F477144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 718 | 343 | 718 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100560360|Ga0070708_1005603602 |
| Length | 266 |
| Sequence | MRRTNFVHCDQWGYHEKVLAHCSRIDAGLCMSPFADLQATELKILAGGSMTGSLNELGPQFERASGHKLTIHFDSTPNLIKQATSGEPFDLAVVPVDVFKDTAAKARFVPGPTIDIARVCYGVIVRAGTPKPDVSTPDALKQTLLNAQSITFLPESAAGAYVLSVFSRLGISEAMKAKTRPQAAPAQIAHAVAKGEADLGVFLVNVLIAPGVELAGPFPAELQQELVFTSAVAADSKNAEAAKAFINYLMTPTAAAVIKAKGMAPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 180 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 215 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 290 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 291 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 292 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 313 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 332 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 333 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 334 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 335 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 342 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 343 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.52 |
| Nodule | 0 |
| Rhizoplane | 12.26 |
| Rhizosphere | 77.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003828 | 3300001977 | Bacteria | 2377 |
| 2 | JGI24737J22298_10020484 | 3300001990 | Bacteria | 2111 |
| 3 | JGI24748J21848_1000524 | 3300002074 | Bacteria | 4194 |
| 4 | JGI24738J21930_10017382 | 3300002075 | Bacteria | 1512 |
| 5 | JGI24744J21845_10004801 | 3300002077 | Bacteria | 2795 |
| 6 | JGI25404J52841_10003853 | 3300003659 | Bacteria | 3000 |
| 7 | JGI25404J52841_10015330 | 3300003659 | Bacteria | 1663 |
| 8 | JGI25405J52794_10045588 | 3300003911 | Bacteria | 933 |
| 9 | Ga0070690_100021813 | 3300005330 | Bacteria | 3914 |
| 10 | Ga0070670_100201244 | 3300005331 | Bacteria | 1730 |
| 11 | Ga0070670_100531736 | 3300005331 | Bacteria | 1048 |
| 12 | Ga0070677_10172808 | 3300005333 | Bacteria | 1023 |
| 13 | Ga0070677_10209931 | 3300005333 | Unclassified | 945 |
| 14 | Ga0068869_100277372 | 3300005334 | Bacteria | 1347 |
| 15 | Ga0070666_10071962 | 3300005335 | Bacteria | 2354 |
| 16 | Ga0070666_10237672 | 3300005335 | Bacteria | 1288 |
| 17 | Ga0070680_100268906 | 3300005336 | Bacteria | 1443 |
| 18 | Ga0070682_100122410 | 3300005337 | Bacteria | 1749 |
| 19 | Ga0070682_100280581 | 3300005337 | Bacteria | 1214 |
| 20 | Ga0068868_100022399 | 3300005338 | Bacteria | 4767 |
| 21 | Ga0068868_100389111 | 3300005338 | Bacteria | 1201 |
| 22 | Ga0068868_100521008 | 3300005338 | Bacteria | 1044 |
| 23 | Ga0070660_100098830 | 3300005339 | Bacteria | 2310 |
| 24 | Ga0070660_100112646 | 3300005339 | Bacteria | 2166 |
| 25 | Ga0070689_100001662 | 3300005340 | Bacteria | 14205 |
| 26 | Ga0070691_10011614 | 3300005341 | Bacteria | 4023 |
