F477162

General Info

Members Datasets Scaffolds Average Seq Length
718 506 1436 270

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10449661|Ga0105237_104496611
Length 263
Sequence MSTEAAGDGPMMSSSADFSTVLNRILDTAADNLRIAKILVQMGLDPNNITYEAFALIGAVFFVATLLMQTMVPLRIANMAGCTFFVAFGALSGNVATFLLYLLLLPINAVRLRQMRNLIRKARLATESDTSMEWLRPFMTERRYRRGDTLCKKDDAANEMFLTITGRYLVTEIGVELPPGRIVGELGFLTPNKQRTATVECIEDGQVLTITYEKLLEIYFQNPQFGYYFLVLTSQRLLENISRLEGIVAQEKAARQGAGAADI

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
64 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
65 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
141 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
142 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
143 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
144 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
179 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
238 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
239 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
266 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
267 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
268 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
271 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
272 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
283 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
288 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
289 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
292 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
293 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
294 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
295 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
296 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
299 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
306 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
307 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
308 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
309 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
310 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
313 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
314 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
315 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
316 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
317 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
320 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
321 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
322 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
323 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
324 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
325 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
326 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
327 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
328 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
329 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
330 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
331 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
332 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
333 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
334 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
335 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
336 2791355199
337 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
338 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
339 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
340 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
341 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
342 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
343 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
344 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
345 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
346 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
347 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
348 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
349 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
350 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
351 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
352 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
353 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
354 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
355 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
356 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
357 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
358 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
359 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
360 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
361 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
362 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
363 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
364 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
365 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
366 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
367 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
368 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
369 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
370 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
371 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
372 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
373 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
374 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
375 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
376 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
377 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
378 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
379 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
380 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
381 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
382 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
383 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
384 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
385 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
386 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
387 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
388 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
389 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
390 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
391 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
392 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
393 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
394 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
395 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
396 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
397 2904699407
398 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
399 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
400 2906610324
401 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
402 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
403 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
404 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
405 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
406 2922368715
407 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
408 2922425934
409 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
410 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
411 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
412 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
413 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
414 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
