105240_10011484 3300009093 Bacteria 12333
93 Ga0114129_10000681 3300009147 Bacteria 42861
94 Ga0105243_10009399 3300009148 Bacteria 7450
95 Ga0105241_10003035 3300009174 Bacteria 12527
96 Ga0105249_10264363 3300009553 Bacteria 1711
97 Ga0105239_10014794 3300010375 Bacteria 8654
98 Ga0105239_10131203 3300010375 Bacteria 2787
99 Ga0105246_10043073 3300011119 Bacteria 3061
100 Ga0105246_10531960 3300011119 Bacteria 1004
101 Ga0105246_10602434 3300011119 Bacteria 950
102 Ga0157370_10057608 3300013104 Bacteria 3693
103 Ga0157369_10114233 3300013105 Bacteria 2868
104 Ga0157369_10129576 3300013105 Bacteria 2674
105 Ga0157369_10457542 3300013105 Bacteria 1321
106 Ga0157374_10122188 3300013296 Bacteria 2514
107 Ga0157372_10137066 3300013307 Bacteria 2819
108 Ga0157372_10360691 3300013307 Bacteria 1693
109 Ga0182008_10000552 3300014497 Bacteria 27794
110 Ga0182008_10000777 3300014497 Bacteria 22348
111 Ga0182007_10000554 3300015262 Bacteria 22069
112 Ga0182007_10000661 3300015262 Bacteria 19773
113 Ga0183367_1011 3300015688 Bacteria 397353
114 Ga0183367_1016 3300015688 Bacteria 290198
115 Ga0206356_10357540 3300020070 Bacteria 1423
116 Ga0224712_10091684 3300022467 Bacteria 1274
117 Ga0209129_1000180 3300025258 Bacteria 90882
118 Ga0209025_1001362 3300025294 Bacteria 32778
119 Ga0209051_1004857 3300025303 Bacteria 8079
120 Ga0207697_10004439 3300025315 Bacteria 6702
121 Ga0207692_10005516 3300025898 Bacteria 5075
122 Ga0207692_10121735 3300025898 Unclassified 1462
123 Ga0207647_10005581 3300025904 Bacteria 9201
124 Ga0207647_10005686 3300025904 Bacteria 9103
125 Ga0207647_10010531 3300025904 Bacteria 6527
126 Ga0207647_10013528 3300025904 Bacteria 5651
127 Ga0207647_10032455 3300025904 Bacteria 3354
128 Ga0207647_10090575 3300025904 Bacteria 1824
129 Ga0207647_10096689 3300025904 Bacteria 1757
130 Ga0207699_10003554 3300025906 Bacteria 7436
131 Ga0207699_10281098 3300025906 Bacteria 1156
132 Ga0207705_10313041 3300025909 Bacteria 1205
133 Ga0207654_10003921 3300025911 Bacteria 7491
134 Ga0207707_10050349 3300025912 Bacteria 3629
135 Ga0207695_10003004 3300025913 Bacteria 24248
136 Ga0207671_10000488 3300025914 Bacteria 53807
137 Ga0207693_10012884 3300025915 Bacteria 6748
138 Ga0207693_10022336 3300025915 Bacteria 5028
139 Ga0207693_10051422 3300025915 Bacteria 3233
140 Ga0207663_10060410 3300025916 Bacteria 2402
141 Ga0207663_10214767 3300025916 Bacteria 1396
142 Ga0207660_10064154 3300025917 Bacteria 2650
143 Ga0207657_10025688 3300025919 Bacteria 5425
144 Ga0207657_10112922 3300025919 Bacteria 2242
145 Ga0207646_10106023 3300025922 Bacteria 2521
146 Ga0207694_10001572 3300025924 Bacteria 19329
147 Ga0207700_10007329 3300025928 Bacteria 6735
148 Ga0207700_10046153 3300025928 Bacteria 3220
149 Ga0207700_10078808 3300025928 Bacteria 2564
150 Ga0207700_10086278 3300025928 Bacteria 2466
151 Ga0207700_10138432 3300025928 Bacteria 1997
152 Ga0207664_10012624 3300025929 Bacteria 6044
153 Ga0207664_10125027 3300025929 Bacteria 2158
154 Ga0207664_10342427 3300025929 Bacteria 1322
155 Ga0207664_10731517 3300025929 Bacteria 890
156 Ga0207690_10098864 3300025932 Bacteria 2079
157 Ga0207706_10051112 3300025933 Bacteria 3651
158 Ga0207665_10045607 3300025939 Bacteria 2935
159 Ga0207665_10135810 3300025939 Bacteria 1750
160 Ga0207689_10180457 3300025942 Bacteria 1741
161 Ga0207689_10621902 3300025942 Bacteria 909
162 Ga0207661_10027634 3300025944 Bacteria 4336
163 Ga0207661_10188297 3300025944 Bacteria 1808
164 Ga0207661_10250823 3300025944 Bacteria 1573
165 Ga0207667_10293489 3300025949 Bacteria 1661
166 Ga0207640_10010341 3300025981 Bacteria 5254
167 Ga0207640_10121888 3300025981 Bacteria 1870
168 Ga0207640_10145475 3300025981 Bacteria 1734
169 Ga0207677_10217350 3300026023 Bacteria 1530
170 Ga0207639_10136666 3300026041 Bacteria 2037
171 Ga0207639_10146051 3300026041 Bacteria 1976
172 Ga0207639_10177159 3300026041 Bacteria 1811
173 Ga0207678_10007418 3300026067 Bacteria 9711
174 Ga0207678_10081725 3300026067 Bacteria 2766
175 Ga0207678_10149752 3300026067 Bacteria 1992
176 Ga0207678_10564727 3300026067 Bacteria 996
177 Ga0207708_10107363 3300026075 Bacteria 2165
178 Ga0207702_10266430 3300026078 Bacteria 1615
179 Ga0207702_10525361 3300026078 Bacteria 1156
180 Ga0207674_10037961 3300026116 Bacteria 5003
181 Ga0207674_10298506 3300026116 Bacteria 1560
182 Ga0207674_10479038 3300026116 Bacteria 1203
183 Ga0207675_100702086 3300026118 Bacteria 1021
184 Ga0207683_10054399 3300026121 Bacteria 3510
185 Ga0207698_10028688 3300026142 Bacteria 3973
186 Ga0207698_10152830 3300026142 Bacteria 2006
187 Ga0207698_10632428 3300026142 Bacteria 1058
188 Ga0209371_1021303 3300027312 Bacteria 1574
189 Ga0209813_10120765 3300027866 Bacteria 912
190 Ga0268266_10090348 3300028379 Bacteria 2684
191 Ga0268266_10094709 3300028379 Bacteria 2622
192 Ga0268266_10532855 3300028379 Bacteria 1124
193 Ga0265337_1000230 3300028556 Bacteria 30116
194 Ga0265326_10001838 3300028558 Bacteria 7291
195 Ga0265319_1001673 3300028563 Bacteria 12805
196 Ga0265334_10000178 3300028573 Bacteria 37532
197 Ga0265334_10041226 3300028573 Bacteria 1805
198 Ga0265322_10014316 3300028654 Bacteria 2292
199 Ga0265336_10003119 3300028666 Bacteria 6590
200 Ga0265336_10003740 3300028666 Bacteria 5890
201 Ga0307517_10018152 3300028786 Bacteria 9117
202 Ga0307515_10010304 3300028794 Bacteria 17938
203 Ga0307515_10074461 3300028794 Bacteria 4542
204 Ga0307515_10250021 3300028794 Bacteria 1527
205 Ga0265338_10000683 3300028800 Bacteria 58337
206 Ga0265338_10054900 3300028800 Bacteria 3548
207 Ga0265324_10006327 3300029957 Bacteria 4962
208 Ga0265324_10009973 3300029957 Bacteria 3688
209 Ga0307511_10000672 3300030521 Bacteria 36429
210 Ga0307512_10000801 3300030522 Bacteria 46484
211 Ga0307512_10022842 3300030522 Bacteria 5605
212 Ga0265332_10020655 3300031238 Bacteria 2907
213 Ga0265332_10050673 3300031238 Bacteria 1784
214 Ga0265320_10007740 3300031240 Bacteria 6640
215 Ga0265325_10034084 3300031241 Bacteria 2712
216 Ga0265340_10001938 3300031247 Bacteria 11824
217 Ga0265340_10002640 3300031247 Bacteria 10187
218 Ga0265339_10005353 3300031249 Bacteria 8546
219 Ga0265339_10196402 3300031249 Bacteria 997
220 Ga0265331_10014814 3300031250 Bacteria 4137
221 Ga0265316_10015012 3300031344 Bacteria 6791
222 Ga0307513_10001986 3300031456 Bacteria 28948
223 Ga0307513_10010977 3300031456 Bacteria 11301
224 Ga0307513_10031680 3300031456 Bacteria 5983
225 Ga0307509_10006518 3300031507 Bacteria 15655
226 Ga0307509_10011002 3300031507 Bacteria 11025
227 Ga0307509_10024641 3300031507 Bacteria 6734
228 Ga0307509_10035479 3300031507 Bacteria 5473
229 Ga0307509_10138169 3300031507 Bacteria 2378
230 Ga0265313_10004009 3300031595 Bacteria 11526
231 Ga0307508_10004718 3300031616 Bacteria 13199
232 Ga0307508_10013835 3300031616 Bacteria 7363
233 Ga0307508_10030536 3300031616 Bacteria 4871
234 Ga0307514_10005174 3300031649 Bacteria 11764
235 Ga0307514_10008786 3300031649 Bacteria 8554
236 Ga0307514_10101916 3300031649 Bacteria 2059
237 Ga0307514_10164558 3300031649 Bacteria 1462
238 Ga0265314_10010641 3300031711 Bacteria 7654
239 Ga0265342_10001496 3300031712 Bacteria 21649
240 Ga0265342_10049373 3300031712 Bacteria 2518
241 Ga0307516_10000841 3300031730 Bacteria 42119
242 Ga0307516_10059569 3300031730 Bacteria 3713
243 Ga0307516_10402392 3300031730 Bacteria 1028
244 Ga0307405_10049965 3300031731 Bacteria 2587
245 Ga0307413_10023094 3300031824 Bacteria 3366
246 Ga0307413_10113689 3300031824 Bacteria 1818
247 Ga0307518_10092157 3300031838 Bacteria 2179
248 Ga0307410_10295621 3300031852 Bacteria 1276
249 Ga0307410_10545948 3300031852 Bacteria 960
250 Ga0307410_10693820 3300031852 Bacteria 857
251 Ga0307409_100237851 3300031995 Bacteria 1656
252 Ga0307409_100247022 3300031995 Bacteria 1629
253 Ga0307409_100302300 3300031995 Bacteria 1489
254 Ga0307409_100532770 3300031995 Bacteria 1150
255 Ga0307409_100770785 3300031995 Bacteria 967
256 Ga0307416_100192175 3300032002 Bacteria 1927
257 Ga0307415_100025726 3300032126 Bacteria 3700
258 Ga0307415_100266671 3300032126 Bacteria 1400
259 Ga0307507_10030151 3300033179 Bacteria 5726
260 Ga0307507_10060126 3300033179 Bacteria 3550
261 Ga0307507_10094661 3300033179 Bacteria 2537
262 Ga0307507_10163834 3300033179 Bacteria 1635
263 Ga0307510_10006065 3300033180 Bacteria 14405
264 Ga0307510_10057502 3300033180 Bacteria 4036
265 Ga0307510_10075977 3300033180 Bacteria 3307
266 Ga0307510_10130210 3300033180 Bacteria 2192
267 Ga0307510_10141332 3300033180 Bacteria 2050
268 Ga0373934_0031420 3300035086 Bacteria 2079
269 Ga0373944_0073491 3300035089 Bacteria 1118
270 Ga0373936_0010500 3300035113 Bacteria 3495
271 Ga0373954_0057351 3300035118 Bacteria 1834
272 Ga0373957_0085254 3300035120 Bacteria 1250
273 Ga0373955_0029602 3300035172 Bacteria 2849
274 Ga0373924_0011618 3300035410 Bacteria 3274