| 27 | Ga0070687_100029272 | 3300005343 | Bacteria | 2680 |
| 28 | Ga0070687_100092025 | 3300005343 | Bacteria | 1680 |
| 29 | Ga0070661_100036904 | 3300005344 | Bacteria | 3554 |
| 30 | Ga0070661_100267371 | 3300005344 | Bacteria | 1323 |
| 31 | Ga0070661_100371460 | 3300005344 | Bacteria | 1126 |
| 32 | Ga0070692_10027176 | 3300005345 | Bacteria | 2834 |
| 33 | Ga0070668_100038142 | 3300005347 | Bacteria | 3671 |
| 34 | Ga0070668_100343820 | 3300005347 | Bacteria | 1261 |
| 35 | Ga0070669_100069685 | 3300005353 | Bacteria | 2598 |
| 36 | Ga0070669_100096099 | 3300005353 | Bacteria | 2229 |
| 37 | Ga0070675_100047606 | 3300005354 | Bacteria | 3513 |
| 38 | Ga0070675_100728943 | 3300005354 | Unclassified | 904 |
| 39 | Ga0070671_100019919 | 3300005355 | Bacteria | 5465 |
| 40 | Ga0070671_100027961 | 3300005355 | Bacteria | 4643 |
| 41 | Ga0070674_100027518 | 3300005356 | Bacteria | 3727 |
| 42 | Ga0070674_100086602 | 3300005356 | Bacteria | 2250 |
| 43 | Ga0070673_100230069 | 3300005364 | Bacteria | 1608 |
| 44 | Ga0070688_100065983 | 3300005365 | Bacteria | 2302 |
| 45 | Ga0070688_100174912 | 3300005365 | Bacteria | 1485 |
| 46 | Ga0070688_100317403 | 3300005365 | Unclassified | 1131 |
| 47 | Ga0070659_100058345 | 3300005366 | Bacteria | 3046 |
| 48 | Ga0070667_100015429 | 3300005367 | Bacteria | 6316 |
| 49 | Ga0070667_100162617 | 3300005367 | Bacteria | 1967 |
| 50 | Ga0070667_100280910 | 3300005367 | Bacteria | 1495 |
| 51 | Ga0070714_100240437 | 3300005435 | Bacteria | 1671 |
| 52 | Ga0070713_100232416 | 3300005436 | Bacteria | 1677 |
| 53 | Ga0070713_100391914 | 3300005436 | Bacteria | 1296 |
| 54 | Ga0070713_100743772 | 3300005436 | Bacteria | 938 |
| 55 | Ga0070701_10006562 | 3300005438 | Bacteria | 4905 |
| 56 | Ga0070701_10261592 | 3300005438 | Bacteria | 1049 |
| 57 | Ga0070705_100094405 | 3300005440 | Bacteria | 1873 |
| 58 | Ga0070700_100062136 | 3300005441 | Bacteria | 2359 |
| 59 | Ga0070708_100560360 | 3300005445 | Bacteria | 1078 |
| 60 | Ga0070663_100076740 | 3300005455 | Bacteria | 2444 |
| 61 | Ga0070663_100123633 | 3300005455 | Bacteria | 1957 |
| 62 | Ga0070663_100173931 | 3300005455 | Bacteria | 1666 |
| 63 | Ga0070678_100019754 | 3300005456 | Bacteria | 4403 |
| 64 | Ga0070678_100067401 | 3300005456 | Bacteria | 2664 |
| 65 | Ga0070678_100164381 | 3300005456 | Bacteria | 1801 |
| 66 | Ga0070662_100148845 | 3300005457 | Bacteria | 1820 |
| 67 | Ga0070662_100216435 | 3300005457 | Bacteria | 1526 |
| 68 | Ga0068867_100058761 | 3300005459 | Bacteria | 2850 |
| 69 | Ga0068867_100203594 | 3300005459 | Bacteria | 1586 |
| 70 | Ga0070685_10072406 | 3300005466 | Bacteria | 2046 |
| 71 | Ga0070698_100115178 | 3300005471 | Bacteria | 2653 |
| 72 | Ga0070679_100608630 | 3300005530 | Bacteria | 1036 |
| 73 | Ga0070684_100035117 | 3300005535 | Bacteria | 4289 |
| 74 | Ga0070684_100107553 | 3300005535 | Bacteria | 2498 |