415 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
416 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
417 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
418 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
419 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
420 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
421 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
422 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
423 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
424 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
425 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
426 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
427 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
428 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
429 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
430 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
431 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
432 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
433 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
434 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
435 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
436 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
437 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
438 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
439 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
440 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
441 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
442 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
443 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
444 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
445 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
446 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
447 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
448 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
449 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
450 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
451 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
452 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
453 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
454 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
455 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
456 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
457 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
458 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
459 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
460 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
461 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
462 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
463 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
464 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
465 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
466 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
467 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
468 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
469 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
470 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
471 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
472 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
473 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
474 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
475 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
476 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
477 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
478 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
479 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
480 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
481 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
482 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
483 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
484 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
485 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
486 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
487 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
488 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
489 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
490 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
491 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
492 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
493 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
494 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
495 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
496 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
497 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
498 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
499 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
500 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
501 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
502 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
503 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
504 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
505 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
506 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.19
Metatranscriptomes 0.14
Isolates 25.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.43
Nodule 19.64
Rhizoplane 3.48
Rhizosphere 50.42
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10449661 3300009545 Bacteria 1294
2 JGI25406J46586_10001591 3300003203 Bacteria 10726
3 JGI25406J46586_10003138 3300003203 Bacteria 7765
4 JGI25153J46596_10001822 3300003215 Bacteria 12629
5 JGI25153J46596_10003459 3300003215 Bacteria 8844
6 JGI25153J46596_10004454 3300003215 Bacteria 7551
7 JGI25153J46596_10030199 3300003215 Bacteria 1848
8 JGI25160J50197_1000729 3300003354 Bacteria 17998
9 JGI25160J50197_1002598 3300003354 Bacteria 8344
10 JGI25404J52841_10009491 3300003659 Bacteria 2080
11 Ga0055542_1005244 3300003762 Bacteria 2964
12 Ga0055526_1051644 3300003771 Bacteria 933
13 Ga0055531_10004381 3300003794 Bacteria 8620
14 JGI25405J52794_10035098 3300003911 Bacteria 1050
15 Ga0055543_1001967 3300004625 Bacteria 7323
16 Ga0065165_1000278 3300005262 Bacteria 87353
17 Ga0065165_1005698 3300005262 Bacteria 6856
18 Ga0065165_1010190 3300005262 Bacteria 4099
19 Ga0070683_100015396 3300005329 Bacteria 6717
20 Ga0070670_100061597 3300005331 Bacteria 3221
21 Ga0068869_100067311 3300005334 Bacteria 2642
22 Ga0070680_100007902 3300005336 Bacteria 8111
23 Ga0070680_100011830 3300005336 Bacteria 6768
24 Ga0068868_100004886 3300005338 Bacteria 9409
25 Ga0068868_100152190 3300005338 Bacteria 1906
26 Ga0070660_100099635 3300005339 Bacteria 2301
27 Ga0070660_100388847 3300005339 Bacteria 1152
28 Ga0070661_100282180 3300005344 Bacteria 1289
29 Ga0070668_100148632 3300005347 Bacteria 1893
30 Ga0070669_100265305 3300005353 Bacteria 1371
31 Ga0070675_100220742 3300005354 Bacteria 1651
32 Ga0070671_100012665 3300005355 Bacteria 6799
33 Ga0070673_100117541 3300005364 Bacteria 2213
34 Ga0070673_100147632 3300005364 Bacteria 1989
35 Ga0070709_10043295 3300005434 Bacteria 2783
36 Ga0070709_10066265 3300005434 Bacteria 2315
37 Ga0070709_10336632 3300005434 Bacteria 1112
38 Ga0070713_100003997 3300005436 Bacteria 9815
39 Ga0070710_10003009 3300005437 Bacteria 8016
40 Ga0070710_10128048 3300005437 Bacteria 1544
41 Ga0070711_100043044 3300005439 Bacteria 3056
42 Ga0070663_100033372 3300005455 Bacteria 3556
43 Ga0070663_100067025 3300005455 Bacteria 2603
44 Ga0070663_100301617 3300005455 Bacteria 1282
45 Ga0070662_100097867 3300005457 Bacteria 2215
46 Ga0070681_10018303 3300005458 Bacteria 7001