275 Ga0373935_0146614 3300035692 Bacteria 1598
276 Ga0373933_0016144 3300035724 Bacteria 4172
277 Ga0373925_0006443 3300037068 Bacteria 8639
278 Ga0395900_0231452 3300037418 Bacteria 1858
279 Ga0395898_0007719 3300037466 Bacteria 11421
280 Ga0395898_0036977 3300037466 Bacteria 4845
281 Ga0439436_0003837 3300041404 Bacteria 4602
282 Ga0439436_0004109 3300041404 Bacteria 4461
283 Ga0439436_0005195 3300041404 Bacteria 3991
284 Ga0439436_0015754 3300041404 Bacteria 2271
285 Ga0439438_071793 3300041405 Bacteria 856
286 Ga0439439_0000121 3300041406 Bacteria 10896
287 Ga0439439_0003420 3300041406 Bacteria 3500
288 Ga0439439_0010864 3300041406 Bacteria 2183
289 Ga0439439_0072405 3300041406 Bacteria 924
290 Ga0451797_0640309 3300041453 Bacteria 1371
291 Ga0451795_1034354 3300041456 Bacteria 3727
292 Ga0451800_0421651 3300041459 Bacteria 2013
293 Ga0451802_1768030 3300041460 Bacteria 1004
294 Ga0451853_1223826 3300041512 Bacteria 2013
295 Ga0451853_1833064 3300041512 Bacteria 2049
296 Ga0439433_0003165 3300041999 Bacteria 3525
297 Ga0439433_0007013 3300041999 Bacteria 2432
298 Ga0439448_0011705 3300042005 Bacteria 2616
299 Ga0439448_0017640 3300042005 Bacteria 2181
300 Ga0439448_0090220 3300042005 Bacteria 1035
301 Ga0439449_0007982 3300042007 Bacteria 4021
302 Ga0439449_0012598 3300042007 Bacteria 3181
303 Ga0439449_0015988 3300042007 Bacteria 2820
304 Ga0439450_067692 3300042008 Bacteria 872
305 Ga0439457_000111 3300042014 Bacteria 19558
306 Ga0439457_000307 3300042014 Bacteria 13539
307 Ga0439457_000998 3300042014 Bacteria 8532
308 Ga0439462_0017760 3300042015 Bacteria 1843
309 Ga0450890_006837 3300042127 Bacteria 1455
310 Ga0450894_000148 3300042131 Bacteria 12360
311 Ga0450894_000258 3300042131 Bacteria 9518
312 Ga0450894_000894 3300042131 Bacteria 4749
313 Ga0450895_006859 3300042132 Bacteria 937
314 Ga0450896_000218 3300042133 Bacteria 5111
315 Ga0450898_000150 3300042134 Bacteria 7018
316 Ga0450898_000188 3300042134 Bacteria 6552
317 Ga0450898_002540 3300042134 Bacteria 2555
318 Ga0450899_000083 3300042135 Bacteria 7979
319 Ga0450900_012551 3300042136 Bacteria 1112
320 Ga0450903_000204 3300042138 Bacteria 13059
321 Ga0450903_011561 3300042138 Bacteria 1420
322 Ga0450906_000040 3300042145 Bacteria 21045
323 Ga0450906_000331 3300042145 Bacteria 9635
324 Ga0450906_000521 3300042145 Bacteria 8089
325 Ga0439458_0000476 3300042157 Bacteria 10265
326 Ga0439458_0003238 3300042157 Bacteria 3849
327 Ga0439458_0009838 3300042157 Bacteria 2129
328 Ga0450908_003549 3300042184 Bacteria 3039
329 Ga0450908_010342 3300042184 Bacteria 1722
330 Ga0439440_0016019 3300042993 Bacteria 1635
331 Ga0466969_0002669 3300044656 Bacteria 9533
332 Ga0466972_0000744 3300044658 Bacteria 15520
333 Ga0466972_0036878 3300044658 Bacteria 2390
334 Ga0466965_0001152 3300044683 Bacteria 10396
335 Ga0466966_0006589 3300044684 Bacteria 7690
336 Ga0466966_0011651 3300044684 Bacteria 5828
337 Ga0466961_0001075 3300044693 Bacteria 16849
338 Ga0466961_0009383 3300044693 Bacteria 6234
339 Ga0466961_0527404 3300044693 Bacteria 712
340 Ga0466963_0010946 3300044694 Bacteria 5512
341 Ga0466963_0036954 3300044694 Bacteria 3187
342 Ga0466963_0037174 3300044694 Bacteria 3178
343 Ga0466963_0078485 3300044694 Bacteria 2232
344 Ga0466963_0122264 3300044694 Bacteria 1792
345 Ga0466964_0002075 3300044706 Bacteria 7048
346 Ga0466964_0150537 3300044706 Bacteria 1078
347 Ga0466971_0000151 3300044719 Bacteria 25764
348 Ga0466971_0010618 3300044719 Bacteria 4026
349 Ga0466971_0032982 3300044719 Bacteria 2320
350 Ga0466971_0088403 3300044719 Bacteria 1417
351 Ga0466968_0033531 3300044735 Bacteria 2140
352 Ga0466970_0025639 3300044765 Bacteria 3088
353 Ga0466970_0078037 3300044765 Bacteria 1786
354 Ga0466957_0102866 3300044842 Bacteria 1802
355 Ga0466960_0009435 3300044901 Bacteria 4022
356 Ga0466960_0144681 3300044901 Bacteria 1265
357 Ga0466959_0002709 3300045049 Bacteria 11383
358 Ga0466959_0008239 3300045049 Bacteria 7357
359 Ga0466959_0049610 3300045049 Bacteria 3084
360 Ga0466959_0089831 3300045049 Bacteria 2207
361 Ga0466959_0108116 3300045049 Bacteria 1987
362 Ga0466958_0008107 3300045836 Bacteria 5812
363 Ga0466958_0027439 3300045836 Bacteria 3370
364 Ga0466958_0058276 3300045836 Bacteria 2348
365 Ga0466967_0002421 3300045976 Bacteria 11598
366 Ga0466967_0041393 3300045976 Bacteria 3972
367 Ga0466967_0063721 3300045976 Bacteria 3276
368 Ga0466967_0087334 3300045976 Bacteria 2827
369 Ga0466967_0255378 3300045976 Bacteria 1675
370 Ga0466967_0621733 3300045976 Bacteria 1067
371 Ga0495627_026909 3300046453 Bacteria 1850
372 Ga0495592_0011446 3300046454 Bacteria 6712
373 Ga0495592_0012776 3300046454 Bacteria 6383
374 Ga0495592_0130734 3300046454 Bacteria 1756
375 Ga0495603_0012311 3300046455 Bacteria 5177
376 Ga0495629_0014036 3300046459 Bacteria 5772
377 Ga0495629_0015196 3300046459 Bacteria 5531
378 Ga0495629_0025807 3300046459 Bacteria 4175
379 Ga0495629_0131760 3300046459 Bacteria 1741
380 Ga0495629_0371008 3300046459 Bacteria 975
381 Ga0495638_0075194 3300046460 Bacteria 2059
382 Ga0495651_0001705 3300046462 Bacteria 16969
383 Ga0495651_0002959 3300046462 Bacteria 13126
384 Ga0495651_0004042 3300046462 Bacteria 11214
385 Ga0495653_0021618 3300046463 Bacteria 5211
386 Ga0495650_0028062 3300046471 Bacteria 2591
387 Ga0495650_0028239 3300046471 Bacteria 2580
388 Ga0495650_0107007 3300046471 Bacteria 1043
389 Ga0495580_0046716 3300046472 Bacteria 3071
390 Ga0495580_0182859 3300046472 Bacteria 1447
391 Ga0495582_0057870 3300046473 Bacteria 2137
392 Ga0495605_0120762 3300046474 Bacteria 1188
393 Ga0495639_0126083 3300046475 Bacteria 1224
394 Ga0495639_0136025 3300046475 Bacteria 1179
395 Ga0495662_0000534 3300046476 Bacteria 17425
396 Ga0495662_0011551 3300046476 Bacteria 4316
397 Ga0495662_0090320 3300046476 Bacteria 1493
398 Ga0495662_0092381 3300046476 Bacteria 1476
399 Ga0495664_0000617 3300046477 Bacteria 18040
400 Ga0495664_0003610 3300046477 Bacteria 8435
401 Ga0495664_0159761 3300046477 Bacteria 1367
402 Ga0495585_0022960 3300046492 Bacteria 3580
403 Ga0495585_0153112 3300046492 Bacteria 1201
404 Ga0495594_0008240 3300046499 Bacteria 5363
405 Ga0495594_0034337 3300046499 Bacteria 2759
406 Ga0495594_0062842 3300046499 Bacteria 2056
407 Ga0495596_0014822 3300046500 Bacteria 3279
408 Ga0495596_0035274 3300046500 Bacteria 1984
409 Ga0495583_0006789 3300046506 Bacteria 7397
410 Ga0495583_0064824 3300046506 Bacteria 1619
411 Ga0495583_0072513 3300046506 Bacteria 1511
412 Ga0495606_0007389 3300046507 Bacteria 9853
413 Ga0495608_0036891 3300046511 Bacteria 3288
414 Ga0495608_0211865 3300046511 Bacteria 1218
415 Ga0495610_0059901 3300046512 Bacteria 1815
416 Ga0495616_0018556 3300046513 Bacteria 3816
417 Ga0495618_0218426 3300046514 Bacteria 1203
418 Ga0495620_0010158 3300046515 Bacteria 4973
419 Ga0495628_0004349 3300046516 Bacteria 12569
420 Ga0495628_0036786 3300046516 Bacteria 3926
421 Ga0495628_0071763 3300046516 Bacteria 2698
422 Ga0495628_0100719 3300046516 Bacteria 2230
423 Ga0495628_0220511 3300046516 Bacteria 1424
424 Ga0495630_0169651 3300046517 Bacteria 1662
425 Ga0495630_0400598 3300046517 Bacteria 1051
426 Ga0495630_0413688 3300046517 Bacteria 1033
427 Ga0495631_0003534 3300046518 Bacteria 8542
428 Ga0495637_0019780 3300046520 Bacteria 3108
429 Ga0495643_0005450 3300046522 Bacteria 8605
430 Ga0495643_0010819 3300046522 Bacteria 5593
431 Ga0495648_0037742 3300046524 Bacteria 3100
432 Ga0495648_0070367 3300046524 Bacteria 2033
433 Ga0495652_0001214 3300046529 Bacteria 28869
434 Ga0495652_0004196 3300046529 Bacteria 13871
435 Ga0495652_0031801 3300046529 Bacteria 4619
436 Ga0495654_0162063 3300046530 Bacteria 981
437 Ga0495665_0199212 3300046531 Bacteria 1038
438 Ga0495640_0014013 3300046533 Bacteria 6084
439 Ga0495640_0040118 3300046533 Bacteria 3279
440 Ga0495586_0020844 3300046535 Bacteria 3492
441 Ga0495586_0039468 3300046535 Bacteria 2538
442 Ga0495586_0067886 3300046535 Bacteria 1945
443 Ga0495587_0003123 3300046536 Bacteria 11081
444 Ga0495587_0037947 3300046536 Bacteria 2891
445 Ga0495587_0067962 3300046536 Bacteria 2076
446 Ga0495609_0006276 3300046538 Bacteria 6090
447 Ga0495597_0114070 3300046542 Bacteria 1131
448 Ga0495645_0005263 3300046543 Bacteria 8862
449 Ga0495645_0027092 3300046543 Bacteria 4162
450 Ga0495645_0035747 3300046543 Bacteria 3621
451 Ga0495633_0019430 3300046558 Bacteria 3436
452 Ga0495656_0042467 3300046615 Bacteria 1904
453 Ga0495668_0047568 3300046616 Bacteria 2381
454 Ga0495668_0064320 3300046616 Bacteria 2019
455 Ga0495634_0005064 3300046642 Bacteria 10178
456 Ga0495634_0015110 3300046642 Bacteria 5548
457 Ga0495634_0095421 3300046642 Bacteria 1926
458 Ga0495611_0040066 3300046648 Bacteria 2087
459 Ga0495611_0108677 3300046648 Bacteria 1290
460 Ga0495625_0022762 3300046660 Bacteria 4796
461 Ga0495625_0050603 3300046660 Bacteria 2981