| 75 | Ga0070697_100396478 | 3300005536 | Bacteria | 1197 |
| 76 | Ga0068853_100156895 | 3300005539 | Bacteria | 2051 |
| 77 | Ga0068853_100309214 | 3300005539 | Bacteria | 1463 |
| 78 | Ga0068853_100641073 | 3300005539 | Bacteria | 1011 |
| 79 | Ga0070672_100003299 | 3300005543 | Bacteria | 10449 |
| 80 | Ga0070696_100146186 | 3300005546 | Bacteria | 1732 |
| 81 | Ga0070693_100111908 | 3300005547 | Bacteria | 1681 |
| 82 | Ga0070693_100164847 | 3300005547 | Bacteria | 1414 |
| 83 | Ga0070693_100275982 | 3300005547 | Bacteria | 1124 |
| 84 | Ga0070665_100041916 | 3300005548 | Bacteria | 4601 |
| 85 | Ga0070665_100153300 | 3300005548 | Bacteria | 2306 |
| 86 | Ga0070665_100597368 | 3300005548 | Bacteria | 1117 |
| 87 | Ga0070664_100036292 | 3300005564 | Bacteria | 4140 |
| 88 | Ga0070664_100102739 | 3300005564 | Bacteria | 2487 |
| 89 | Ga0068857_100500721 | 3300005577 | Bacteria | 1140 |
| 90 | Ga0068854_100061089 | 3300005578 | Bacteria | 2728 |
| 91 | Ga0068854_100175615 | 3300005578 | Bacteria | 1670 |
| 92 | Ga0068856_100003347 | 3300005614 | Bacteria | 16276 |
| 93 | Ga0068856_100312836 | 3300005614 | Bacteria | 1588 |
| 94 | Ga0068856_100379643 | 3300005614 | Bacteria | 1432 |
| 95 | Ga0068852_100046625 | 3300005616 | Bacteria | 3694 |
| 96 | Ga0068852_100129085 | 3300005616 | Bacteria | 2325 |
| 97 | Ga0068859_100021148 | 3300005617 | Bacteria | 6529 |
| 98 | Ga0068859_100163980 | 3300005617 | Bacteria | 2301 |
| 99 | Ga0068864_100006339 | 3300005618 | Bacteria | 9703 |
| 100 | Ga0068864_100089179 | 3300005618 | Bacteria | 2717 |
| 101 | Ga0068864_100423324 | 3300005618 | Bacteria | 1269 |
| 102 | Ga0068866_10004065 | 3300005718 | Bacteria | 6005 |
| 103 | Ga0068861_100043820 | 3300005719 | Bacteria | 3361 |
| 104 | Ga0068861_100190918 | 3300005719 | Bacteria | 1712 |
| 105 | Ga0068861_100226964 | 3300005719 | Bacteria | 1582 |
| 106 | Ga0068861_100393163 | 3300005719 | Bacteria | 1228 |
| 107 | Ga0068861_100472242 | 3300005719 | Bacteria | 1128 |
| 108 | Ga0068870_10116407 | 3300005840 | Bacteria | 1533 |
| 109 | Ga0068863_100005456 | 3300005841 | Bacteria | 12531 |
| 110 | Ga0068860_100008760 | 3300005843 | Bacteria | 10078 |
| 111 | Ga0068860_100081543 | 3300005843 | Bacteria | 3076 |
| 112 | Ga0068860_100100065 | 3300005843 | Bacteria | 2765 |
| 113 | Ga0068862_100061588 | 3300005844 | Bacteria | 3226 |
| 114 | Ga0068862_100098063 | 3300005844 | Bacteria | 2560 |
| 115 | Ga0068862_100268495 | 3300005844 | Bacteria | 1559 |
| 116 | Ga0068862_100271003 | 3300005844 | Bacteria | 1552 |
| 117 | Ga0081455_10001734 | 3300005937 | Bacteria | 26379 |
| 118 | Ga0081455_10015026 | 3300005937 | Bacteria | 7541 |
| 119 | Ga0081455_10017479 | 3300005937 | Bacteria | 6872 |
| 120 | Ga0081455_10040027 | 3300005937 | Bacteria | 4137 |
| 121 | Ga0081455_10343491 | 3300005937 | Bacteria | 1055 |
| 122 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 123 | Ga0081540_1000105 | 3300005983 | Bacteria | 89863 |