47 Ga0070681_10039237 3300005458 Bacteria 4747
48 Ga0070681_10221653 3300005458 Bacteria 1806
49 Ga0070698_100013516 3300005471 Bacteria 8642
50 Ga0070684_100014665 3300005535 Bacteria 6356
51 Ga0070684_100191857 3300005535 Bacteria 1859
52 Ga0070697_100468120 3300005536 Bacteria 1099
53 Ga0068853_100047034 3300005539 Bacteria 3702
54 Ga0068853_100132298 3300005539 Bacteria 2234
55 Ga0068853_100262303 3300005539 Bacteria 1589
56 Ga0068853_100404795 3300005539 Bacteria 1278
57 Ga0068855_100017763 3300005563 Bacteria 8551
58 Ga0068855_100031717 3300005563 Bacteria 6309
59 Ga0070664_100063775 3300005564 Bacteria 3142
60 Ga0068857_100142520 3300005577 Bacteria 2167
61 Ga0068857_100176731 3300005577 Bacteria 1942
62 Ga0068857_100358954 3300005577 Bacteria 1350
63 Ga0068857_100404836 3300005577 Bacteria 1270
64 Ga0068856_100219740 3300005614 Bacteria 1915
65 Ga0070702_100094805 3300005615 Bacteria 1818
66 Ga0068852_100010094 3300005616 Bacteria 7030
67 Ga0068852_100524486 3300005616 Bacteria 1182
68 Ga0068864_100141029 3300005618 Bacteria 2174
69 Ga0068864_100231811 3300005618 Bacteria 1708
70 Ga0068861_100109478 3300005719 Bacteria 2211
71 Ga0068863_100628002 3300005841 Bacteria 1064
72 Ga0068862_100052050 3300005844 Bacteria 3502
73 Ga0068862_100099684 3300005844 Bacteria 2540
74 Ga0081455_10042189 3300005937 Bacteria 4005
75 Ga0081455_10042301 3300005937 Bacteria 3999
76 Ga0081540_1001897 3300005983 Bacteria 17504
77 Ga0081540_1003613 3300005983 Bacteria 12137
78 Ga0081539_10000945 3300005985 Bacteria 54444
79 Ga0070717_10007297 3300006028 Bacteria 8199
80 Ga0070717_10019413 3300006028 Bacteria 5329
81 Ga0070717_10142595 3300006028 Bacteria 2067
82 Ga0075365_10008873 3300006038 Bacteria 5740
83 Ga0075365_10161387 3300006038 Unclassified 1562
84 Ga0075368_10006951 3300006042 Bacteria 3979
85 Ga0075363_100043257 3300006048 Bacteria 2382
86 Ga0075364_10007096 3300006051 Bacteria 6624
87 Ga0075364_10008417 3300006051 Bacteria 6165
88 Ga0070715_10000729 3300006163 Bacteria 8879
89 Ga0070712_100027427 3300006175 Bacteria 3803
90 Ga0070712_100040008 3300006175 Bacteria 3211
91 Ga0075362_10014038 3300006177 Bacteria 3224
92 Ga0075367_10008803 3300006178 Bacteria 5249
93 Ga0075367_10049439 3300006178 Bacteria 2478
94 Ga0075367_10077069 3300006178 Bacteria 2012
95 Ga0075369_10030768 3300006186 Bacteria 2262
96 Ga0075369_10087434 3300006186 Bacteria 1388
97 Ga0075366_10004318 3300006195 Bacteria 7627
98 Ga0075366_10063342 3300006195 Bacteria 2198
99 Ga0075366_10067000 3300006195 Bacteria 2136
100 Ga0097621_100016142 3300006237 Bacteria 5638
101 Ga0097621_100307751 3300006237 Bacteria 1401
102 Ga0075370_10009166 3300006353 Bacteria 5124
103 Ga0075370_10025933 3300006353 Bacteria 3244
104 Ga0075370_10041524 3300006353 Bacteria 2596
105 Ga0068871_100162275 3300006358 Bacteria 1912
106 Ga0075434_100205515 3300006871 Bacteria 1989
107 Ga0099825_1032376 3300006941 Bacteria 2127
108 Ga0099824_1016133 3300006942 Bacteria 6855
109 Ga0099823_1044958 3300006944 Bacteria 2968
110 Ga0099794_10055211 3300007265 Bacteria 1919
111 Ga0105251_10164062 3300009011 Bacteria 1002
112 Ga0105240_10031852 3300009093 Bacteria 6832
113 Ga0105240_10077493 3300009093 Bacteria 4095
114 Ga0105240_10125673 3300009093 Bacteria 3082
115 Ga0105245_10001585 3300009098 Bacteria 20674
116 Ga0105245_10004121 3300009098 Bacteria 12904
117 Ga0105243_10650653 3300009148 Bacteria 1021
118 Ga0105241_10023166 3300009174 Bacteria 4603
119 Ga0105241_10033535 3300009174 Bacteria 3854
120 Ga0105241_10057648 3300009174 Bacteria 2980
121 Ga0105241_10375328 3300009174 Bacteria 1241
122 Ga0105241_10499596 3300009174 Bacteria 1084
123 Ga0105248_10004940 3300009177 Bacteria 14731
124 Ga0105248_10012339 3300009177 Bacteria 9428
125 Ga0105248_10098240 3300009177 Bacteria 3298
126 Ga0105237_10014161 3300009545 Bacteria 8349
127 Ga0105237_10015754 3300009545 Bacteria 7862
128 Ga0105237_10051651 3300009545 Bacteria 4129
129 Ga0105237_10430259 3300009545 Bacteria 1325
130 Ga0105249_10288445 3300009553 Bacteria 1642
131 Ga0105239_10052215 3300010375 Bacteria 4482
132 Ga0105239_10181027 3300010375 Bacteria 2358
133 Ga0105239_10192370 3300010375 Bacteria 2284
134 Ga0105239_10250456 3300010375 Bacteria 1989
135 Ga0105246_10001515 3300011119 Bacteria 13777
136 Ga0105246_10096611 3300011119 Bacteria 2142
137 Ga0105246_10141857 3300011119 Bacteria 1808
138 Ga0105246_10172710 3300011119 Bacteria 1657
139 Ga0157370_10013630 3300013104 Bacteria 8365
140 Ga0157370_10083372 3300013104 Bacteria 3006
141 Ga0157370_10095939 3300013104 Bacteria 2782
142 Ga0157369_10026130 3300013105 Bacteria 6478
143 Ga0157369_10078089 3300013105 Bacteria 3547
144 Ga0157374_10033415 3300013296 Bacteria 4693
145 Ga0157374_10266386 3300013296 Bacteria 1689
146 Ga0157378_10158618 3300013297 Bacteria 2114
147 Ga0163162_10138456 3300013306 Bacteria 2545
148 Ga0163162_10219951 3300013306 Bacteria 2029
149 Ga0157372_10209269 3300013307 Bacteria 2260
150 Ga0163163_10017116 3300014325 Bacteria 6752
151 Ga0157377_10133828 3300014745 Bacteria 1517
152 Ga0157376_10043971 3300014969 Bacteria 3669
153 Ga0209563_101494 3300025230 Bacteria 6143
154 Ga0207425_1017592 3300025245 Bacteria 1567
155 Ga0209677_105896 3300025253 Bacteria 3061
156 Ga0209148_1000344 3300025254 Bacteria 61011
157 Ga0209233_1005823 3300025261 Bacteria 4049
158 Ga0209673_1024307 3300025273 Bacteria 2039
159 Ga0209564_1002208 3300025295 Bacteria 16231
160 Ga0209758_1000407 3300025297 Bacteria 73945
161 Ga0209758_1000900 3300025297 Bacteria 40401
162 Ga0209758_1000952 3300025297 Bacteria 39040
163 Ga0209758_1011752 3300025297 Bacteria 5019
164 Ga0209758_1030934 3300025297 Bacteria 2206
165 Ga0209256_1019540 3300025299 Bacteria 2151
166 Ga0207426_1000466 3300025302 Bacteria 62533
167 Ga0207426_1000865 3300025302 Bacteria 31635
168 Ga0207426_1003194 3300025302 Bacteria 9234
169 Ga0207426_1008651 3300025302 Bacteria 4086
170 Ga0207426_1024999 3300025302 Bacteria 2018
171 Ga0209257_1001445 3300025304 Bacteria 28079
172 Ga0207697_10032884 3300025315 Bacteria 2123
173 Ga0207697_10060508 3300025315 Bacteria 1575
174 Ga0207692_10000318 3300025898 Bacteria 16715
175 Ga0207692_10027670 3300025898 Bacteria 2673
176 Ga0207692_10140739 3300025898 Bacteria 1372
177 Ga0207692_10189975 3300025898 Bacteria 1202
178 Ga0207710_10130873 3300025900 Bacteria 1205
179 Ga0207647_10008614 3300025904 Bacteria 7300
180 Ga0207685_10001710 3300025905 Bacteria 4749
181 Ga0207685_10049864 3300025905 Bacteria 1610
182 Ga0207699_10021869 3300025906 Bacteria 3456
183 Ga0207699_10064756 3300025906 Bacteria 2213
184 Ga0207643_10216684 3300025908 Bacteria 1170
185 Ga0207684_10037545 3300025910 Bacteria 4111
186 Ga0207684_10200944 3300025910 Bacteria 1719
187 Ga0207654_10001150 3300025911 Bacteria 14244
188 Ga0207654_10084567 3300025911 Bacteria 1918
189 Ga0207654_10170555 3300025911 Bacteria 1413
190 Ga0207707_10001119 3300025912 Bacteria 25478
191 Ga0207707_10003222 3300025912 Bacteria 14487
192 Ga0207707_10007981 3300025912 Bacteria 9195
193 Ga0207707_10220119 3300025912 Bacteria 1652
194 Ga0207707_10234549 3300025912 Bacteria 1596
195 Ga0207695_10000029 3300025913 Bacteria 548364
196 Ga0207695_10063666 3300025913 Bacteria 3801
197 Ga0207695_10074630 3300025913 Bacteria 3453
198 Ga0207695_10275109 3300025913 Bacteria 1578
199 Ga0207671_10005971 3300025914 Bacteria 11027
200 Ga0207671_10048682 3300025914 Bacteria 3137
201 Ga0207671_10143580 3300025914 Bacteria 1841
202 Ga0207671_10164947 3300025914 Bacteria 1717
203 Ga0207693_10027725 3300025915 Bacteria 4477
204 Ga0207663_10002625 3300025916 Bacteria 8648
205 Ga0207663_10303285 3300025916 Bacteria 1194
206 Ga0207660_10012652 3300025917 Bacteria 5527
207 Ga0207660_10038528 3300025917 Bacteria 3338
208 Ga0207660_10084511 3300025917 Bacteria 2339