462 Ga0495625_0221413 3300046660 Bacteria 1240
463 Ga0495635_0001004 3300046663 Bacteria 18654
464 Ga0495635_0006399 3300046663 Bacteria 8207
465 Ga0495635_0008784 3300046663 Bacteria 7054
466 Ga0495635_0122104 3300046663 Bacteria 1776
467 Ga0495661_0015013 3300046665 Bacteria 5176
468 Ga0495588_0005143 3300046674 Bacteria 5811
469 Ga0495588_0007950 3300046674 Bacteria 4848
470 Ga0495657_0007012 3300046675 Bacteria 8742
471 Ga0495657_0007655 3300046675 Bacteria 8315
472 Ga0495657_0046225 3300046675 Bacteria 2949
473 Ga0495657_0056586 3300046675 Bacteria 2610
474 Ga0495599_0263107 3300046678 Bacteria 1047
475 Ga0495623_0038419 3300046679 Unclassified 3061
476 Ga0495623_0140009 3300046679 Bacteria 1440
477 Ga0495646_0027436 3300046680 Bacteria 3573
478 Ga0495646_0057201 3300046680 Bacteria 2335
479 Ga0495646_0126822 3300046680 Bacteria 1439
480 Ga0495647_0034238 3300046681 Bacteria 1902
481 Ga0495658_0008782 3300046683 Bacteria 5021
482 Ga0495658_0009802 3300046683 Bacteria 4776
483 Ga0495658_0025901 3300046683 Bacteria 3139
484 Ga0495613_0017227 3300046689 Bacteria 5382
485 Ga0495613_0017594 3300046689 Bacteria 5322
486 Ga0495613_0039155 3300046689 Bacteria 3514
487 Ga0495613_0097823 3300046689 Bacteria 2120
488 Ga0495671_0027920 3300046692 Bacteria 2910
489 Ga0495589_0017853 3300046794 Bacteria 3639
490 Ga0495589_0056999 3300046794 Bacteria 1922
491 Ga0495589_0174134 3300046794 Bacteria 1022
492 Ga0495600_0017891 3300046809 Bacteria 4510
493 Ga0495660_0102664 3300046810 Bacteria 1469
494 Ga0495581_0021486 3300047315 Bacteria 3740
495 Ga0495581_0038159 3300047315 Bacteria 2780
496 Ga0495581_0063538 3300047315 Bacteria 2133
497 Ga0495581_0075144 3300047315 Bacteria 1955
498 Ga0495604_0003200 3300047317 Bacteria 13084
499 Ga0495604_0004760 3300047317 Bacteria 10752
500 Ga0495604_0045322 3300047317 Bacteria 3432
501 Ga0495604_0066312 3300047317 Bacteria 2746
502 Ga0495604_0239144 3300047317 Bacteria 1242
503 Ga0495636_0018692 3300047318 Bacteria 2781
504 Ga0495636_0024149 3300047318 Bacteria 2463
505 Ga0495636_0072794 3300047318 Bacteria 1469
506 Ga0495674_0069192 3300047319 Bacteria 3053
507 Ga0495674_0334491 3300047319 Bacteria 1231
508 Ga0495674_0518661 3300047319 Bacteria 952
509 Ga0495676_0012001 3300047321 Bacteria 7815
510 Ga0495676_0017146 3300047321 Bacteria 6408
511 Ga0495676_0021121 3300047321 Bacteria 5697
512 Ga0495676_0072134 3300047321 Bacteria 2652
513 Ga0495676_0084970 3300047321 Bacteria 2385
514 Ga0495680_0010905 3300047322 Bacteria 8076
515 Ga0495680_0158276 3300047322 Bacteria 1646
516 Ga0495683_0042719 3300047323 Bacteria 2285
517 Ga0495687_001648 3300047443 Bacteria 20081
518 Ga0495687_005720 3300047443 Bacteria 7830
519 Ga0495687_012644 3300047443 Bacteria 4449
520 Ga0495687_061924 3300047443 Bacteria 1537
521 Ga0495687_068479 3300047443 Bacteria 1433
522 Ga0495687_082509 3300047443 Bacteria 1254
523 Ga0495687_127269 3300047443 Bacteria 908
524 Ga0495685_004021 3300047447 Bacteria 4728
525 Ga0495685_042950 3300047447 Bacteria 1542
526 Ga0495681_0001693 3300047470 Bacteria 16334
527 Ga0495681_0003555 3300047470 Bacteria 10848
528 Ga0495681_0018274 3300047470 Bacteria 3866
529 Ga0495684_0172801 3300047471 Bacteria 1606
530 Ga0495686_0126084 3300047472 Bacteria 1522
531 Ga0495593_0003639 3300047673 Bacteria 9204
532 Ga0495593_0005185 3300047673 Bacteria 7702
533 Ga0495602_0044426 3300048088 Bacteria 4030
534 Ga0495602_0048087 3300048088 Bacteria 3838
535 Ga0495602_0112008 3300048088 Bacteria 2215
536 Ga0495614_0000841 3300048089 Bacteria 12989
537 Ga0495614_0124692 3300048089 Bacteria 1137
538 Ga0495626_0031029 3300048091 Bacteria 2575
539 Ga0496100_0320045 3300048903 Bacteria 1165
540 Ga0496101_0203665 3300048904 Bacteria 1530
541 Ga0496103_0048374 3300048906 Bacteria 2628
542 Ga0496104_0001344 3300048907 Bacteria 21277
543 Ga0496105_0015905 3300048908 Bacteria 6001
544 Ga0496105_0104975 3300048908 Bacteria 2332
545 Ga0496108_0003880 3300048911 Bacteria 12006
546 Ga0496108_0276214 3300048911 Bacteria 1463
547 Ga0496109_0009141 3300048912 Bacteria 8437
548 Ga0496110_0077753 3300048913 Bacteria 2952
549 Ga0496111_0000184 3300048914 Bacteria 28609
550 Ga0496111_0646386 3300048914 Bacteria 772
551 Ga0496112_0789927 3300048915 Bacteria 874
552 Ga0496113_0383910 3300048916 Bacteria 1127
553 Ga0496114_0045997 3300048917 Bacteria 3626
554 Ga0496114_0087355 3300048917 Bacteria 2644
555 Ga0496114_0204771 3300048917 Bacteria 1729
556 Ga0496114_0240856 3300048917 Bacteria 1591
557 Ga0496114_0468784 3300048917 Bacteria 1114
558 Ga0496115_0058151 3300048918 Bacteria 3111
559 Ga0496115_0106671 3300048918 Bacteria 2300
560 Ga0496126_0040528 3300048929 Bacteria 4317
561 Ga0496126_0052562 3300048929 Bacteria 3701
562 Ga0496126_0189384 3300048929 Bacteria 1743
563 Ga0495678_040733 3300049459 Bacteria 1864
564 Ga0501031_0026720 3300049568 Bacteria 3763
565 Ga0501032_0159857 3300049569 Bacteria 1479
566 Ga0501033_0016410 3300049570 Bacteria 5609
567 Ga0501033_0124749 3300049570 Bacteria 1867
568 Ga0501038_0004886 3300049574 Bacteria 12455
569 Ga0501038_0056791 3300049574 Bacteria 3362
570 Ga0501039_0012962 3300049575 Bacteria 6374
571 Ga0501039_0038797 3300049575 Bacteria 3678
572 Ga0501040_0022715 3300049576 Bacteria 4202
573 Ga0501040_0129682 3300049576 Bacteria 1772
574 Ga0501041_0027512 3300049577 Bacteria 3427
575 Ga0501042_0025091 3300049578 Bacteria 4185
576 Ga0501043_0234243 3300049579 Bacteria 1417
577 Ga0501046_0115301 3300049580 Bacteria 2049
578 Ga0501048_0027173 3300049582 Bacteria 4161
579 Ga0501048_0203577 3300049582 Bacteria 1403
580 Ga0501069_0234904 3300049585 Bacteria 1068
581 Ga0501070_0334905 3300049586 Bacteria 1230
582 Ga0501070_0642175 3300049586 Bacteria 843
583 Ga0501071_0106982 3300049587 Bacteria 2065
584 Ga0501071_0107270 3300049587 Bacteria 2062
585 Ga0501071_0528061 3300049587 Bacteria 906
586 Ga0501072_0016239 3300049588 Bacteria 5711
587 Ga0501076_0052533 3300049592 Bacteria 3228
588 Ga0501079_0153950 3300049741 Bacteria 1792
589 Ga0501079_0273516 3300049741 Bacteria 1320
590 Ga0501081_0105440 3300049743 Bacteria 1997
591 Ga0501035_0789158 3300049822 Bacteria 759
592 Ga0501044_0129950 3300049823 Bacteria 2513
593 Ga0501045_0150440 3300049824 Bacteria 1732
594 nmdc:mga03n38_113996_c1 3300050490 Bacteria 1320
595 nmdc:mga03n38_59632_c1 3300050490 Bacteria 1732
596 nmdc:mga0yw44_9998_c1 3300050492 Bacteria 4826
597 nmdc:mga06z11_3522_c1 3300050494 Bacteria 6065
598 nmdc:mga06z11_79061_c1 3300050494 Bacteria 1760
599 nmdc:mga04h51_141831_c1 3300050495 Bacteria 912
600 nmdc:mga05p37_190442_c1 3300050507 Bacteria 2491
601 nmdc:mga0qj67_177337_c1 3300050509 Bacteria 1731
602 nmdc:mga06r32_517459_c1 3300050510 Bacteria 1169
603 nmdc:mga08y16_481470_c1 3300050511 Bacteria 1263
604 Ga0495601_0046889 3300053077 Bacteria 2720
605 Ga0495601_0080219 3300053077 Bacteria 2093
606 Ga0495601_0257853 3300053077 Bacteria 1138
607 Ga0495612_0030361 3300053078 Bacteria 2176
608 Ga0495612_0052942 3300053078 Bacteria 1671
609 Ga0500635_0000006 3300053080 Bacteria 187108
610 Ga0495655_0009402 3300053083 Bacteria 1894
611 Ga0495655_0043695 3300053083 Bacteria 1156
612 Ga0495619_0236981 3300053085 Bacteria 1264
613 Ga0495619_0254160 3300053085 Bacteria 1218
614 Ga0495619_0347717 3300053085 Bacteria 1026
615 Ga0500578_0028597 3300053086 Bacteria 3580
616 Ga0500578_0095711 3300053086 Bacteria 1883
617 Ga0500583_0077922 3300053092 Bacteria 1597
618 Ga0500640_001432 3300053095 Bacteria 7238
619 Ga0500640_090474 3300053095 Bacteria 1282
620 Ga0500654_093215 3300053099 Bacteria 1328
621 Ga0500660_090749 3300053100 Bacteria 1366
622 Ga0500553_082981 3300053101 Bacteria 1435
623 Ga0500553_099182 3300053101 Bacteria 1258
624 Ga0500553_101657 3300053101 Bacteria 1235
625 Ga0500560_005769 3300053107 Bacteria 2771
626 Ga0500560_108310 3300053107 Bacteria 931
627 Ga0500569_001328 3300053109 Bacteria 4631
628 Ga0500580_047549 3300053113 Bacteria 1810
629 Ga0500621_091258 3300053126 Bacteria 1211
630 Ga0500628_000785 3300053129 Bacteria 5659
631 Ga0500652_012391 3300053131 Bacteria 2989
632 Ga0500658_0011811 3300053134 Bacteria 3219
633 Ga0500561_0009872 3300053137 Bacteria 1952
634 Ga0500573_0017609 3300053140 Bacteria 4069
635 Ga0500573_0069670 3300053140 Bacteria 2007
636 Ga0500579_029352 3300053143 Bacteria 3536
637 Ga0500600_0027671 3300053149 Bacteria 3358
638 Ga0500616_0004587 3300053153 Bacteria 9771
639 Ga0500616_0011605 3300053153 Bacteria 5192
640 Ga0500633_0026027 3300053160 Bacteria 1836
641 Ga0500634_0041823 3300053161 Bacteria 2487
642 Ga0500587_001195 3300053739 Bacteria 3598
643 Ga0466962_0000203 3300061719 Bacteria 24833
644 Ga0466962_0009988 3300061719 Bacteria 4554
645 Ga0466962_0013923 3300061719 Bacteria 3873
646 Ga0530510_0049948 3300061734 Bacteria 3021
647 Ga0530510_0145979 3300061734 Bacteria 1745