| 124 | Ga0081540_1003965 | 3300005983 | Bacteria | 11501 |
| 125 | Ga0081540_1026858 | 3300005983 | Bacteria | 3275 |
| 126 | Ga0070717_10064461 | 3300006028 | Bacteria | 3043 |
| 127 | Ga0070717_10663546 | 3300006028 | Bacteria | 947 |
| 128 | Ga0075365_10222696 | 3300006038 | Bacteria | 1324 |
| 129 | Ga0075365_10263989 | 3300006038 | Bacteria | 1211 |
| 130 | Ga0075365_10288284 | 3300006038 | Bacteria | 1155 |
| 131 | Ga0075368_10031919 | 3300006042 | Bacteria | 2044 |
| 132 | Ga0075368_10078818 | 3300006042 | Bacteria | 1338 |
| 133 | Ga0075363_100033900 | 3300006048 | Bacteria | 2663 |
| 134 | Ga0075363_100234600 | 3300006048 | Bacteria | 1054 |
| 135 | Ga0070716_100170099 | 3300006173 | Bacteria | 1421 |
| 136 | Ga0070712_100055550 | 3300006175 | Bacteria | 2774 |
| 137 | Ga0070712_100080564 | 3300006175 | Bacteria | 2357 |
| 138 | Ga0075362_10040333 | 3300006177 | Bacteria | 2056 |
| 139 | Ga0075367_10068817 | 3300006178 | Bacteria | 2124 |
| 140 | Ga0075367_10081807 | 3300006178 | Bacteria | 1954 |
| 141 | Ga0075367_10162074 | 3300006178 | Bacteria | 1391 |
| 142 | Ga0075367_10184526 | 3300006178 | Bacteria | 1301 |
| 143 | Ga0075366_10062746 | 3300006195 | Bacteria | 2208 |
| 144 | Ga0097621_100008674 | 3300006237 | Bacteria | 7339 |
| 145 | Ga0097621_100100345 | 3300006237 | Bacteria | 2435 |
| 146 | Ga0075370_10148644 | 3300006353 | Bacteria | 1373 |
| 147 | Ga0068871_100026031 | 3300006358 | Bacteria | 4560 |
| 148 | Ga0068871_100326895 | 3300006358 | Bacteria | 1352 |
| 149 | Ga0068871_100610559 | 3300006358 | Bacteria | 992 |
| 150 | Ga0075428_100027523 | 3300006844 | Bacteria | 6290 |
| 151 | Ga0075430_100084022 | 3300006846 | Bacteria | 2667 |
| 152 | Ga0075431_100122877 | 3300006847 | Bacteria | 2679 |
| 153 | Ga0075431_100183347 | 3300006847 | Bacteria | 2148 |
| 154 | Ga0075433_10027057 | 3300006852 | Bacteria | 4862 |
| 155 | Ga0075434_100012519 | 3300006871 | Bacteria | 8046 |
| 156 | Ga0075434_100014111 | 3300006871 | Bacteria | 7630 |
| 157 | Ga0075434_100225504 | 3300006871 | Bacteria | 1893 |
| 158 | Ga0075429_100472408 | 3300006880 | Bacteria | 1099 |
| 159 | Ga0068865_100095558 | 3300006881 | Bacteria | 2165 |
| 160 | Ga0068865_100467611 | 3300006881 | Unclassified | 1046 |
| 161 | Ga0097620_100021146 | 3300006931 | Bacteria | 6529 |
| 162 | Ga0097620_100163987 | 3300006931 | Bacteria | 2301 |
| 163 | Ga0099794_10066421 | 3300007265 | Bacteria | 1760 |
| 164 | Ga0099794_10163626 | 3300007265 | Bacteria | 1132 |
| 165 | Ga0099795_10031853 | 3300007788 | Bacteria | 1819 |
| 166 | Ga0105240_10255829 | 3300009093 | Bacteria | 2022 |
| 167 | Ga0111539_10076949 | 3300009094 | Bacteria | 3928 |
| 168 | Ga0111539_10293057 | 3300009094 | Bacteria | 1893 |
| 169 | Ga0111539_10567908 | 3300009094 | Bacteria | 1321 |
| 170 | Ga0105245_10027586 | 3300009098 | Bacteria | 5003 |