209 Ga0207660_10334749 3300025917 Bacteria 1211
210 Ga0207657_10064333 3300025919 Bacteria 3131
211 Ga0207657_10250543 3300025919 Bacteria 1412
212 Ga0207652_10008142 3300025921 Bacteria 8418
213 Ga0207652_10010456 3300025921 Bacteria 7470
214 Ga0207652_10026854 3300025921 Bacteria 4798
215 Ga0207694_10221557 3300025924 Bacteria 1543
216 Ga0207650_10091560 3300025925 Bacteria 2324
217 Ga0207687_10055275 3300025927 Bacteria 2781
218 Ga0207700_10007250 3300025928 Bacteria 6764
219 Ga0207700_10022832 3300025928 Bacteria 4299
220 Ga0207700_10511229 3300025928 Bacteria 1063
221 Ga0207664_10204060 3300025929 Bacteria 1708
222 Ga0207644_10086201 3300025931 Bacteria 2331
223 Ga0207690_10531007 3300025932 Bacteria 955
224 Ga0207706_10125734 3300025933 Bacteria 2255
225 Ga0207706_10326521 3300025933 Bacteria 1335
226 Ga0207709_10026733 3300025935 Bacteria 3317
227 Ga0207665_10000311 3300025939 Bacteria 33740
228 Ga0207711_10212668 3300025941 Bacteria 1767
229 Ga0207711_10224952 3300025941 Bacteria 1717
230 Ga0207689_10014007 3300025942 Bacteria 6827
231 Ga0207661_10008392 3300025944 Bacteria 7381
232 Ga0207679_10034372 3300025945 Bacteria 3576
233 Ga0207667_10037454 3300025949 Bacteria 5183
234 Ga0207667_10134031 3300025949 Bacteria 2551
235 Ga0207667_10728591 3300025949 Bacteria 992
236 Ga0207651_10096664 3300025960 Bacteria 2179
237 Ga0207668_10139792 3300025972 Bacteria 1860
238 Ga0207658_10030261 3300025986 Bacteria 3832
239 Ga0207658_10576004 3300025986 Bacteria 1009
240 Ga0207677_10013899 3300026023 Bacteria 4679
241 Ga0207703_10162839 3300026035 Bacteria 1955
242 Ga0207639_10456198 3300026041 Bacteria 1161
243 Ga0207678_10042504 3300026067 Bacteria 3937
244 Ga0207678_10523324 3300026067 Bacteria 1035
245 Ga0207702_10734210 3300026078 Bacteria 974
246 Ga0207676_10236809 3300026095 Bacteria 1635
247 Ga0207674_10056763 3300026116 Bacteria 3973
248 Ga0207674_10068547 3300026116 Bacteria 3570
249 Ga0207674_10371185 3300026116 Bacteria 1383
250 Ga0207675_100154789 3300026118 Bacteria 2184
251 Ga0207698_10015126 3300026142 Bacteria 5158
252 Ga0207698_10459006 3300026142 Bacteria 1232
253 Ga0209389_1000011 3300027296 Bacteria 223265
254 Ga0209389_1000025 3300027296 Bacteria 149588
255 Ga0209589_1000066 3300027357 Bacteria 100795
256 Ga0209489_100017 3300027361 Bacteria 223265
257 Ga0209489_100030 3300027361 Bacteria 185999
258 Ga0209700_100027 3300027363 Bacteria 223462
259 Ga0209179_1006560 3300027512 Bacteria 1883
260 Ga0209588_1002751 3300027671 Bacteria 4807
261 Ga0268264_10134165 3300028381 Bacteria 2199
262 Ga0265762_1034850 3300030760 Bacteria 967
263 Ga0265314_10071779 3300031711 Bacteria 2315
264 Ga0265342_10021560 3300031712 Bacteria 4111
265 Ga0307516_10062981 3300031730 Bacteria 3592
266 Ga0307510_10042405 3300033180 Bacteria 4959
267 Ga0316215_1000880 3300033544 Bacteria 2949
268 Ga0373944_0048648 3300035089 Bacteria 1331
269 Ga0373936_0108395 3300035113 Bacteria 1177
270 Ga0373936_0120468 3300035113 Bacteria 1120
271 Ga0373945_0064938 3300035116 Bacteria 1369
272 Ga0373957_0051449 3300035120 Bacteria 1576
273 Ga0373943_0005471 3300035170 Bacteria 5717
274 Ga0373943_0031479 3300035170 Bacteria 2517
275 Ga0373946_0027185 3300035171 Bacteria 2261
276 Ga0373955_0009368 3300035172 Bacteria 4583
277 Ga0373955_0019488 3300035172 Bacteria 3392
278 Ga0373924_0069072 3300035410 Bacteria 1488
279 Ga0373935_0010393 3300035692 Bacteria 5581
280 Ga0373927_0000515 3300035695 Bacteria 29473
281 Ga0373933_0008698 3300035724 Bacteria 5535
282 Ga0373933_0037509 3300035724 Bacteria 2843
283 Ga0373947_0011552 3300035725 Bacteria 5065
284 Ga0373947_0027207 3300035725 Bacteria 3346
285 Ga0373937_0368708 3300036401 Bacteria 1361
286 Ga0373937_0503138 3300036401 Bacteria 1151
287 Ga0373925_0001116 3300037068 Bacteria 23846
288 Ga0373925_0052470 3300037068 Bacteria 3046
289 Ga0395900_0001980 3300037418 Bacteria 23121
290 Ga0395898_0018122 3300037466 Bacteria 7186
291 Ga0395905_0015966 3300037471 Bacteria 7137
292 Ga0395905_0083925 3300037471 Bacteria 2984
293 Ga0395905_0311355 3300037471 Bacteria 1463
294 Ga0395901_0026781 3300038443 Bacteria 5920
295 Ga0395901_0071278 3300038443 Bacteria 3621
296 Ga0395901_0093836 3300038443 Bacteria 3143
297 Ga0395901_0148346 3300038443 Bacteria 2465
298 Ga0436361_1211699 3300039447 Bacteria 1967
299 Ga0436363_0232520 3300039450 Bacteria 4878
300 Ga0466972_0000261 3300044658 Bacteria 34759
301 Ga0466972_0008229 3300044658 Bacteria 5228
302 Ga0466966_0000211 3300044684 Bacteria 38929
303 Ga0466966_0205536 3300044684 Bacteria 1191
304 Ga0466961_0005032 3300044693 Bacteria 8314
305 Ga0466961_0165283 3300044693 Bacteria 1378
306 Ga0466963_0221714 3300044694 Bacteria 1324
307 Ga0466971_0037598 3300044719 Bacteria 2170
308 Ga0466968_0001473 3300044735 Bacteria 8432
309 Ga0466970_0296155 3300044765 Bacteria 912
310 Ga0466957_0017412 3300044842 Bacteria 4208
311 Ga0466960_0002388 3300044901 Bacteria 7066
312 Ga0466959_0011922 3300045049 Bacteria 6266
313 Ga0466959_0012080 3300045049 Bacteria 6231
314 Ga0495592_0032474 3300046454 Bacteria 3938
315 Ga0495592_0195789 3300046454 Bacteria 1367
316 Ga0495603_0000156 3300046455 Bacteria 34369
317 Ga0495629_0000297 3300046459 Bacteria 42433
318 Ga0495629_0014255 3300046459 Bacteria 5724
319 Ga0495629_0085568 3300046459 Bacteria 2200
320 Ga0495629_0119612 3300046459 Bacteria 1835
321 Ga0495638_0009098 3300046460 Bacteria 6993
322 Ga0495641_0003323 3300046461 Bacteria 12109
323 Ga0495651_0152145 3300046462 Bacteria 1666
324 Ga0495651_0205242 3300046462 Bacteria 1376
325 Ga0495653_0081497 3300046463 Bacteria 2391
326 Ga0495653_0102683 3300046463 Bacteria 2069
327 Ga0495580_0004927 3300046472 Bacteria 11163
328 Ga0495582_0000087 3300046473 Bacteria 47529
329 Ga0495582_0145047 3300046473 Bacteria 1346
330 Ga0495639_0003735 3300046475 Bacteria 6549
331 Ga0495639_0053073 3300046475 Bacteria 1846
332 Ga0495662_0001853 3300046476 Bacteria 10603
333 Ga0495662_0106921 3300046476 Bacteria 1370
334 Ga0495664_0036389 3300046477 Bacteria 2901
335 Ga0495664_0122796 3300046477 Bacteria 1570
336 Ga0495594_0000722 3300046499 Bacteria 16979
337 Ga0495583_0025158 3300046506 Bacteria 2979
338 Ga0495606_0034700 3300046507 Bacteria 3459
339 Ga0495608_0012913 3300046511 Bacteria 5797
340 Ga0495610_0039636 3300046512 Bacteria 2381
341 Ga0495618_0018261 3300046514 Bacteria 4306
342 Ga0495618_0077691 3300046514 Bacteria 2115
343 Ga0495628_0061710 3300046516 Bacteria 2940
344 Ga0495628_0270695 3300046516 Bacteria 1263
345 Ga0495628_0347869 3300046516 Bacteria 1090
346 Ga0495630_0004575 3300046517 Bacteria 9693
347 Ga0495648_0013331 3300046524 Bacteria 6084
348 Ga0495648_0161593 3300046524 Bacteria 1157
349 Ga0495652_0048579 3300046529 Bacteria 3635
350 Ga0495652_0167152 3300046529 Bacteria 1701
351 Ga0495652_0178992 3300046529 Bacteria 1629
352 Ga0495652_0264297 3300046529 Bacteria 1268
353 Ga0495665_0000117 3300046531 Bacteria 37802
354 Ga0495640_0014622 3300046533 Bacteria 5930
355 Ga0495640_0038248 3300046533 Bacteria 3376
356 Ga0495640_0126489 3300046533 Bacteria 1657
357 Ga0495586_0208382 3300046535 Bacteria 1109
358 Ga0495587_0152159 3300046536 Bacteria 1318
359 Ga0495597_0029333 3300046542 Bacteria 2512
360 Ga0495622_0034064 3300046557 Bacteria 2376
361 Ga0495667_0010331 3300046559 Bacteria 6314
362 Ga0495667_0064983 3300046559 Bacteria 2386
363 Ga0495667_0292051 3300046559 Bacteria 1034
364 Ga0495667_0296516 3300046559 Bacteria 1025
365 Ga0495668_0198568 3300046616 Bacteria 1098
366 Ga0495634_0005647 3300046642 Bacteria 9582
367 Ga0495634_0057409 3300046642 Bacteria 2598
368 Ga0495634_0084852 3300046642 Bacteria 2065
369 Ga0495611_0120783 3300046648 Bacteria 1222
370 Ga0495625_0011551 3300046660 Bacteria 7194
371 Ga0495625_0205447 3300046660 Bacteria 1297