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10188297 Ga0207661_101882972 213
2 3300031995 Ga0307409_100770785 Ga0307409_1007707851 214
3 3300041460 Ga0451802_1768030 Ga0451802_1768030_176_832 216
4 3300044693 Ga0466961_0527404 Ga0466961_0527404_28_681 217
5 3300048904 Ga0496101_0203665 Ga0496101_0203665_19_672 217
6 3300031456 Ga0307513_10031680 Ga0307513_100316804 218
7 3300041453 Ga0451797_0640309 Ga0451797_0640309_680_1339 219
8 3300046516 Ga0495628_0004349 Ga0495628_0004349_19_681 219
9 3300048914 Ga0496111_0646386 Ga0496111_0646386_25_684 219
10 3300032126 Ga0307415_100266671 Ga0307415_1002666712 220
11 3300049569 Ga0501032_0159857 Ga0501032_0159857_666_1445 220
12 3300010375 Ga0105239_10131203 Ga0105239_101312032 221
13 3300033179 Ga0307507_10163834 Ga0307507_101638342 222
14 3300005577 Ga0068857_100627876 Ga0068857_1006278762 223
15 3300025932 Ga0207690_10098864 Ga0207690_100988643 223
16 3300026075 Ga0207708_10107363 Ga0207708_101073632 223
17 3300026116 Ga0207674_10298506 Ga0207674_102985062 223
18 3300046511 Ga0495608_0211865 Ga0495608_0211865_26_697 223
19 3300005437 Ga0070710_10004386 Ga0070710_100043864 224
20 3300025898 Ga0207692_10005516 Ga0207692_100055163 224
21 3300044765 Ga0466970_0078037 Ga0466970_0078037_899_1708 224
22 3300045049 Ga0466959_0089831 Ga0466959_0089831_505_1314 224
23 3300053085 Ga0495619_0347717 Ga0495619_0347717_53_730 225
24 3300005616 Ga0068852_100197985 Ga0068852_1001979853 226
25 3300025919 Ga0207657_10112922 Ga0207657_101129222 226
26 3300025981 Ga0207640_10145475 Ga0207640_101454752 226
27 3300026142 Ga0207698_10632428 Ga0207698_106324282 226
28 3300049570 Ga0501033_0124749 Ga0501033_0124749_337_1101 226
29 3300042005 Ga0439448_0011705 Ga0439448_0011705_632_1321 228
30 3300042993 Ga0439440_0016019 Ga0439440_0016019_146_904 228
31 3300050511 nmdc:mga08y16_481470_c1 nmdc:mga08y16_481470_c1_108_866 228
32 3300037068 Ga0373925_0006443 Ga0373925_0006443_7811_8572 230
33 3300045049 Ga0466959_0049610 Ga0466959_0049610_2099_2854 230
34 3300031995 Ga0307409_100237851 Ga0307409_1002378512 233
35 3300042138 Ga0450903_011561 Ga0450903_011561_676_1377 233
36 3300049568 Ga0501031_0026720 Ga0501031_0026720_1018_1719 233
37 3300049575 Ga0501039_0012962 Ga0501039_0012962_5369_6070 233
38 3300049576 Ga0501040_0129682 Ga0501040_0129682_221_922 233
39 3300049582 Ga0501048_0203577 Ga0501048_0203577_641_1342 233
40 3300049587 Ga0501071_0106982 Ga0501071_0106982_343_1044 233
41 3300049741 Ga0501079_0273516 Ga0501079_0273516_257_958 233
42 3300049743 Ga0501081_0105440 Ga0501081_0105440_696_1397 233
43 3300049822 Ga0501035_0789158 Ga0501035_0789158_21_722 233
44 3300049824 Ga0501045_0150440 Ga0501045_0150440_80_781 233
45 3300061734 Ga0530510_0145979 Ga0530510_0145979_675_1376 233
46 3300005937 Ga0081455_10001079 Ga0081455_100010792 234
47 3300014497 Ga0182008_10000777 Ga0182008_100007778 234
48 3300015262 Ga0182007_10000661 Ga0182007_100006617 234
49 3300005329 Ga0070683_100115720 Ga0070683_1001157202 235
50 3300005535 Ga0070684_100065285 Ga0070684_1000652855 235
51 3300025944 Ga0207661_10027634 Ga0207661_100276345 235
52 3300025944 Ga0207661_10250823 Ga0207661_102508233 235
53 3300005337 Ga0070682_100268051 Ga0070682_1002680512 237
54 3300026067 Ga0207678_10564727 Ga0207678_105647272 237
55 3300044901 Ga0466960_0144681 Ga0466960_0144681_511_1224 237
56 3300048929 Ga0496126_0189384 Ga0496126_0189384_94_873 237
57 3300042005 Ga0439448_0017640 Ga0439448_0017640_886_1659 238
58 3300005329 Ga0070683_100846362 Ga0070683_1008463621 239
59 3300025933 Ga0207706_10051112 Ga0207706_100511125 239
60 3300031852 Ga0307410_10693820 Ga0307410_106938201 239
61 3300046500 Ga0495596_0035274 Ga0495596_0035274_958_1677 239
62 3300046462 Ga0495651_0002959 Ga0495651_0002959_8995_9762 240
63 3300046529 Ga0495652_0004196 Ga0495652_0004196_4526_5293 240
64 3300046543 Ga0495645_0035747 Ga0495645_0035747_1458_2225 240
65 3300047317 Ga0495604_0045322 Ga0495604_0045322_2636_3403 240
66 iso_pu_bacteria 2884693830 2884702668 240
67 iso_pu_bacteria 2895427314 2895429477 240
68 iso_pu_bacteria 2895442618 2895452168 240
69 3300028794 Ga0307515_10074461 Ga0307515_100744614 241
70 3300045976 Ga0466967_0621733 Ga0466967_0621733_173_898 241
71 3300003316 rootH1_10005650 rootH1_100056502 242
72 iso_pu_bacteria 8003314358 8003322633 242
73 3300026023 Ga0207677_10217350 Ga0207677_102173502 243
74 3300035089 Ga0373944_0073491 Ga0373944_0073491_314_1045 243
75 3300046472 Ga0495580_0046716 Ga0495580_0046716_26_760 243
76 3300046475 Ga0495639_0126083 Ga0495639_0126083_319_1053 243
77 3300047321 Ga0495676_0072134 Ga0495676_0072134_1379_2113 243
78 3300005329 Ga0070683_100370914 Ga0070683_1003709142 244
79 3300005336 Ga0070680_100018278 Ga0070680_1000182782 244
80 3300005336 Ga0070680_100065815 Ga0070680_1000658153 244
81 3300005337 Ga0070682_100051982 Ga0070682_1000519822 244
82 3300005339 Ga0070660_100044202 Ga0070660_1000442023 244
83 3300005434 Ga0070709_10012890 Ga0070709_100128904 244
84 3300005435 Ga0070714_100090715 Ga0070714_1000907152 244
85 3300005435 Ga0070714_100226882 Ga0070714_1002268823 244
86 3300005436 Ga0070713_100103696 Ga0070713_1001036962 244
87 3300005436 Ga0070713_100157475 Ga0070713_1001574753 244
88 3300005437 Ga0070710_10032628 Ga0070710_100326283 244
89 3300005458 Ga0070681_10073741 Ga0070681_100737413 244
90 3300005468 Ga0070707_100066294 Ga0070707_1000662943 244
91 3300005471 Ga0070698_100009228 Ga0070698_1000092283 244
92 3300005518 Ga0070699_100076467 Ga0070699_1000764672 244
93 3300005535 Ga0070684_100321456 Ga0070684_1003214562 244
94 3300005548 Ga0070665_100111970 Ga0070665_1001119702 244
95 3300005577 Ga0068857_100687266 Ga0068857_1006872662 244
96 3300005616 Ga0068852_100150038 Ga0068852_1001500383 244
97 3300006028 Ga0070717_10241001 Ga0070717_102410012 244
98 3300006028 Ga0070717_10288394 Ga0070717_102883942 244
99 3300006173 Ga0070716_100034547 Ga0070716_1000345472 244
100 3300006175 Ga0070712_100005494 Ga0070712_1000054948 244
101 3300013104 Ga0157370_10057608 Ga0157370_100576085 244
102 3300013105 Ga0157369_10129576 Ga0157369_101295764 244
103 3300020070 Ga0206356_10357540 Ga0206356_103575403 244
104 3300022467 Ga0224712_10091684 Ga0224712_100916842 244
105 3300025904 Ga0207647_10090575 Ga0207647_100905751 244
106 3300025906 Ga0207699_10003554 Ga0207699_100035547 244
107 3300025909 Ga0207705_10313041 Ga0207705_103130413 244
108 3300025912 Ga0207707_10050349 Ga0207707_100503492 244
109 3300025915 Ga0207693_10012884 Ga0207693_100128843 244
110 3300025915 Ga0207693_10022336 Ga0207693_100223365 244
111 3300025917 Ga0207660_10064154 Ga0207660_100641543 244
112 3300025919 Ga0207657_10025688 Ga0207657_100256886 244
113 3300025922 Ga0207646_10106023 Ga0207646_101060233 244
114 3300025928 Ga0207700_10007329 Ga0207700_100073297 244
115 3300025928 Ga0207700_10086278 Ga0207700_100862783 244
116 3300025928 Ga0207700_10138432 Ga0207700_101384322 244
117 3300025929 Ga0207664_10012624 Ga0207664_100126243 244
118 3300025929 Ga0207664_10125027 Ga0207664_101250273 244
119 3300025929 Ga0207664_10342427 Ga0207664_103424271 244
120 3300025929 Ga0207664_10731517 Ga0207664_107315171 244
121 3300025939 Ga0207665_10045607 Ga0207665_100456074 244
122 3300025939 Ga0207665_10135810 Ga0207665_101358102 244
123 3300026067 Ga0207678_10007418 Ga0207678_100074187 244
124 3300026067 Ga0207678_10081725 Ga0207678_100817251 244
125 3300026116 Ga0207674_10037961 Ga0207674_100379613 244
126 3300026116 Ga0207674_10479038 Ga0207674_104790382 244
127 3300026142 Ga0207698_10152830 Ga0207698_101528302 244
128 3300028379 Ga0268266_10094709 Ga0268266_100947093 244
129 3300031731 Ga0307405_10049965 Ga0307405_100499651 244
130 3300031824 Ga0307413_10023094 Ga0307413_100230942 244
131 3300031995 Ga0307409_100302300 Ga0307409_1003023002 244
132 3300032126 Ga0307415_100025726 Ga0307415_1000257264 244
133 3300035086 Ga0373934_0031420 Ga0373934_0031420_290_1033 244
134 3300035113 Ga0373936_0010500 Ga0373936_0010500_2046_2789 244
135 3300035118 Ga0373954_0057351 Ga0373954_0057351_354_1097 244
136 3300035120 Ga0373957_0085254 Ga0373957_0085254_452_1195 244
137 3300035172 Ga0373955_0029602 Ga0373955_0029602_45_788 244
138 3300035410 Ga0373924_0011618 Ga0373924_0011618_545_1288 244
139 3300035692 Ga0373935_0146614 Ga0373935_0146614_457_1200 244
140 3300035724 Ga0373933_0016144 Ga0373933_0016144_56_799 244
141 3300037466 Ga0395898_0036977 Ga0395898_0036977_132_875 244
142 3300044694 Ga0466963_0122264 Ga0466963_0122264_663_1400 244
143 3300045836 Ga0466958_0058276 Ga0466958_0058276_754_1491 244
144 3300046463 Ga0495653_0021618 Ga0495653_0021618_1210_1953 244
145 3300046516 Ga0495628_0220511 Ga0495628_0220511_130_873 244
146 3300046517 Ga0495630_0413688 Ga0495630_0413688_14_757 244
147 3300046533 Ga0495640_0014013 Ga0495640_0014013_4823_5566 244
148 3300046535 Ga0495586_0020844 Ga0495586_0020844_672_1415 244
149 3300046536 Ga0495587_0067962 Ga0495587_0067962_936_1679 244
150 3300046543 Ga0495645_0027092 Ga0495645_0027092_3034_3777 244
151 3300046642 Ga0495634_0095421 Ga0495634_0095421_367_1110 244
152 3300046663 Ga0495635_0122104 Ga0495635_0122104_68_811 244
153 3300046675 Ga0495657_0046225 Ga0495657_0046225_250_993 244
154 3300046678 Ga0495599_0263107 Ga0495599_0263107_293_1036 244
155 3300046679 Ga0495623_0038419 Ga0495623_0038419_323_1066 244
156 3300046680 Ga0495646_0027436 Ga0495646_0027436_2134_2877 244
157 3300047317 Ga0495604_0066312 Ga0495604_0066312_1749_2492 244
158 3300047319 Ga0495674_0334491 Ga0495674_0334491_51_794 244
159 3300047322 Ga0495680_0158276 Ga0495680_0158276_398_1141 244
160 3300048088 Ga0495602_0112008 Ga0495602_0112008_506_1249 244
161 3300048915 Ga0496112_0789927 Ga0496112_0789927_81_824 244
162 3300048918 Ga0496115_0058151 Ga0496115_0058151_1979_2722 244
163 3300048929 Ga0496126_0040528 Ga0496126_0040528_2059_2802 244
164 3300048929 Ga0496126_0052562 Ga0496126_0052562_2264_3007 244
165 3300005354 Ga0070675_100392966 Ga0070675_1003929661 245
166 3300005543 Ga0070672_100122245 Ga0070672_1001222452 245
167 3300009036 Ga0105244_10006177 Ga0105244_100061775 245
168 3300011119 Ga0105246_10043073 Ga0105246_100430733 245
169 3300025303 Ga0209051_1004857 Ga0209051_10048573 245
170 3300025315 Ga0207697_10004439 Ga0207697_100044392 245
171 3300028573 Ga0265334_10041226 Ga0265334_100412261 245
172 3300028654 Ga0265322_10014316 Ga0265322_100143163 245
173 3300028666 Ga0265336_10003740 Ga0265336_100037405 245
174 3300029957 Ga0265324_10009973 Ga0265324_100099733 245
175 3300031238 Ga0265332_10050673 Ga0265332_100506731 245
176 3300031250 Ga0265331_10014814 Ga0265331_100148143 245
177 3300031456 Ga0307513_10001986 Ga0307513_1000198613 245
178 3300031712 Ga0265342_10049373 Ga0265342_100493733 245
179 3300031995 Ga0307409_100532770 Ga0307409_1005327701 245
180 3300041456 Ga0451795_1034354 Ga0451795_1034354_2452_3198 245
181 3300041459 Ga0451800_0421651 Ga0451800_0421651_79_825 245
182 3300046475 Ga0495639_0136025 Ga0495639_0136025_382_1131 245
183 3300046681 Ga0495647_0034238 Ga0495647_0034238_952_1701 245
184 3300048903 Ga0496100_0320045 Ga0496100_0320045_33_782 245
185 3300048906 Ga0496103_0048374 Ga0496103_0048374_1371_2120 245
186 3300048907 Ga0496104_0001344 Ga0496104_0001344_12349_13098 245
187 3300048908 Ga0496105_0015905 Ga0496105_0015905_3250_3999 245
188 3300048911 Ga0496108_0003880 Ga0496108_0003880_8638_9387 245
189 3300048912 Ga0496109_0009141 Ga0496109_0009141_3747_4496 245
190 3300048913 Ga0496110_0077753 Ga0496110_0077753_451_1200 245
191 3300048914 Ga0496111_0000184 Ga0496111_0000184_14870_15619 245
192 3300048917 Ga0496114_0045997 Ga0496114_0045997_1181_1930 245
193 3300048917 Ga0496114_0468784 Ga0496114_0468784_107_856 245
194 3300048918 Ga0496115_0106671 Ga0496115_0106671_320_1069 245
195 3300053153 Ga0500616_0011605 Ga0500616_0011605_2181_2930 245
196 iso_pu_bacteria 2675903060 2676489056 245
197 iso_pu_bacteria 2816332119 2816427009 245
198 iso_pu_bacteria 2844849076 2844850581 245
199 iso_pu_bacteria 2857740372 2857744859 245
200 iso_pu_bacteria 2899370129 2899371203 245
201 iso_pu_bacteria 2904497146 2904499108 245
202 iso_pu_bacteria 2910809715 2910811428 245
203 iso_pu_bacteria 2919059106 2919060911 245
204 iso_pu_bacteria 2933418574 2933422151 245
205 iso_pu_bacteria 2939647034 2939651234 245
206 3300003203 JGI25406J46586_10059721 JGI25406J46586_100597211 246
207 3300005548 Ga0070665_100217797 Ga0070665_1002177972 246
208 3300005614 Ga0068856_100502046 Ga0068856_1005020462 246
209 3300005985 Ga0081539_10001103 Ga0081539_100011037 246
210 3300006048 Ga0075363_100141625 Ga0075363_1001416252 246
211 3300006051 Ga0075364_10130113 Ga0075364_101301131 246
212 3300006178 Ga0075367_10078717 Ga0075367_100787172 246
213 3300009553 Ga0105249_10264363 Ga0105249_102643632 246
214 3300013307 Ga0157372_10137066 Ga0157372_101370661 246
215 3300013307 Ga0157372_10360691 Ga0157372_103606912 246
216 3300026078 Ga0207702_10525361 Ga0207702_105253611 246
217 3300027866 Ga0209813_10120765 Ga0209813_101207651 246
218 3300028379 Ga0268266_10532855 Ga0268266_105328552 246
219 3300031507 Ga0307509_10011002 Ga0307509_100110028 246
220 3300044694 Ga0466963_0010946 Ga0466963_0010946_82_825 246
221 3300045976 Ga0466967_0041393 Ga0466967_0041393_2677_3417 246
222 3300045976 Ga0466967_0063721 Ga0466967_0063721_90_833 246
223 3300046660 Ga0495625_0050603 Ga0495625_0050603_567_1316 246
224 3300048908 Ga0496105_0104975 Ga0496105_0104975_444_1187 246
225 3300048917 Ga0496114_0204771 Ga0496114_0204771_552_1295 246
226 3300048917 Ga0496114_0240856 Ga0496114_0240856_793_1536 246
227 3300050490 nmdc:mga03n38_113996_c1 nmdc:mga03n38_113996_c1_382_1125 246
228 3300050492 nmdc:mga0yw44_9998_c1 nmdc:mga0yw44_9998_c1_1266_2009 246
229 3300050494 nmdc:mga06z11_79061_c1 nmdc:mga06z11_79061_c1_924_1667 246
230 3300050495 nmdc:mga04h51_141831_c1 nmdc:mga04h51_141831_c1_136_879 246
231 iso_pu_bacteria 2731639228 2731909369 246
232 iso_pu_bacteria 2887443736 2887446781 246
233 iso_pu_bacteria 2912715099 2912715776 246
234 3300005434 Ga0070709_10167460 Ga0070709_101674602 247
235 3300005435 Ga0070714_100051600 Ga0070714_1000516003 247
236 3300005436 Ga0070713_100236426 Ga0070713_1002364262 247
237 3300005436 Ga0070713_100504083 Ga0070713_1005040832 247
238 3300005467 Ga0070706_100262720 Ga0070706_1002627202 247
239 3300005985 Ga0081539_10022636 Ga0081539_100226363 247
240 3300025904 Ga0207647_10013528 Ga0207647_100135284 247
241 3300025915 Ga0207693_10051422 Ga0207693_100514224 247
242 3300025916 Ga0207663_10060410 Ga0207663_100604102 247
243 3300025928 Ga0207700_10078808 Ga0207700_100788082 247
244 3300026118 Ga0207675_100702086 Ga0207675_1007020862 247
245 3300028556 Ga0265337_1000230 Ga0265337_100023019 247
246 3300028558 Ga0265326_10001838 Ga0265326_100018387 247
247 3300028563 Ga0265319_1001673 Ga0265319_100167312 247
248 3300028573 Ga0265334_10000178 Ga0265334_1000017813 247
249 3300028666 Ga0265336_10003119 Ga0265336_100031192 247
250 3300028800 Ga0265338_10000683 Ga0265338_1000068342 247
251 3300029957 Ga0265324_10006327 Ga0265324_100063272 247
252 3300031238 Ga0265332_10020655 Ga0265332_100206551 247
253 3300031240 Ga0265320_10007740 Ga0265320_100077403 247
254 3300031247 Ga0265340_10001938 Ga0265340_100019383 247
255 3300031249 Ga0265339_10196402 Ga0265339_101964022 247
256 3300031344 Ga0265316_10015012 Ga0265316_100150123 247
257 3300031595 Ga0265313_10004009 Ga0265313_100040093 247
258 3300031711 Ga0265314_10010641 Ga0265314_100106419 247
259 3300031712 Ga0265342_10001496 Ga0265342_100014965 247
260 3300032002 Ga0307416_100192175 Ga0307416_1001921752 247
261 3300046476 Ga0495662_0090320 Ga0495662_0090320_160_906 247
262 3300048911 Ga0496108_0276214 Ga0496108_0276214_339_1091 247
263 3300048917 Ga0496114_0087355 Ga0496114_0087355_1502_2245 247
264 3300049574 Ga0501038_0056791 Ga0501038_0056791_43_789 247
265 3300049575 Ga0501039_0038797 Ga0501039_0038797_165_911 247
266 3300049576 Ga0501040_0022715 Ga0501040_0022715_544_1290 247
267 3300049577 Ga0501041_0027512 Ga0501041_0027512_2655_3401 247
268 3300049578 Ga0501042_0025091 Ga0501042_0025091_730_1476 247
269 3300049580 Ga0501046_0115301 Ga0501046_0115301_437_1183 247
270 3300049582 Ga0501048_0027173 Ga0501048_0027173_913_1659 247
271 3300049586 Ga0501070_0334905 Ga0501070_0334905_198_944 247
272 3300049587 Ga0501071_0107270 Ga0501071_0107270_430_1176 247
273 3300049588 Ga0501072_0016239 Ga0501072_0016239_2211_2957 247
274 3300049592 Ga0501076_0052533 Ga0501076_0052533_1973_2719 247
275 3300049741 Ga0501079_0153950 Ga0501079_0153950_317_1063 247
276 3300061734 Ga0530510_0049948 Ga0530510_0049948_2127_2873 247
277 iso_pu_bacteria 2582581313 2585304325 247
278 iso_pu_bacteria 2582581314 2585314956 247
279 iso_pu_bacteria 2643221548 2643760014 247
280 iso_pu_bacteria 2643221678 2644440778 247
281 iso_pu_bacteria 2643221682 2644460290 247
282 iso_pu_bacteria 2784746763 2785346268 247
283 iso_pu_bacteria 2784746763 2785346826 247
284 iso_pu_bacteria 2784746768 2785373391 247
285 iso_pu_bacteria 2786546132 2786674605 247
286 iso_pu_bacteria 2808606359 2808845504 247
287 iso_pu_bacteria 2808606375 2808915210 247
288 iso_pu_bacteria 2811994879 2812354187 247
289 iso_pu_bacteria 2852635781 2852635863 247
290 iso_pu_bacteria 2862281513 2862282898 247
291 iso_pu_bacteria 2863404153 2863407847 247
292 iso_pu_bacteria 2867428634 2867431623 247
293 iso_pu_bacteria 2877676314 2877677527 247
294 iso_pu_bacteria 2919468124 2919472853 247
295 iso_pu_bacteria 2932426870 2932430161 247
296 iso_pu_bacteria 2939674588 2939678959 247
297 iso_pu_bacteria 2946064051 2946071511 247
298 iso_pu_bacteria 2947224130 2947225267 247
299 iso_pu_bacteria 2954002825 2954009434 247
300 iso_pu_bacteria 2954380949 2954382258 247
301 iso_pu_bacteria 2954673503 2954680798 247
302 iso_pu_bacteria 2954682443 2954683357 247
303 iso_pu_bacteria 2954691527 2954693085 247
304 iso_pu_bacteria 2954701450 2954708159 247
305 iso_pu_bacteria 2954711539 2954712758 247
306 iso_pu_bacteria 2954721474 2954722717 247
307 iso_pu_bacteria 2954731030 2954739143 247
308 iso_pu_bacteria 2954740390 2954741597 247
309 iso_pu_bacteria 2954749733 2954757972 247
310 iso_pu_bacteria 2954759201 2954760608 247
311 iso_pu_bacteria 2997600082 2997608423 247
312 iso_pu_bacteria 8048406513 8048410554 247
313 iso_pu_bacteria 8056829672 8056836320 247
314 3300002773 JGI25152J39213_1000109 JGI25152J39213_10001095 248
315 3300005334 Ga0068869_100123209 Ga0068869_1001232091 248
316 3300009036 Ga0105244_10054056 Ga0105244_100540562 248
317 3300009148 Ga0105243_10009399 Ga0105243_100093995 248
318 3300011119 Ga0105246_10602434 Ga0105246_106024341 248
319 3300025258 Ga0209129_1000180 Ga0209129_100018019 248
320 3300025294 Ga0209025_1001362 Ga0209025_100136227 248
321 3300025942 Ga0207689_10180457 Ga0207689_101804572 248
322 3300031824 Ga0307413_10113689 Ga0307413_101136892 248
323 3300031852 Ga0307410_10295621 Ga0307410_102956212 248
324 3300031852 Ga0307410_10545948 Ga0307410_105459481 248
325 3300031995 Ga0307409_100247022 Ga0307409_1002470221 248
326 3300044658 Ga0466972_0036878 Ga0466972_0036878_159_908 248
327 3300044683 Ga0466965_0001152 Ga0466965_0001152_5447_6196 248
328 3300044694 Ga0466963_0036954 Ga0466963_0036954_407_1156 248
329 3300044694 Ga0466963_0078485 Ga0466963_0078485_62_811 248
330 3300044706 Ga0466964_0002075 Ga0466964_0002075_4817_5566 248
331 3300044719 Ga0466971_0010618 Ga0466971_0010618_3159_3908 248
332 3300044735 Ga0466968_0033531 Ga0466968_0033531_100_849 248
333 3300044765 Ga0466970_0025639 Ga0466970_0025639_2116_2865 248
334 3300044842 Ga0466957_0102866 Ga0466957_0102866_894_1643 248
335 3300044901 Ga0466960_0009435 Ga0466960_0009435_2247_2996 248
336 3300045049 Ga0466959_0108116 Ga0466959_0108116_426_1175 248
337 3300045836 Ga0466958_0008107 Ga0466958_0008107_3180_3929 248
338 3300045976 Ga0466967_0002421 Ga0466967_0002421_4494_5243 248
339 3300045976 Ga0466967_0255378 Ga0466967_0255378_895_1644 248
340 3300046471 Ga0495650_0028239 Ga0495650_0028239_711_1460 248
341 3300061719 Ga0466962_0013923 Ga0466962_0013923_2061_2810 248
342 iso_pu_bacteria 2585428094 2587864724 248
343 iso_pu_bacteria 2616644814 2616698793 248
344 iso_pu_bacteria 2643221578 2643904984 248
345 iso_pu_bacteria 2643221673 2644403043 248
346 iso_pu_bacteria 2643221714 2644631094 248
347 iso_pu_bacteria 2784746763 2785346317 248
348 iso_pu_bacteria 2784746768 2785373451 248
349 iso_pu_bacteria 2852635781 2852642595 248
350 iso_pu_bacteria 2877676314 2877677032 248
351 iso_pu_bacteria 2946045630 2946052410 248
352 iso_pu_bacteria 2946072368 2946079871 248
353 iso_pu_bacteria 2954380949 2954390056 248
354 3300003203 JGI25406J46586_10041231 JGI25406J46586_100412312 249
355 3300005434 Ga0070709_10052893 Ga0070709_100528932 249
356 3300005436 Ga0070713_100014860 Ga0070713_1000148605 249
357 3300005439 Ga0070711_100016186 Ga0070711_1000161862 249
358 3300005983 Ga0081540_1002232 Ga0081540_10022324 249
359 3300005985 Ga0081539_10003736 Ga0081539_1000373616 249
360 3300005985 Ga0081539_10038322 Ga0081539_100383224 249
361 3300006847 Ga0075431_100485878 Ga0075431_1004858782 249
362 3300025906 Ga0207699_10281098 Ga0207699_102810982 249
363 3300025916 Ga0207663_10214767 Ga0207663_102147671 249
364 3300025928 Ga0207700_10046153 Ga0207700_100461534 249
365 3300031507 Ga0307509_10024641 Ga0307509_100246413 249
366 3300044656 Ga0466969_0002669 Ga0466969_0002669_3040_3798 249
367 3300044684 Ga0466966_0006589 Ga0466966_0006589_2354_3112 249
368 3300044693 Ga0466961_0001075 Ga0466961_0001075_15419_16177 249
369 3300044719 Ga0466971_0000151 Ga0466971_0000151_551_1309 249
370 3300045049 Ga0466959_0002709 Ga0466959_0002709_2371_3129 249
371 3300045836 Ga0466958_0027439 Ga0466958_0027439_1125_1883 249