372 Ga0495635_0002863 3300046663 Bacteria 11862
373 Ga0495635_0007694 3300046663 Bacteria 7517
374 Ga0495635_0298433 3300046663 Bacteria 1080
375 Ga0495657_0009077 3300046675 Bacteria 7557
376 Ga0495657_0014067 3300046675 Bacteria 5878
377 Ga0495599_0116566 3300046678 Bacteria 1661
378 Ga0495623_0111389 3300046679 Bacteria 1658
379 Ga0495646_0019514 3300046680 Bacteria 4291
380 Ga0495647_0000849 3300046681 Bacteria 9146
381 Ga0495658_0000331 3300046683 Bacteria 26505
382 Ga0495613_0008600 3300046689 Bacteria 7576
383 Ga0495613_0070731 3300046689 Bacteria 2544
384 Ga0495624_0001012 3300046690 Bacteria 22250
385 Ga0495624_0110149 3300046690 Bacteria 1693
386 Ga0495649_0070668 3300046694 Bacteria 1871
387 Ga0495649_0116789 3300046694 Bacteria 1412
388 Ga0495600_0032498 3300046809 Bacteria 3386
389 Ga0495600_0111490 3300046809 Bacteria 1781
390 Ga0495581_0000543 3300047315 Bacteria 19442
391 Ga0495581_0139496 3300047315 Bacteria 1414
392 Ga0495581_0160633 3300047315 Bacteria 1313
393 Ga0495604_0045510 3300047317 Bacteria 3424
394 Ga0495604_0134140 3300047317 Bacteria 1776
395 Ga0495674_0000177 3300047319 Bacteria 50030
396 Ga0495674_0055953 3300047319 Bacteria 3457
397 Ga0495676_0052488 3300047321 Bacteria 3254
398 Ga0495676_0158294 3300047321 Bacteria 1605
399 Ga0495676_0206390 3300047321 Bacteria 1362
400 Ga0495680_0077188 3300047322 Bacteria 2523
401 Ga0495687_018792 3300047443 Bacteria 3407
402 Ga0495675_0053976 3300047444 Bacteria 2550
403 Ga0495673_0007095 3300047469 Bacteria 6493
404 Ga0495684_0000357 3300047471 Bacteria 36963
405 Ga0495684_0015566 3300047471 Bacteria 5855
406 Ga0495684_0016950 3300047471 Bacteria 5612
407 Ga0495684_0049442 3300047471 Bacteria 3212
408 Ga0495686_0044369 3300047472 Bacteria 2815
409 Ga0495593_0000156 3300047673 Bacteria 34308
410 Ga0495593_0049272 3300047673 Bacteria 2236
411 Ga0495602_0210882 3300048088 Bacteria 1474
412 Ga0495614_0086117 3300048089 Bacteria 1364
413 Ga0496102_0010378 3300048905 Bacteria 8014
414 Ga0496103_0020315 3300048906 Bacteria 3989
415 Ga0496104_0019267 3300048907 Bacteria 6240
416 Ga0496104_0097493 3300048907 Bacteria 2814
417 Ga0496104_0543750 3300048907 Bacteria 1072
418 Ga0496105_0063051 3300048908 Bacteria 3058
419 Ga0496106_0017841 3300048909 Bacteria 5248
420 Ga0496108_0040294 3300048911 Bacteria 3893
421 Ga0496108_0328005 3300048911 Bacteria 1334
422 Ga0496109_0257512 3300048912 Bacteria 1643
423 Ga0496109_0387527 3300048912 Bacteria 1320
424 Ga0496110_0021826 3300048913 Bacteria 5428
425 Ga0496110_0041338 3300048913 Bacteria 4022
426 Ga0496110_0205828 3300048913 Bacteria 1788
427 Ga0496111_0150775 3300048914 Bacteria 1724
428 Ga0496111_0538468 3300048914 Bacteria 858
429 Ga0496112_0062188 3300048915 Bacteria 3682
430 Ga0496112_0098946 3300048915 Bacteria 2886
431 Ga0496112_0296889 3300048915 Bacteria 1561
432 Ga0496112_0388751 3300048915 Bacteria 1335
433 Ga0496113_0046252 3300048916 Bacteria 3230
434 Ga0496114_0242677 3300048917 Bacteria 1585
435 Ga0496114_0353741 3300048917 Bacteria 1299
436 Ga0496115_0074634 3300048918 Bacteria 2754
437 Ga0496115_0147902 3300048918 Bacteria 1939
438 Ga0496117_0080961 3300048920 Bacteria 2133
439 Ga0496119_0081115 3300048922 Bacteria 1869
440 Ga0496119_0174238 3300048922 Bacteria 1133
441 Ga0496120_0010597 3300048923 Bacteria 6411
442 Ga0496121_0035122 3300048924 Bacteria 4498
443 Ga0496121_0055828 3300048924 Bacteria 3287
444 Ga0496121_0250475 3300048924 Bacteria 1228
445 Ga0496121_0389356 3300048924 Bacteria 916
446 Ga0496123_0088746 3300048926 Bacteria 1845
447 Ga0496124_0178147 3300048927 Bacteria 1638
448 Ga0496124_0301428 3300048927 Bacteria 1157
449 Ga0496125_0096219 3300048928 Bacteria 2199
450 Ga0496126_0172539 3300048929 Bacteria 1841
451 Ga0495678_092178 3300049459 Bacteria 1065
452 Ga0495682_0031543 3300049460 Bacteria 1958
453 Ga0501071_0200210 3300049587 Bacteria 1500
454 Ga0501076_0176722 3300049592 Bacteria 1740
455 nmdc:mga03683_55123_c1 3300050489 Bacteria 1669
456 nmdc:mga03n38_152974_c1 3300050490 Bacteria 1162
457 nmdc:mga03n38_6610_c1 3300050490 Bacteria 4043
458 nmdc:mga00v17_114536_c1 3300050491 Bacteria 1713
459 nmdc:mga00v17_173408_c1 3300050491 Bacteria 1391
460 nmdc:mga00v17_35992_c1 3300050491 Bacteria 2949
461 nmdc:mga0yw44_21091_c1 3300050492 Bacteria 3629
462 nmdc:mga0yw44_34705_c1 3300050492 Bacteria 2958
463 nmdc:mga0yw44_363580_c1 3300050492 Unclassified 975
464 nmdc:mga0yw44_73169_c1 3300050492 Bacteria 2132
465 nmdc:mga0k408_5049_c1 3300050493 Bacteria 6988
466 nmdc:mga0k408_73421_c1 3300050493 Bacteria 1998
467 nmdc:mga06z11_102459_c1 3300050494 Bacteria 1573
468 nmdc:mga06z11_10611_c1 3300050494 Bacteria 3934
469 nmdc:mga04h51_36793_c1 3300050495 Bacteria 1577
470 nmdc:mga07m45_105346_c1 3300050496 Bacteria 1622
471 nmdc:mga07m45_111515_c1 3300050496 Bacteria 1576
472 nmdc:mga07m45_189268_c1 3300050496 Bacteria 1197
473 nmdc:mga07m45_29462_c1 3300050496 Bacteria 3036
474 nmdc:mga07m45_75185_c1 3300050496 Bacteria 1925
475 nmdc:mga0n895_220181_c1 3300050512 Bacteria 1927
476 nmdc:mga0rr50_340956_c1 3300050513 Bacteria 1259
477 nmdc:mga0sz30_1122_c1 3300050516 Bacteria 9615
478 nmdc:mga0sz30_68994_c2 3300050516 Bacteria 1090
479 Ga0495601_0115025 3300053077 Bacteria 1744
480 Ga0495601_0140802 3300053077 Bacteria 1573
481 Ga0495619_0006157 3300053085 Bacteria 7601
482 Ga0495619_0169023 3300053085 Bacteria 1512
483 Ga0495619_0264354 3300053085 Bacteria 1192
484 Ga0500643_000019 3300053087 Bacteria 294301
485 Ga0500647_0166196 3300053091 Bacteria 1021
486 Ga0500651_0044361 3300053093 Bacteria 2800
487 Ga0500566_0001353 3300053094 Bacteria 14341
488 Ga0500566_0007323 3300053094 Bacteria 6536
489 Ga0500640_002668 3300053095 Bacteria 5968
490 Ga0500554_030255 3300053102 Bacteria 1590
491 Ga0500556_0027156 3300053104 Bacteria 1908
492 Ga0500557_000149 3300053105 Bacteria 16191
493 Ga0500562_005797 3300053108 Bacteria 3109
494 Ga0500569_021894 3300053109 Bacteria 1695
495 Ga0500580_050558 3300053113 Bacteria 1749
496 Ga0500591_089605 3300053115 Bacteria 1346
497 Ga0500595_000651 3300053119 Bacteria 20888
498 Ga0500595_030868 3300053119 Bacteria 1801
499 Ga0500597_142710 3300053120 Bacteria 1031
500 Ga0500607_012439 3300053121 Bacteria 4992
501 Ga0500608_005278 3300053122 Bacteria 5114
502 Ga0500608_057597 3300053122 Bacteria 1861
503 Ga0500614_006096 3300053123 Bacteria 2536
504 Ga0500618_027048 3300053125 Bacteria 1366
505 Ga0500621_054857 3300053126 Bacteria 1612
506 Ga0500642_0000063 3300053130 Bacteria 58680
507 Ga0500642_0004724 3300053130 Bacteria 4307
508 Ga0500652_062106 3300053131 Bacteria 1540
509 Ga0500655_009335 3300053133 Bacteria 1768
510 Ga0500559_0043444 3300053136 Bacteria 1963
511 Ga0500559_0053205 3300053136 Bacteria 1791
512 Ga0500588_0021225 3300053146 Bacteria 1751
513 Ga0500590_110155 3300053148 Bacteria 1307
514 Ga0500604_0027833 3300053151 Bacteria 1638
515 Ga0500616_0000045 3300053153 Bacteria 339292
516 Ga0500616_0062461 3300053153 Bacteria 1924
517 Ga0500622_0008022 3300053156 Bacteria 5942
518 Ga0500630_004105 3300053159 Bacteria 7089
519 Ga0500634_0089276 3300053161 Bacteria 1569
520 Ga0500638_008408 3300053162 Bacteria 4398
521 Ga0500639_000007 3300053163 Bacteria 152350
522 Ga0500636_0000194 3300053177 Bacteria 32748
523 Ga0500637_0000502 3300053178 Bacteria 15181
524 Ga0500649_129715 3300053722 Bacteria 945
525 Ga0500625_003068 3300053729 Bacteria 6482
526 Ga0500645_024565 3300053730 Bacteria 1841
527 Ga0500609_000571 3300053731 Bacteria 5571
528 Ga0500596_000834 3300053735 Bacteria 6103
529 Ga0500661_000333 3300055283 Bacteria 8566
530 Ga0501082_0258657 3300060353 Bacteria 1514
531 2508544073 2508501009 Bacteria 7784016
532 2508697989 2508501042 Bacteria 8719808
533 2511398633 2511231028 Bacteria 8046582
534 2513628069 2513237092 Bacteria 8341956