372 3300046454 Ga0495592_0130734 Ga0495592_0130734_883_1641 249
373 3300046462 Ga0495651_0001705 Ga0495651_0001705_7806_8564 249
374 3300046477 Ga0495664_0159761 Ga0495664_0159761_391_1149 249
375 3300046529 Ga0495652_0001214 Ga0495652_0001214_14758_15516 249
376 3300046535 Ga0495586_0039468 Ga0495586_0039468_66_824 249
377 3300046663 Ga0495635_0001004 Ga0495635_0001004_6439_7197 249
378 3300046680 Ga0495646_0126822 Ga0495646_0126822_607_1365 249
379 3300050510 nmdc:mga06r32_517459_c1 nmdc:mga06r32_517459_c1_53_829 249
380 3300053077 Ga0495601_0046889 Ga0495601_0046889_1356_2114 249
381 3300053077 Ga0495601_0080219 Ga0495601_0080219_103_861 249
382 3300053078 Ga0495612_0030361 Ga0495612_0030361_1233_1991 249
383 3300053080 Ga0500635_0000006 Ga0500635_0000006_99438_100190 249
384 3300061719 Ga0466962_0000203 Ga0466962_0000203_15375_16133 249
385 iso_pu_bacteria 2811994917 2812482928 249
386 iso_pu_bacteria 2966598605 2966604224 249
387 3300001989 JGI24739J22299_10042956 JGI24739J22299_100429562 250
388 3300001989 JGI24739J22299_10049648 JGI24739J22299_100496481 250
389 3300003316 rootH1_10055768 rootH1_100557685 250
390 3300003322 rootL2_10001330 rootL2_100013304 250
391 3300003323 rootH1_10015077 rootH1_100150771 250
392 3300003323 rootH1_10015078 rootH1_100150782 250
393 3300005437 Ga0070710_10064158 Ga0070710_100641582 250
394 3300005456 Ga0070678_100075137 Ga0070678_1000751373 250
395 3300005563 Ga0068855_100439186 Ga0068855_1004391862 250
396 3300005985 Ga0081539_10064219 Ga0081539_100642193 250
397 3300006038 Ga0075365_10101617 Ga0075365_101016172 250
398 3300006042 Ga0075368_10005280 Ga0075368_100052805 250
399 3300006178 Ga0075367_10005258 Ga0075367_100052582 250
400 3300006846 Ga0075430_100035704 Ga0075430_1000357043 250
401 3300006847 Ga0075431_100005354 Ga0075431_10000535412 250
402 3300006880 Ga0075429_100035883 Ga0075429_1000358833 250
403 3300006948 Ga0099826_10049670 Ga0099826_100496703 250
404 3300009147 Ga0114129_10000681 Ga0114129_100006814 250
405 3300013105 Ga0157369_10114233 Ga0157369_101142332 250
406 3300013105 Ga0157369_10457542 Ga0157369_104575422 250
407 3300014497 Ga0182008_10000552 Ga0182008_100005529 250
408 3300015262 Ga0182007_10000554 Ga0182007_100005543 250
409 3300015688 Ga0183367_1016 Ga0183367_1016239 250
410 3300025898 Ga0207692_10121735 Ga0207692_101217352 250
411 3300025904 Ga0207647_10032455 Ga0207647_100324553 250
412 3300025904 Ga0207647_10096689 Ga0207647_100966892 250
413 3300025949 Ga0207667_10293489 Ga0207667_102934892 250
414 3300026121 Ga0207683_10054399 Ga0207683_100543994 250
415 3300027312 Ga0209371_1021303 Ga0209371_10213032 250
416 3300028786 Ga0307517_10018152 Ga0307517_100181524 250
417 3300028794 Ga0307515_10010304 Ga0307515_100103048 250
418 3300030521 Ga0307511_10000672 Ga0307511_1000067228 250
419 3300030522 Ga0307512_10000801 Ga0307512_1000080123 250
420 3300031507 Ga0307509_10006518 Ga0307509_100065185 250
421 3300031507 Ga0307509_10035479 Ga0307509_100354794 250
422 3300031507 Ga0307509_10138169 Ga0307509_101381692 250
423 3300031616 Ga0307508_10004718 Ga0307508_100047183 250
424 3300031649 Ga0307514_10005174 Ga0307514_100051745 250
425 3300031649 Ga0307514_10008786 Ga0307514_100087864 250
426 3300031649 Ga0307514_10101916 Ga0307514_101019163 250
427 3300031730 Ga0307516_10000841 Ga0307516_100008415 250
428 3300031730 Ga0307516_10059569 Ga0307516_100595695 250
429 3300031838 Ga0307518_10092157 Ga0307518_100921572 250
430 3300033179 Ga0307507_10030151 Ga0307507_100301515 250
431 3300033179 Ga0307507_10060126 Ga0307507_100601263 250
432 3300033179 Ga0307507_10094661 Ga0307507_100946612 250
433 3300033180 Ga0307510_10006065 Ga0307510_100060657 250
434 3300033180 Ga0307510_10057502 Ga0307510_100575025 250
435 3300033180 Ga0307510_10075977 Ga0307510_100759775 250
436 3300033180 Ga0307510_10130210 Ga0307510_101302102 250
437 3300033180 Ga0307510_10141332 Ga0307510_101413322 250
438 3300037418 Ga0395900_0231452 Ga0395900_0231452_458_1213 250
439 3300037466 Ga0395898_0007719 Ga0395898_0007719_2484_3239 250
440 3300041404 Ga0439436_0004109 Ga0439436_0004109_1755_2510 250
441 3300041404 Ga0439436_0015754 Ga0439436_0015754_800_1555 250
442 3300041405 Ga0439438_071793 Ga0439438_071793_19_774 250
443 3300041406 Ga0439439_0010864 Ga0439439_0010864_619_1374 250
444 3300041406 Ga0439439_0072405 Ga0439439_0072405_61_816 250
445 3300041512 Ga0451853_1223826 Ga0451853_1223826_1017_1772 250
446 3300041999 Ga0439433_0007013 Ga0439433_0007013_963_1718 250
447 3300042005 Ga0439448_0090220 Ga0439448_0090220_72_827 250
448 3300042007 Ga0439449_0012598 Ga0439449_0012598_1859_2614 250
449 3300042007 Ga0439449_0015988 Ga0439449_0015988_1102_1857 250
450 3300042008 Ga0439450_067692 Ga0439450_067692_21_776 250
451 3300042014 Ga0439457_000998 Ga0439457_000998_3428_4183 250
452 3300042131 Ga0450894_000148 Ga0450894_000148_783_1538 250
453 3300042132 Ga0450895_006859 Ga0450895_006859_137_892 250
454 3300042134 Ga0450898_000188 Ga0450898_000188_1040_1795 250
455 3300042138 Ga0450903_000204 Ga0450903_000204_8684_9439 250
456 3300042145 Ga0450906_000040 Ga0450906_000040_2996_3751 250
457 3300042157 Ga0439458_0000476 Ga0439458_0000476_5022_5777 250
458 3300042157 Ga0439458_0003238 Ga0439458_0003238_1160_1915 250
459 3300042184 Ga0450908_010342 Ga0450908_010342_310_1065 250
460 3300044658 Ga0466972_0000744 Ga0466972_0000744_11320_12075 250
461 3300044684 Ga0466966_0011651 Ga0466966_0011651_3501_4256 250
462 3300044693 Ga0466961_0009383 Ga0466961_0009383_738_1493 250
463 3300044694 Ga0466963_0037174 Ga0466963_0037174_1497_2252 250
464 3300044706 Ga0466964_0150537 Ga0466964_0150537_283_1038 250
465 3300044719 Ga0466971_0032982 Ga0466971_0032982_816_1571 250
466 3300045976 Ga0466967_0087334 Ga0466967_0087334_2030_2785 250
467 3300046454 Ga0495592_0011446 Ga0495592_0011446_244_1002 250
468 3300046454 Ga0495592_0012776 Ga0495592_0012776_4561_5316 250
469 3300046459 Ga0495629_0014036 Ga0495629_0014036_654_1412 250
470 3300046459 Ga0495629_0015196 Ga0495629_0015196_2464_3219 250
471 3300046459 Ga0495629_0025807 Ga0495629_0025807_1261_2016 250
472 3300046459 Ga0495629_0371008 Ga0495629_0371008_197_955 250
473 3300046460 Ga0495638_0075194 Ga0495638_0075194_1096_1851 250
474 3300046462 Ga0495651_0004042 Ga0495651_0004042_4169_4924 250
475 3300046472 Ga0495580_0182859 Ga0495580_0182859_466_1224 250
476 3300046474 Ga0495605_0120762 Ga0495605_0120762_401_1156 250
477 3300046476 Ga0495662_0000534 Ga0495662_0000534_6991_7746 250
478 3300046476 Ga0495662_0092381 Ga0495662_0092381_43_801 250
479 3300046477 Ga0495664_0000617 Ga0495664_0000617_9912_10670 250
480 3300046477 Ga0495664_0003610 Ga0495664_0003610_6168_6923 250
481 3300046492 Ga0495585_0022960 Ga0495585_0022960_49_807 250
482 3300046499 Ga0495594_0008240 Ga0495594_0008240_1522_2280 250
483 3300046499 Ga0495594_0034337 Ga0495594_0034337_666_1421 250
484 3300046500 Ga0495596_0014822 Ga0495596_0014822_602_1360 250
485 3300046506 Ga0495583_0006789 Ga0495583_0006789_156_914 250
486 3300046506 Ga0495583_0064824 Ga0495583_0064824_171_929 250
487 3300046506 Ga0495583_0072513 Ga0495583_0072513_327_1082 250
488 3300046507 Ga0495606_0007389 Ga0495606_0007389_4375_5133 250
489 3300046511 Ga0495608_0036891 Ga0495608_0036891_885_1643 250
490 3300046512 Ga0495610_0059901 Ga0495610_0059901_407_1165 250
491 3300046513 Ga0495616_0018556 Ga0495616_0018556_3007_3765 250
492 3300046514 Ga0495618_0218426 Ga0495618_0218426_350_1108 250
493 3300046515 Ga0495620_0010158 Ga0495620_0010158_3584_4342 250
494 3300046516 Ga0495628_0036786 Ga0495628_0036786_887_1645 250
495 3300046516 Ga0495628_0071763 Ga0495628_0071763_553_1308 250
496 3300046516 Ga0495628_0100719 Ga0495628_0100719_917_1675 250
497 3300046517 Ga0495630_0169651 Ga0495630_0169651_470_1225 250
498 3300046518 Ga0495631_0003534 Ga0495631_0003534_130_888 250
499 3300046520 Ga0495637_0019780 Ga0495637_0019780_2075_2833 250
500 3300046522 Ga0495643_0010819 Ga0495643_0010819_2307_3065 250
501 3300046524 Ga0495648_0037742 Ga0495648_0037742_1347_2105 250
502 3300046524 Ga0495648_0070367 Ga0495648_0070367_410_1168 250
503 3300046529 Ga0495652_0031801 Ga0495652_0031801_1570_2325 250
504 3300046530 Ga0495654_0162063 Ga0495654_0162063_35_793 250
505 3300046531 Ga0495665_0199212 Ga0495665_0199212_16_774 250
506 3300046533 Ga0495640_0040118 Ga0495640_0040118_1298_2056 250
507 3300046535 Ga0495586_0067886 Ga0495586_0067886_499_1257 250
508 3300046536 Ga0495587_0003123 Ga0495587_0003123_9377_10132 250
509 3300046536 Ga0495587_0037947 Ga0495587_0037947_1922_2680 250
510 3300046538 Ga0495609_0006276 Ga0495609_0006276_378_1136 250
511 3300046542 Ga0495597_0114070 Ga0495597_0114070_112_870 250
512 3300046543 Ga0495645_0005263 Ga0495645_0005263_3795_4550 250
513 3300046558 Ga0495633_0019430 Ga0495633_0019430_2390_3148 250
514 3300046616 Ga0495668_0047568 Ga0495668_0047568_1348_2106 250
515 3300046616 Ga0495668_0064320 Ga0495668_0064320_159_917 250
516 3300046642 Ga0495634_0005064 Ga0495634_0005064_9170_9925 250
517 3300046642 Ga0495634_0015110 Ga0495634_0015110_2806_3564 250
518 3300046648 Ga0495611_0040066 Ga0495611_0040066_500_1258 250
519 3300046648 Ga0495611_0108677 Ga0495611_0108677_132_890 250
520 3300046660 Ga0495625_0022762 Ga0495625_0022762_1733_2488 250
521 3300046663 Ga0495635_0006399 Ga0495635_0006399_7147_7902 250
522 3300046663 Ga0495635_0008784 Ga0495635_0008784_4819_5577 250
523 3300046665 Ga0495661_0015013 Ga0495661_0015013_2288_3046 250
524 3300046674 Ga0495588_0007950 Ga0495588_0007950_1806_2561 250
525 3300046675 Ga0495657_0007012 Ga0495657_0007012_2134_2892 250
526 3300046675 Ga0495657_0007655 Ga0495657_0007655_189_944 250
527 3300046679 Ga0495623_0140009 Ga0495623_0140009_58_816 250
528 3300046680 Ga0495646_0057201 Ga0495646_0057201_1479_2234 250
529 3300046683 Ga0495658_0008782 Ga0495658_0008782_2313_3071 250
530 3300046683 Ga0495658_0025901 Ga0495658_0025901_1108_1863 250
531 3300046689 Ga0495613_0017227 Ga0495613_0017227_295_1050 250
532 3300046689 Ga0495613_0097823 Ga0495613_0097823_1135_1893 250
533 3300046692 Ga0495671_0027920 Ga0495671_0027920_497_1252 250
534 3300046794 Ga0495589_0017853 Ga0495589_0017853_1779_2537 250
535 3300046794 Ga0495589_0056999 Ga0495589_0056999_62_820 250
536 3300046809 Ga0495600_0017891 Ga0495600_0017891_295_1050 250
537 3300046810 Ga0495660_0102664 Ga0495660_0102664_80_838 250
538 3300047315 Ga0495581_0021486 Ga0495581_0021486_1478_2233 250
539 3300047315 Ga0495581_0075144 Ga0495581_0075144_21_779 250
540 3300047317 Ga0495604_0003200 Ga0495604_0003200_779_1534 250
541 3300047317 Ga0495604_0004760 Ga0495604_0004760_4354_5112 250
542 3300047317 Ga0495604_0239144 Ga0495604_0239144_29_787 250
543 3300047318 Ga0495636_0018692 Ga0495636_0018692_31_786 250
544 3300047318 Ga0495636_0072794 Ga0495636_0072794_298_1056 250
545 3300047319 Ga0495674_0069192 Ga0495674_0069192_712_1470 250
546 3300047319 Ga0495674_0518661 Ga0495674_0518661_30_788 250
547 3300047321 Ga0495676_0012001 Ga0495676_0012001_1557_2312 250
548 3300047321 Ga0495676_0017146 Ga0495676_0017146_650_1408 250
549 3300047321 Ga0495676_0021121 Ga0495676_0021121_4549_5307 250
550 3300047321 Ga0495676_0084970 Ga0495676_0084970_1220_1978 250
551 3300047322 Ga0495680_0010905 Ga0495680_0010905_2591_3349 250
552 3300047443 Ga0495687_001648 Ga0495687_001648_7630_8385 250
553 3300047443 Ga0495687_061924 Ga0495687_061924_24_782 250
554 3300047443 Ga0495687_082509 Ga0495687_082509_263_1018 250
555 3300047447 Ga0495685_042950 Ga0495685_042950_563_1321 250
556 3300047470 Ga0495681_0001693 Ga0495681_0001693_7231_7986 250
557 3300047470 Ga0495681_0018274 Ga0495681_0018274_501_1259 250
558 3300047471 Ga0495684_0172801 Ga0495684_0172801_649_1407 250
559 3300047673 Ga0495593_0003639 Ga0495593_0003639_6791_7546 250
560 3300047673 Ga0495593_0005185 Ga0495593_0005185_1963_2721 250
561 3300048088 Ga0495602_0044426 Ga0495602_0044426_552_1310 250
562 3300048088 Ga0495602_0048087 Ga0495602_0048087_1260_2015 250
563 3300048089 Ga0495614_0000841 Ga0495614_0000841_35_790 250
564 3300048089 Ga0495614_0124692 Ga0495614_0124692_76_834 250
565 3300048091 Ga0495626_0031029 Ga0495626_0031029_45_803 250
566 3300049459 Ga0495678_040733 Ga0495678_040733_621_1379 250
567 3300049570 Ga0501033_0016410 Ga0501033_0016410_3497_4252 250
568 3300049574 Ga0501038_0004886 Ga0501038_0004886_8317_9072 250
569 3300049579 Ga0501043_0234243 Ga0501043_0234243_586_1341 250
570 3300049585 Ga0501069_0234904 Ga0501069_0234904_208_963 250
571 3300049587 Ga0501071_0528061 Ga0501071_0528061_125_880 250
572 3300049823 Ga0501044_0129950 Ga0501044_0129950_606_1361 250
573 3300050494 nmdc:mga06z11_3522_c1 nmdc:mga06z11_3522_c1_467_1222 250
574 3300050507 nmdc:mga05p37_190442_c1 nmdc:mga05p37_190442_c1_195_971 250
575 3300050509 nmdc:mga0qj67_177337_c1 nmdc:mga0qj67_177337_c1_417_1193 250
576 3300053078 Ga0495612_0052942 Ga0495612_0052942_301_1056 250
577 3300053083 Ga0495655_0043695 Ga0495655_0043695_82_837 250
578 3300053085 Ga0495619_0236981 Ga0495619_0236981_464_1219 250
579 3300053085 Ga0495619_0254160 Ga0495619_0254160_373_1128 250
580 3300053086 Ga0500578_0095711 Ga0500578_0095711_440_1195 250
581 3300053092 Ga0500583_0077922 Ga0500583_0077922_468_1223 250
582 3300053095 Ga0500640_001432 Ga0500640_001432_1496_2254 250
583 3300053095 Ga0500640_090474 Ga0500640_090474_234_989 250
584 3300053101 Ga0500553_082981 Ga0500553_082981_553_1308 250
585 3300053101 Ga0500553_099182 Ga0500553_099182_211_969 250
586 3300053107 Ga0500560_108310 Ga0500560_108310_53_808 250
587 3300053140 Ga0500573_0069670 Ga0500573_0069670_201_956 250
588 iso_pu_bacteria 2862382967 2862386815 250
589 iso_pu_bacteria 8008558824 8008560421 250
590 3300005539 Ga0068853_100170450 Ga0068853_1001704502 251
591 3300005539 Ga0068853_100302113 Ga0068853_1003021132 251
592 3300005563 Ga0068855_100009579 Ga0068855_10000957911 251
593 3300005578 Ga0068854_100000781 Ga0068854_1000007814 251
594 3300005614 Ga0068856_100505448 Ga0068856_1005054482 251
595 3300005616 Ga0068852_100113891 Ga0068852_1001138913 251
596 3300006847 Ga0075431_100258992 Ga0075431_1002589922 251
597 3300009093 Ga0105240_10011484 Ga0105240_100114845 251
598 3300009174 Ga0105241_10003035 Ga0105241_100030358 251
599 3300010375 Ga0105239_10014794 Ga0105239_100147944 251
600 3300013296 Ga0157374_10122188 Ga0157374_101221882 251
601 3300025904 Ga0207647_10005686 Ga0207647_100056867 251
602 3300025911 Ga0207654_10003921 Ga0207654_100039217 251
603 3300025913 Ga0207695_10003004 Ga0207695_100030046 251
604 3300025914 Ga0207671_10000488 Ga0207671_1000048835 251
605 3300025924 Ga0207694_10001572 Ga0207694_100015729 251
606 3300025942 Ga0207689_10621902 Ga0207689_106219022 251
607 3300025981 Ga0207640_10010341 Ga0207640_100103413 251
608 3300026041 Ga0207639_10136666 Ga0207639_101366662 251
609 3300026041 Ga0207639_10146051 Ga0207639_101460512 251
610 3300026067 Ga0207678_10149752 Ga0207678_101497522 251
611 3300026142 Ga0207698_10028688 Ga0207698_100286882 251
612 3300028379 Ga0268266_10090348 Ga0268266_100903482 251
613 3300028800 Ga0265338_10054900 Ga0265338_100549002 251
614 3300031241 Ga0265325_10034084 Ga0265325_100340843 251
615 3300031247 Ga0265340_10002640 Ga0265340_100026402 251
616 3300031249 Ga0265339_10005353 Ga0265339_100053539 251
617 3300041404 Ga0439436_0005195 Ga0439436_0005195_2410_3165 251
618 3300041406 Ga0439439_0003420 Ga0439439_0003420_2728_3483 251
619 3300042014 Ga0439457_000307 Ga0439457_000307_11760_12515 251
620 3300042131 Ga0450894_000894 Ga0450894_000894_2519_3328 251
621 3300042134 Ga0450898_002540 Ga0450898_002540_1021_1830 251
622 3300042145 Ga0450906_000521 Ga0450906_000521_741_1550 251
623 3300046455 Ga0495603_0012311 Ga0495603_0012311_3229_3993 251
624 3300046459 Ga0495629_0131760 Ga0495629_0131760_706_1470 251
625 3300046471 Ga0495650_0028062 Ga0495650_0028062_1455_2213 251
626 3300046471 Ga0495650_0107007 Ga0495650_0107007_69_827 251
627 3300046473 Ga0495582_0057870 Ga0495582_0057870_273_1037 251
628 3300046476 Ga0495662_0011551 Ga0495662_0011551_1341_2105 251
629 3300046499 Ga0495594_0062842 Ga0495594_0062842_1228_1992 251
630 3300046517 Ga0495630_0400598 Ga0495630_0400598_103_867 251
631 3300046660 Ga0495625_0221413 Ga0495625_0221413_99_872 251
632 3300046674 Ga0495588_0005143 Ga0495588_0005143_2768_3532 251
633 3300046675 Ga0495657_0056586 Ga0495657_0056586_1208_1972 251
634 3300046689 Ga0495613_0017594 Ga0495613_0017594_2535_3299 251
635 3300046689 Ga0495613_0039155 Ga0495613_0039155_2655_3419 251
636 3300047315 Ga0495581_0038159 Ga0495581_0038159_1229_1993 251
637 3300047315 Ga0495581_0063538 Ga0495581_0063538_565_1329 251
638 3300047318 Ga0495636_0024149 Ga0495636_0024149_360_1133 251
639 3300047443 Ga0495687_068479 Ga0495687_068479_543_1307 251
640 3300047472 Ga0495686_0126084 Ga0495686_0126084_566_1324 251
641 3300053077 Ga0495601_0257853 Ga0495601_0257853_17_784 251
642 iso_pu_bacteria 2990059506 2990066967 251
643 3300001989 JGI24739J22299_10017128 JGI24739J22299_100171282 252
644 3300002075 JGI24738J21930_10009736 JGI24738J21930_100097362 252
645 3300003316 rootH1_10026697 rootH1_100266973 252
646 3300005539 Ga0068853_100095691 Ga0068853_1000956914 252
647 3300005578 Ga0068854_100054481 Ga0068854_1000544813 252
648 3300005614 Ga0068856_100213535 Ga0068856_1002135352 252
649 3300005834 Ga0068851_10297548 Ga0068851_102975482 252
650 3300006048 Ga0075363_100123438 Ga0075363_1001234382 252
651 3300011119 Ga0105246_10531960 Ga0105246_105319602 252
652 3300015688 Ga0183367_1011 Ga0183367_101145 252
653 3300025904 Ga0207647_10005581 Ga0207647_100055814 252
654 3300025904 Ga0207647_10010531 Ga0207647_100105316 252
655 3300025981 Ga0207640_10121888 Ga0207640_101218882 252
656 3300026041 Ga0207639_10177159 Ga0207639_101771592 252
657 3300026078 Ga0207702_10266430 Ga0207702_102664302 252
658 3300028794 Ga0307515_10250021 Ga0307515_102500211 252
659 3300030522 Ga0307512_10022842 Ga0307512_100228425 252
660 3300031456 Ga0307513_10010977 Ga0307513_100109774 252
661 3300031616 Ga0307508_10013835 Ga0307508_100138354 252
662 3300031616 Ga0307508_10030536 Ga0307508_100305364 252
663 3300031649 Ga0307514_10164558 Ga0307514_101645582 252
664 3300031730 Ga0307516_10402392 Ga0307516_104023922 252
665 3300041404 Ga0439436_0003837 Ga0439436_0003837_324_1082 252
666 3300041406 Ga0439439_0000121 Ga0439439_0000121_817_1575 252
667 3300041512 Ga0451853_1833064 Ga0451853_1833064_512_1324 252
668 3300041999 Ga0439433_0003165 Ga0439433_0003165_543_1301 252
669 3300042007 Ga0439449_0007982 Ga0439449_0007982_2399_3157 252
670 3300042014 Ga0439457_000111 Ga0439457_000111_2263_3021 252
671 3300042015 Ga0439462_0017760 Ga0439462_0017760_812_1570 252
672 3300042127 Ga0450890_006837 Ga0450890_006837_676_1434 252
673 3300042131 Ga0450894_000258 Ga0450894_000258_5217_5975 252
674 3300042133 Ga0450896_000218 Ga0450896_000218_2349_3107 252
675 3300042134 Ga0450898_000150 Ga0450898_000150_5534_6292 252
676 3300042135 Ga0450899_000083 Ga0450899_000083_4660_5418 252
677 3300042136 Ga0450900_012551 Ga0450900_012551_143_901 252
678 3300042145 Ga0450906_000331 Ga0450906_000331_6193_6951 252
679 3300042157 Ga0439458_0009838 Ga0439458_0009838_1151_1924 252
680 3300042184 Ga0450908_003549 Ga0450908_003549_1519_2277 252
681 3300044719 Ga0466971_0088403 Ga0466971_0088403_288_1097 252
682 3300045049 Ga0466959_0008239 Ga0466959_0008239_1560_2369 252
683 3300046453 Ga0495627_026909 Ga0495627_026909_797_1603 252
684 3300046492 Ga0495585_0153112 Ga0495585_0153112_104_910 252
685 3300046522 Ga0495643_0005450 Ga0495643_0005450_5571_6377 252
686 3300046615 Ga0495656_0042467 Ga0495656_0042467_222_1028 252
687 3300046683 Ga0495658_0009802 Ga0495658_0009802_1163_1924 252
688 3300046794 Ga0495589_0174134 Ga0495589_0174134_13_819 252
689 3300047323 Ga0495683_0042719 Ga0495683_0042719_1260_2066 252
690 3300047443 Ga0495687_005720 Ga0495687_005720_2131_2892 252
691 3300047443 Ga0495687_012644 Ga0495687_012644_2580_3386 252
692 3300047443 Ga0495687_127269 Ga0495687_127269_65_871 252
693 3300047447 Ga0495685_004021 Ga0495685_004021_14_820 252
694 3300047470 Ga0495681_0003555 Ga0495681_0003555_1994_2800 252
695 3300048916 Ga0496113_0383910 Ga0496113_0383910_346_1104 252
696 3300049586 Ga0501070_0642175 Ga0501070_0642175_21_833 252
697 3300050490 nmdc:mga03n38_59632_c1 nmdc:mga03n38_59632_c1_430_1188 252
698 3300053083 Ga0495655_0009402 Ga0495655_0009402_971_1732 252
699 3300053086 Ga0500578_0028597 Ga0500578_0028597_2312_3118 252
700 3300053099 Ga0500654_093215 Ga0500654_093215_440_1246 252
701 3300053100 Ga0500660_090749 Ga0500660_090749_176_982 252
702 3300053101 Ga0500553_101657 Ga0500553_101657_374_1135 252
703 3300053107 Ga0500560_005769 Ga0500560_005769_573_1334 252
704 3300053109 Ga0500569_001328 Ga0500569_001328_995_1801 252
705 3300053113 Ga0500580_047549 Ga0500580_047549_969_1730 252
706 3300053126 Ga0500621_091258 Ga0500621_091258_87_893 252
707 3300053129 Ga0500628_000785 Ga0500628_000785_3860_4666 252
708 3300053131 Ga0500652_012391 Ga0500652_012391_586_1392 252
709 3300053134 Ga0500658_0011811 Ga0500658_0011811_1827_2633 252
710 3300053137 Ga0500561_0009872 Ga0500561_0009872_13_819 252
711 3300053140 Ga0500573_0017609 Ga0500573_0017609_2681_3442 252
712 3300053143 Ga0500579_029352 Ga0500579_029352_1765_2571 252
713 3300053149 Ga0500600_0027671 Ga0500600_0027671_1068_1874 252
714 3300053153 Ga0500616_0004587 Ga0500616_0004587_3461_4267 252
715 3300053160 Ga0500633_0026027 Ga0500633_0026027_586_1392 252
716 3300053161 Ga0500634_0041823 Ga0500634_0041823_459_1265 252
717 3300053739 Ga0500587_001195 Ga0500587_001195_42_848 252
718 3300061719 Ga0466962_0009988 Ga0466962_0009988_1322_2131 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