535 2513643599 2513237094 Bacteria 8789602
536 2513648961 2513237095 Bacteria 8976980
537 2513705940 2513237102 Bacteria 7703324
538 2513878075 2513237139 Bacteria 8737671
539 2514012628 2513237161 Bacteria 8871253
540 2515629423 2515154112 Bacteria 8294334
541 2517107572 2517093001 Bacteria 9002274
542 2524439104 2524023205 Bacteria 8918781
543 2528849645 2528768022 Bacteria 10457665
544 2617353030 2617270735 Bacteria 9163226
545 2617378995 2617270741 Bacteria 8201522
546 2745078783 2744054633 Bacteria 8678936
547 2793059949 2791355196 Bacteria 7323613
548 2793078717
549 2805920035 2802429603 Bacteria 8777136
550 2818241635 2816332527 Bacteria 8933356
551 2824606205 2824600985 Bacteria 8488197
552 2824609813 2824609381 Bacteria 8672835
553 2824622756 2824617872 Bacteria 8814715
554 2824632411 2824626560 Bacteria 8813858
555 2824640430 2824635225 Bacteria 8785348
556 2824647419 2824644064 Bacteria 8743947
557 2824657696 2824653114 Bacteria 8493680
558 2824668745 2824661429 Bacteria 9877870
559 2824674297 2824671348 Bacteria 8369588
560 2824682583 2824679649 Bacteria 8248951
561 2824690919 2824687955 Bacteria 8360029
562 2824698505 2824696289 Bacteria 8335049
563 2824708343 2824704595 Bacteria 9667483
564 2824721455 2824714736 Bacteria 8717648
565 2824728690 2824723954 Bacteria 8758240
566 2824736336 2824732956 Bacteria 7810675
567 2824750005 2824746037 Bacteria 7911610
568 2824758948 2824753945 Bacteria 9787441
569 2824766124 2824763712 Bacteria 9792355
570 2824778232 2824773399 Bacteria 8360218
571 2838127486 2838122688 Bacteria 8803140
572 2841941561 2841941048 Bacteria 8688029
573 2841952423 2841949485 Bacteria 8680857
574 2841959442 2841957949 Bacteria 8652217
575 2841967705 2841966195 Bacteria 8673214
576 2841982129 2841974524 Bacteria 8931498
577 2841986447 2841983080 Bacteria 8395090
578 2842038211 2842038055 Bacteria 8002051
579 2842048843 2842045827 Bacteria 8006841
580 2844317693 2844315083 Bacteria 8138177
581 2847934482 2847930680 Bacteria 9342022
582 2847945084 2847939898 Bacteria 8606328
583 2849080730 2849076700 Bacteria 7039503
584 2857509910 2857509624 Bacteria 7472071
585 2874593273 2874590934 Bacteria 8299676
586 2874618183 2874612657 Bacteria 8252029
587 2874623169 2874620515 Bacteria 8290088
588 2874636086 2874628541 Bacteria 8630250
589 2874652952 2874645413 Bacteria 8214782
590 2876766733 2876761206 Bacteria 10111113
591 2876773313 2876771140 Bacteria 8287509
592 2876821266 2876818435 Bacteria 8274608
593 2879077229 2879074833 Bacteria 8279565
594 2879089675 2879083081 Bacteria 8587928
595 2879107687 2879099564 Bacteria 10442239
596 2879130214 2879127579 Bacteria 8294491
597 2879146729 2879142872 Bacteria 8267021
598 2881365717 2881364244 Bacteria 7710352
599 2881670928 2881665667 Bacteria 8175609
600 2885368891 2885366525 Bacteria 8326213
601 2885391157 2885383462 Bacteria 9473874
602 2885410173 2885409591 Bacteria 9235467
603 2888382414 2888378607 Bacteria 9652610
604 2888388278 2888388044 Bacteria 7304136
605 2888423001 2888419890 Bacteria 7857137
606 2903735373 2903727486 Bacteria 8281579
607 2904669989 2904666416 Bacteria 8226587
608 2904697020 2904690495 Bacteria 9412302
609 2904700482
610 2904718524 2904711408 Bacteria 9771557
611 2906608708 2906602504 Bacteria 8295279
612 2906616313
613 2906630145 2906626472 Bacteria 8826946
614 2906646644 2906643746 Bacteria 8722424
615 2908762712 2908756301 Bacteria 8864324
616 2908778666 2908775508 Bacteria 8092255
617 2922361365 2922361189 Bacteria 7436256
618 2922375548
619 2922394941 2922393267 Bacteria 8285685
620 2922431689
621 2929616284 2929615660 Bacteria 9193770
622 2929625028 2929624759 Bacteria 9339455
623 2932787052 2932784394 Bacteria 9704911
624 2932797279 2932794094 Bacteria 7915132
625 2932804836 2932801729 Bacteria 7987968
626 2932811247 2932809354 Bacteria 9135765
627 2932819880 2932818245 Bacteria 9955613
628 2932832359 2932828146 Bacteria 9745859
629 2933578432 2933577622 Bacteria 9116884
630 2935611024 2935608549 Bacteria 8203142
631 2935619070 2935616580 Bacteria 9032984
632 2935643112 2935638405 Bacteria 10015038
633 2935648455 2935648319 Bacteria 8801166
634 2935657557 2935656913 Bacteria 8965014
635 2935669739 2935665750 Bacteria 9571747
636 2935677121 2935675223 Bacteria 9928132
637 2935693156 2935684952 Bacteria 9590419
638 2935695350 2935694250 Bacteria 9291695
639 2935709541 2935703347 Bacteria 10242284
640 2935719764 2935713505 Bacteria 9608509
641 2935729469 2935722832 Bacteria 9608746
642 2935739647 2935732158 Bacteria 9706831
643 2935748685 2935741537 Bacteria 9707219
644 2935756728 2935750917 Bacteria 9590372
645 2935761287 2935760218 Bacteria 9817913
646 2935771439 2935769743 Bacteria 7878163
647 2935779128 2935777560 Bacteria 8077691
648 2935788332 2935785616 Bacteria 7962367
649 2935800869 2935793552 Bacteria 8012592
650 2935807260 2935801545 Bacteria 9301974
651 2935812399 2935810662 Bacteria 9401221
652 2935820509 2935819856 Bacteria 8261050
653 2935832743 2935827899 Bacteria 10038562
654 2935839177 2935837841 Bacteria 9454360
655 2935849482 2935847175 Bacteria 8228321
656 2935857435 2935855204 Bacteria 9035059
657 2935864965 2935864058 Bacteria 9784707
658 2935876743 2935873716 Bacteria 9632195
659 2935884928 2935883170 Bacteria 7964738
660 2935911744 2935908558 Bacteria 8568796
661 2935919399 2935916978 Bacteria 9113783
662 2935928773 2935926038 Bacteria 8601059
663 2935938418 2935934488 Bacteria 8602579
664 2935945690 2935942939 Bacteria 8599779
665 2935954703 2935951376 Bacteria 8602333
666 2935963304 2935959822 Bacteria 7869783
667 2935970590 2935967501 Bacteria 8603075
668 2935979174 2935975950 Bacteria 8347125
669 2935987814 2935984226 Bacteria 8302647
670 2935999644 2935992306 Bacteria 9802711
671 2936008334 2936002035 Bacteria 9362176
672 2936011365 2936011229 Bacteria 8801034
673 2936019960 2936019824 Bacteria 8804134
674 2936028556 2936028420 Bacteria 8965941
675 2936038992 2936037263 Bacteria 9446081
676 2936046683 2936046547 Bacteria 8903709
677 2936063066 2936055302 Bacteria 8785755
678 2940562642 2940556831 Bacteria 9590747
679 2941539867 2941538514 Bacteria 9402094
680 3005487894 3005483717 Bacteria 7877331
681 3005508786 3005506211 Bacteria 6943378
682 3005589400 3005587118 Bacteria 7794411
683 3005597426 3005594810 Bacteria 8716512
684 3005713458 3005710791 Bacteria 7622528
685 3005720868 3005718088 Bacteria 8283608
686 8006928755 8006926726 Bacteria 6749210
687 8006938892 8006933436 Bacteria 10410654
688 8006978662 8006973647 Bacteria 10679141
689 8006984799 8006984368 Bacteria 9651211
690 8016515156 8016511872 Bacteria 9921665
691 8016522946 8016522445 Bacteria 8156687
692 8016536407 8016530956 Bacteria 8155261
693 8016540687 8016539877 Bacteria 8155419
694 8016552560 8016548790 Bacteria 8155074
695 8016560936 8016557553 Bacteria 8154380
696 8016574770 8016566248 Bacteria 8158151
697 8016578844 8016575299 Bacteria 8154085
698 8016590792 8016583857 Bacteria 10421953
699 8016598804 8016595262 Bacteria 8149947
700 8016612277 8016603502 Bacteria 8731218
701 8016621530 8016613128 Bacteria 8794220
702 8016632630 8016630954 Bacteria 9217207
703 8017061298 8017057580 Bacteria 10023680
704 8019536128 8019530166 Bacteria 8155624
705 8019543343 8019538911 Bacteria 7872763
706 8019555513 8019547302 Bacteria 7996444
707 8019565088 8019555841 Bacteria 9642137
708 8019580767 8019576017 Bacteria 10049540
709 8019588500 8019586578 Bacteria 10212056
710 8019602837 8019597564 Bacteria 10041141
711 8019615718 8019608314 Bacteria 10042931
712 8019626466 8019619141 Bacteria 9218857
713 8019663790 8019659431 Bacteria 8577854
714 8019679798 8019678201 Bacteria 8863603
715 8019688391 8019687851 Bacteria 8712826
716 8055747930 8055742211 Bacteria 9226248
717 8056695065 8056689827 Bacteria 6712655