7

193

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

12

246

0.91

PF08659

KR

KR domain

7

183

0.75

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

8

241

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dqx-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from rhizobium etli cfn 42 0.9649 1 242
2d1y-assembly1.cif.gz_C crystal structure of tt0321 from thermus thermophilus hb8 0.959 3 241
3sju-assembly1.cif.gz_A hedamycin polyketide ketoreductase bound to nadph 0.9572 8 244
6ffb-assembly1.cif.gz_A 17beta-hydroxysteroid dehydrogenase 14 variant s205 - mutant q148a - in complex with a nonsteroidal inhibitor 0.9541 1 245
4yqz-assembly1.cif.gz_B crystal structure of a putative oxidoreductase from thermus thermophilus hb27 (tt_p0034, target efi-513932) in its apo form 0.9539 1 242
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 4 174 3.40.50.720
2d1yC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 3 241 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9577 50 169 3.40.50.720
4yqzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9523 4 241 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9518 4 186 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1X4HYD4-F1-model_v4 Short-chain dehydrogenase 0.9987 1 222 GO:0016491
AF-A0A6I3FNJ5-F1-model_v4 SDR family oxidoreductase 0.997 74 248 GO:0016491
AF-A0A345XXH1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9969 2 252 GO:0016491
AF-A0A2N0EMC4-F1-model_v4 deleted 0.9967 1 249
AF-A0A367EHH1-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9954 3 251 GO:0016491

Feature Viewer

pLDDT pTM Quality
94.66 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map