718 8056969495 8056967851 Bacteria 9038162
719 Ga0105237_10449661
720 JGI25406J46586_10001591
721 JGI25406J46586_10003138
722 JGI25153J46596_10001822
723 JGI25153J46596_10003459
724 JGI25153J46596_10004454
725 JGI25153J46596_10030199
726 JGI25160J50197_1000729
727 JGI25160J50197_1002598
728 JGI25404J52841_10009491
729 Ga0055542_1005244
730 Ga0055526_1051644
731 Ga0055531_10004381
732 JGI25405J52794_10035098
733 Ga0055543_1001967
734 Ga0065165_1000278
735 Ga0065165_1005698
736 Ga0065165_1010190
737 Ga0070683_100015396
738 Ga0070670_100061597
739 Ga0068869_100067311
740 Ga0070680_100007902
741 Ga0070680_100011830
742 Ga0068868_100004886
743 Ga0068868_100152190
744 Ga0070660_100099635
745 Ga0070660_100388847
746 Ga0070661_100282180
747 Ga0070668_100148632
748 Ga0070669_100265305
749 Ga0070675_100220742
750 Ga0070671_100012665
751 Ga0070673_100117541
752 Ga0070673_100147632
753 Ga0070709_10043295
754 Ga0070709_10066265
755 Ga0070709_10336632
756 Ga0070713_100003997
757 Ga0070710_10003009
758 Ga0070710_10128048
759 Ga0070711_100043044
760 Ga0070663_100033372
761 Ga0070663_100067025
762 Ga0070663_100301617
763 Ga0070662_100097867
764 Ga0070681_10018303
765 Ga0070681_10039237
766 Ga0070681_10221653
767 Ga0070698_100013516
768 Ga0070684_100014665
769 Ga0070684_100191857
770 Ga0070697_100468120
771 Ga0068853_100047034
772 Ga0068853_100132298
773 Ga0068853_100262303
774 Ga0068853_100404795
775 Ga0068855_100017763
776 Ga0068855_100031717
777 Ga0070664_100063775
778 Ga0068857_100142520
779 Ga0068857_100176731
780 Ga0068857_100358954
781 Ga0068857_100404836
782 Ga0068856_100219740
783 Ga0070702_100094805
784 Ga0068852_100010094
785 Ga0068852_100524486
786 Ga0068864_100141029
787 Ga0068864_100231811
788 Ga0068861_100109478
789 Ga0068863_100628002
790 Ga0068862_100052050
791 Ga0068862_100099684
792 Ga0081455_10042189
793 Ga0081455_10042301
794 Ga0081540_1001897
795 Ga0081540_1003613
796 Ga0081539_10000945
797 Ga0070717_10007297
798 Ga0070717_10019413
799 Ga0070717_10142595
800 Ga0075365_10008873
801 Ga0075365_10161387
802 Ga0075368_10006951
803 Ga0075363_100043257
804 Ga0075364_10007096
805 Ga0075364_10008417
806 Ga0070715_10000729
807 Ga0070712_100027427
808 Ga0070712_100040008
809 Ga0075362_10014038
810 Ga0075367_10008803
811 Ga0075367_10049439
812 Ga0075367_10077069
813 Ga0075369_10030768
814 Ga0075369_10087434
815 Ga0075366_10004318
816 Ga0075366_10063342
817 Ga0075366_10067000
818 Ga0097621_100016142
819 Ga0097621_100307751
820 Ga0075370_10009166
821 Ga0075370_10025933
822 Ga0075370_10041524
823 Ga0068871_100162275
824 Ga0075434_100205515
825 Ga0099825_1032376
826 Ga0099824_1016133
827 Ga0099823_1044958
828 Ga0099794_10055211
829 Ga0105251_10164062
830 Ga0105240_10031852
831 Ga0105240_10077493
832 Ga0105240_10125673
833 Ga0105245_10001585
834 Ga0105245_10004121
835 Ga0105243_10650653
836 Ga0105241_10023166
837 Ga0105241_10033535
838 Ga0105241_10057648
839 Ga0105241_10375328
840 Ga0105241_10499596
841 Ga0105248_10004940
842 Ga0105248_10012339
843 Ga0105248_10098240
844 Ga0105237_10014161
845 Ga0105237_10015754
846 Ga0105237_10051651
847 Ga0105237_10430259
848 Ga0105249_10288445
849 Ga0105239_10052215
850 Ga0105239_10181027
851 Ga0105239_10192370
852 Ga0105239_10250456
853 Ga0105246_10001515
854 Ga0105246_10096611
855 Ga0105246_10141857
856 Ga0105246_10172710
857 Ga0157370_10013630
858 Ga0157370_10083372
859 Ga0157370_10095939
860 Ga0157369_10026130
861 Ga0157369_10078089
862 Ga0157374_10033415
863 Ga0157374_10266386
864 Ga0157378_10158618
865 Ga0163162_10138456
866 Ga0163162_10219951
867 Ga0157372_10209269
868 Ga0163163_10017116
869 Ga0157377_10133828
870 Ga0157376_10043971
871 Ga0209563_101494
872 Ga0207425_1017592
873 Ga0209677_105896
874 Ga0209148_1000344
875 Ga0209233_1005823
876 Ga0209673_1024307
877 Ga0209564_1002208
878 Ga0209758_1000407
879 Ga0209758_1000900
880 Ga0209758_1000952
881 Ga0209758_1011752
882 Ga0209758_1030934
883 Ga0209256_1019540
884 Ga0207426_1000466
885 Ga0207426_1000865
886 Ga0207426_1003194
887 Ga0207426_1008651
888 Ga0207426_1024999
889 Ga0209257_1001445
890 Ga0207697_10032884
891 Ga0207697_10060508
892 Ga0207692_10000318
893 Ga0207692_10027670
894 Ga0207692_10140739
895 Ga0207692_10189975
896 Ga0207710_10130873
897 Ga0207647_10008614
898 Ga0207685_10001710
899 Ga0207685_10049864
900 Ga0207699_10021869
901 Ga0207699_10064756
902 Ga0207643_10216684
903 Ga0207684_10037545
904 Ga0207684_10200944
905 Ga0207654_10001150
906 Ga0207654_10084567
907 Ga0207654_10170555
908 Ga0207707_10001119
909 Ga0207707_10003222
910 Ga0207707_10007981
911 Ga0207707_10220119
912 Ga0207707_10234549
913 Ga0207695_10000029
914 Ga0207695_10063666
915 Ga0207695_10074630
916 Ga0207695_10275109
917 Ga0207671_10005971
918 Ga0207671_10048682
919 Ga0207671_10143580
920 Ga0207671_10164947
921 Ga0207693_10027725
922 Ga0207663_10002625
923 Ga0207663_10303285
924 Ga0207660_10012652
925 Ga0207660_10038528
926 Ga0207660_10084511
927 Ga0207660_10334749
928 Ga0207657_10064333
929 Ga0207657_10250543
930 Ga0207652_10008142
931 Ga0207652_10010456
932 Ga0207652_10026854
933 Ga0207694_10221557
934 Ga0207650_10091560
935 Ga0207687_10055275
936 Ga0207700_10007250
937 Ga0207700_10022832
938 Ga0207700_10511229
939 Ga0207664_10204060
940 Ga0207644_10086201
941 Ga0207690_10531007
942 Ga0207706_10125734
943 Ga0207706_10326521
944 Ga0207709_10026733
945 Ga0207665_10000311
946 Ga0207711_10212668
947 Ga0207711_10224952
948 Ga0207689_10014007
949 Ga0207661_10008392
950 Ga0207679_10034372
951 Ga0207667_10037454
952 Ga0207667_10134031
953 Ga0207667_10728591
954 Ga0207651_10096664
955 Ga0207668_10139792
956 Ga0207658_10030261
957 Ga0207658_10576004
958 Ga0207677_10013899
959 Ga0207703_10162839
960 Ga0207639_10456198
961 Ga0207678_10042504
962 Ga0207678_10523324
963 Ga0207702_10734210
964 Ga0207676_10236809
965 Ga0207674_10056763
966 Ga0207674_10068547
967 Ga0207674_10371185
968 Ga0207675_100154789
969 Ga0207698_10015126
970 Ga0207698_10459006
971 Ga0209389_1000011
972 Ga0209389_1000025
973 Ga0209589_1000066
974 Ga0209489_100017
975 Ga0209489_100030
976 Ga0209700_100027
977 Ga0209179_1006560
978 Ga0209588_1002751
979 Ga0268264_10134165
980 Ga0265762_1034850
981 Ga0265314_10071779
982 Ga0265342_10021560
983 Ga0307516_10062981
984 Ga0307510_10042405
985 Ga0316215_1000880
986 Ga0373944_0048648
987 Ga0373936_0108395
988 Ga0373936_0120468
989 Ga0373945_0064938
990 Ga0373957_0051449
991 Ga0373943_0005471
992 Ga0373943_0031479
993 Ga0373946_0027185
994 Ga0373955_0009368
995 Ga0373955_0019488
996 Ga0373924_0069072
997 Ga0373935_0010393
998 Ga0373927_0000515
999 Ga0373933_0008698
1000 Ga0373933_0037509
1001 Ga0373947_0011552
1002 Ga0373947_0027207
1003 Ga0373937_0368708
1004 Ga0373937_0503138
1005 Ga0373925_0001116
1006 Ga0373925_0052470
1007 Ga0395900_0001980
1008 Ga0395898_0018122
1009 Ga0395905_0015966
1010 Ga0395905_0083925
1011 Ga0395905_0311355
1012 Ga0395901_0026781
1013 Ga0395901_0071278
1014 Ga0395901_0093836
1015 Ga0395901_0148346
1016 Ga0436361_1211699
1017 Ga0436363_0232520
1018 Ga0466972_0000261
1019 Ga0466972_0008229
1020 Ga0466966_0000211
1021 Ga0466966_0205536
1022 Ga0466961_0005032
1023 Ga0466961_0165283
1024 Ga0466963_0221714
1025 Ga0466971_0037598
1026 Ga0466968_0001473
1027 Ga0466970_0296155
1028 Ga0466957_0017412
1029 Ga0466960_0002388
1030 Ga0466959_0011922
1031 Ga0466959_0012080
1032 Ga0495592_0032474
1033 Ga0495592_0195789
1034 Ga0495603_0000156
1035 Ga0495629_0000297
1036 Ga0495629_0014255
1037 Ga0495629_0085568
1038 Ga0495629_0119612
1039 Ga0495638_0009098
1040 Ga0495641_0003323
1041 Ga0495651_0152145
1042 Ga0495651_0205242
1043 Ga0495653_0081497
1044 Ga0495653_0102683
1045 Ga0495580_0004927
1046 Ga0495582_0000087
1047 Ga0495582_0145047
1048 Ga0495639_0003735
1049 Ga0495639_0053073
1050 Ga0495662_0001853
1051 Ga0495662_0106921
1052 Ga0495664_0036389
1053 Ga0495664_0122796
1054 Ga0495594_0000722
1055 Ga0495583_0025158
1056 Ga0495606_0034700
1057 Ga0495608_0012913
1058 Ga0495610_0039636
1059 Ga0495618_0018261
1060 Ga0495618_0077691
1061 Ga0495628_0061710
1062 Ga0495628_0270695
1063 Ga0495628_0347869
1064 Ga0495630_0004575
1065 Ga0495648_0013331
1066 Ga0495648_0161593
1067 Ga0495652_0048579
1068 Ga0495652_0167152
1069 Ga0495652_0178992
1070 Ga0495652_0264297
1071 Ga0495665_0000117
1072 Ga0495640_0014622
1073 Ga0495640_0038248
1074 Ga0495640_0126489
1075 Ga0495586_0208382
1076 Ga0495587_0152159
1077 Ga0495597_0029333
1078 Ga0495622_0034064
1079 Ga0495667_0010331
1080 Ga0495667_0064983
1081 Ga0495667_0292051
1082 Ga0495667_0296516
1083 Ga0495668_0198568
1084 Ga0495634_0005647
1085 Ga0495634_0057409
1086 Ga0495634_0084852
1087 Ga0495611_0120783
1088 Ga0495625_0011551
1089 Ga0495625_0205447
1090 Ga0495635_0002863
1091 Ga0495635_0007694
1092 Ga0495635_0298433
1093 Ga0495657_0009077
1094 Ga0495657_0014067
1095 Ga0495599_0116566
1096 Ga0495623_0111389
1097 Ga0495646_0019514
1098 Ga0495647_0000849
1099 Ga0495658_0000331
1100 Ga0495613_0008600
1101 Ga0495613_0070731
1102 Ga0495624_0001012
1103 Ga0495624_0110149
1104 Ga0495649_0070668
1105 Ga0495649_0116789
1106 Ga0495600_0032498
1107 Ga0495600_0111490
1108 Ga0495581_0000543
1109 Ga0495581_0139496
1110 Ga0495581_0160633
1111 Ga0495604_0045510
1112 Ga0495604_0134140
1113 Ga0495674_0000177
1114 Ga0495674_0055953
1115 Ga0495676_0052488
1116 Ga0495676_0158294
1117 Ga0495676_0206390
1118 Ga0495680_0077188
1119 Ga0495687_018792
1120 Ga0495675_0053976
1121 Ga0495673_0007095
1122 Ga0495684_0000357
1123 Ga0495684_0015566
1124 Ga0495684_0016950
1125 Ga0495684_0049442
1126 Ga0495686_0044369
1127 Ga0495593_0000156
1128 Ga0495593_0049272
1129 Ga0495602_0210882
1130 Ga0495614_0086117
1131 Ga0496102_0010378
1132 Ga0496103_0020315
1133 Ga0496104_0019267
1134 Ga0496104_0097493
1135 Ga0496104_0543750
1136 Ga0496105_0063051
1137 Ga0496106_0017841
1138 Ga0496108_0040294
1139 Ga0496108_0328005
1140 Ga0496109_0257512
1141 Ga0496109_0387527
1142 Ga0496110_0021826
1143 Ga0496110_0041338
1144 Ga0496110_0205828
1145 Ga0496111_0150775
1146 Ga0496111_0538468
1147 Ga0496112_0062188
1148 Ga0496112_0098946
1149 Ga0496112_0296889
1150 Ga0496112_0388751
1151 Ga0496113_0046252
1152 Ga0496114_0242677
1153 Ga0496114_0353741
1154 Ga0496115_0074634
1155 Ga0496115_0147902
1156 Ga0496117_0080961
1157 Ga0496119_0081115
1158 Ga0496119_0174238
1159 Ga0496120_0010597
1160 Ga0496121_0035122
1161 Ga0496121_0055828
1162 Ga0496121_0250475
1163 Ga0496121_0389356
1164 Ga0496123_0088746
1165 Ga0496124_0178147
1166 Ga0496124_0301428
1167 Ga0496125_0096219
1168 Ga0496126_0172539
1169 Ga0495678_092178
1170 Ga0495682_0031543
1171 Ga0501071_0200210
1172 Ga0501076_0176722
1173 nmdc:mga03683_55123_c1
1174 nmdc:mga03n38_152974_c1
1175 nmdc:mga03n38_6610_c1
1176 nmdc:mga00v17_114536_c1
1177 nmdc:mga00v17_173408_c1
1178 nmdc:mga00v17_35992_c1
1179 nmdc:mga0yw44_21091_c1
1180 nmdc:mga0yw44_34705_c1
1181 nmdc:mga0yw44_363580_c1
1182 nmdc:mga0yw44_73169_c1
1183 nmdc:mga0k408_5049_c1
1184 nmdc:mga0k408_73421_c1
1185 nmdc:mga06z11_102459_c1
1186 nmdc:mga06z11_10611_c1
1187 nmdc:mga04h51_36793_c1
1188 nmdc:mga07m45_105346_c1
1189 nmdc:mga07m45_111515_c1
1190 nmdc:mga07m45_189268_c1
1191 nmdc:mga07m45_29462_c1
1192 nmdc:mga07m45_75185_c1
1193 nmdc:mga0n895_220181_c1
1194 nmdc:mga0rr50_340956_c1
1195 nmdc:mga0sz30_1122_c1
1196 nmdc:mga0sz30_68994_c2
1197 Ga0495601_0115025
1198 Ga0495601_0140802
1199 Ga0495619_0006157
1200 Ga0495619_0169023
1201 Ga0495619_0264354
1202 Ga0500643_000019
1203 Ga0500647_0166196
1204 Ga0500651_0044361
1205 Ga0500566_0001353
1206 Ga0500566_0007323
1207 Ga0500640_002668
1208 Ga0500554_030255
1209 Ga0500556_0027156
1210 Ga0500557_000149
1211 Ga0500562_005797
1212 Ga0500569_021894
1213 Ga0500580_050558
1214 Ga0500591_089605
1215 Ga0500595_000651
1216 Ga0500595_030868
1217 Ga0500597_142710
1218 Ga0500607_012439
1219 Ga0500608_005278
1220 Ga0500608_057597
1221 Ga0500614_006096
1222 Ga0500618_027048
1223 Ga0500621_054857
1224 Ga0500642_0000063
1225 Ga0500642_0004724
1226 Ga0500652_062106
1227 Ga0500655_009335
1228 Ga0500559_0043444
1229 Ga0500559_0053205
1230 Ga0500588_0021225
1231 Ga0500590_110155
1232 Ga0500604_0027833
1233 Ga0500616_0000045
1234 Ga0500616_0062461
1235 Ga0500622_0008022
1236 Ga0500630_004105
1237 Ga0500634_0089276
1238 Ga0500638_008408
1239 Ga0500639_000007
1240 Ga0500636_0000194
1241 Ga0500637_0000502
1242 Ga0500649_129715
1243 Ga0500625_003068
1244 Ga0500645_024565
1245 Ga0500609_000571
1246 Ga0500596_000834
1247 Ga0500661_000333
1248 Ga0501082_0258657
1249 2508544073
1250 2508697989
1251 2511398633
1252 2513628069
1253 2513643599
1254 2513648961
1255 2513705940
1256 2513878075
1257 2514012628
1258 2515629423
1259 2517107572
1260 2524439104
1261 2528849645
1262 2617353030
1263 2617378995
1264 2745078783
1265 2793059949
1266 2793078717
1267 2805920035
1268 2818241635
1269 2824606205
1270 2824609813
1271 2824622756
1272 2824632411
1273 2824640430
1274 2824647419
1275 2824657696
1276 2824668745
1277 2824674297
1278 2824682583
1279 2824690919
1280 2824698505
1281 2824708343
1282 2824721455
1283 2824728690
1284 2824736336
1285 2824750005
1286 2824758948
1287 2824766124
1288 2824778232
1289 2838127486
1290 2841941561
1291 2841952423
1292 2841959442
1293 2841967705
1294 2841982129
1295 2841986447
1296 2842038211
1297 2842048843
1298 2844317693
1299 2847934482
1300 2847945084
1301 2849080730
1302 2857509910
1303 2874593273
1304 2874618183
1305 2874623169
1306 2874636086
1307 2874652952
1308 2876766733
1309 2876773313
1310 2876821266
1311 2879077229
1312 2879089675
1313 2879107687
1314 2879130214
1315 2879146729
1316 2881365717
1317 2881670928
1318 2885368891
1319 2885391157
1320 2885410173
1321 2888382414
1322 2888388278
1323 2888423001
1324 2903735373
1325 2904669989
1326 2904697020
1327 2904700482
1328 2904718524
1329 2906608708
1330 2906616313
1331 2906630145
1332 2906646644
1333 2908762712
1334 2908778666
1335 2922361365
1336 2922375548
1337 2922394941
1338 2922431689
1339 2929616284
1340 2929625028
1341 2932787052
1342 2932797279
1343 2932804836
1344 2932811247
1345 2932819880
1346 2932832359
1347 2933578432
1348 2935611024
1349 2935619070
1350 2935643112
1351 2935648455
1352 2935657557
1353 2935669739
1354 2935677121
1355 2935693156
1356 2935695350
1357 2935709541
1358 2935719764
1359 2935729469
1360 2935739647
1361 2935748685
1362 2935756728
1363 2935761287
1364 2935771439
1365 2935779128
1366 2935788332
1367 2935800869
1368 2935807260
1369 2935812399
1370 2935820509
1371 2935832743
1372 2935839177
1373 2935849482
1374 2935857435
1375 2935864965
1376 2935876743
1377 2935884928
1378 2935911744
1379 2935919399
1380 2935928773
1381 2935938418
1382 2935945690
1383 2935954703
1384 2935963304
1385 2935970590
1386 2935979174
1387 2935987814
1388 2935999644
1389 2936008334
1390 2936011365
1391 2936019960
1392 2936028556
1393 2936038992
1394 2936046683
1395 2936063066
1396 2940562642
1397 2941539867
1398 3005487894
1399 3005508786
1400 3005589400
1401 3005597426
1402 3005713458
1403 3005720868
1404 8006928755
1405 8006938892
1406 8006978662
1407 8006984799
1408 8016515156
1409 8016522946
1410 8016536407
1411 8016540687
1412 8016552560
1413 8016560936
1414 8016574770
1415 8016578844
1416 8016590792
1417 8016598804
1418 8016612277
1419 8016621530
1420 8016632630
1421 8017061298
1422 8019536128
1423 8019543343
1424 8019555513
1425 8019565088
1426 8019580767
1427 8019588500
1428 8019602837
1429 8019615718
1430 8019626466
1431 8019663790
1432 8019679798
1433 8019688391
1434 8055747930
1435 8056695065
1436 8056969495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

141

222

0.91

Map