| 171 | Ga0105245_10063788 | 3300009098 | Bacteria | 3328 |
| 172 | Ga0105245_10258761 | 3300009098 | Bacteria | 1693 |
| 173 | Ga0105247_10012572 | 3300009101 | Bacteria | 5084 |
| 174 | Ga0114129_10050640 | 3300009147 | Bacteria | 5833 |
| 175 | Ga0114129_10619074 | 3300009147 | Bacteria | 1401 |
| 176 | Ga0105243_10020756 | 3300009148 | Bacteria | 4984 |
| 177 | Ga0105243_10107981 | 3300009148 | Bacteria | 2323 |
| 178 | Ga0105243_10420351 | 3300009148 | Bacteria | 1247 |
| 179 | Ga0105243_10442065 | 3300009148 | Bacteria | 1218 |
| 180 | Ga0105241_10093808 | 3300009174 | Bacteria | 2373 |
| 181 | Ga0105241_10418413 | 3300009174 | Bacteria | 1179 |
| 182 | Ga0105242_10085438 | 3300009176 | Bacteria | 2646 |
| 183 | Ga0105248_10090371 | 3300009177 | Bacteria | 3448 |
| 184 | Ga0105248_10095524 | 3300009177 | Bacteria | 3347 |
| 185 | Ga0105248_10234721 | 3300009177 | Bacteria | 2065 |
| 186 | Ga0105248_10283841 | 3300009177 | Bacteria | 1864 |
| 187 | Ga0105248_10454036 | 3300009177 | Bacteria | 1444 |
| 188 | Ga0105237_10059660 | 3300009545 | Bacteria | 3816 |
| 189 | Ga0105237_10134764 | 3300009545 | Bacteria | 2464 |
| 190 | Ga0105237_10625038 | 3300009545 | Bacteria | 1084 |
| 191 | Ga0105238_10049666 | 3300009551 | Bacteria | 4224 |
| 192 | Ga0105238_10232933 | 3300009551 | Bacteria | 1818 |
| 193 | Ga0105238_10763859 | 3300009551 | Bacteria | 981 |
| 194 | Ga0105249_10166479 | 3300009553 | Bacteria | 2134 |
| 195 | Ga0105249_10218549 | 3300009553 | Bacteria | 1874 |
| 196 | Ga0105249_10228388 | 3300009553 | Bacteria | 1835 |
| 197 | Ga0099796_10026830 | 3300010159 | Bacteria | 1834 |
| 198 | Ga0099796_10126705 | 3300010159 | Bacteria | 986 |
| 199 | Ga0105239_10083385 | 3300010375 | Bacteria | 3520 |
| 200 | Ga0105239_10146039 | 3300010375 | Bacteria | 2638 |
| 201 | Ga0105239_10338932 | 3300010375 | Bacteria | 1696 |
| 202 | Ga0105239_10569234 | 3300010375 | Bacteria | 1291 |
| 203 | Ga0105246_10015760 | 3300011119 | Bacteria | 4778 |
| 204 | Ga0157370_10556305 | 3300013104 | Bacteria | 1052 |
| 205 | Ga0157374_10003239 | 3300013296 | Bacteria | 13672 |
| 206 | Ga0157374_10200703 | 3300013296 | Bacteria | 1953 |
| 207 | Ga0157374_10508647 | 3300013296 | Bacteria | 1210 |
| 208 | Ga0157378_10009041 | 3300013297 | Bacteria | 8671 |
| 209 | Ga0157378_10066261 | 3300013297 | Bacteria | 3234 |
| 210 | Ga0157378_10552613 | 3300013297 | Bacteria | 1157 |
| 211 | Ga0163162_10212560 | 3300013306 | Bacteria | 2064 |
| 212 | Ga0163162_10386812 | 3300013306 | Bacteria | 1532 |
| 213 | Ga0163162_10659944 | 3300013306 | Bacteria | 1169 |
| 214 | Ga0163162_11048056 | 3300013306 | Unclassified | 923 |
| 215 | Ga0157375_10047518 | 3300013308 | Bacteria | 4192 |
| 216 | Ga0157375_10103459 | 3300013308 | Bacteria | 2935 |
| 217 | Ga0157375_10156349 | 3300013308 | Bacteria | 2419 |
| 218 | Ga0157375_10201898 | 3300013308 | Bacteria | 2144 |
| 219 | Ga0157375_11166684 | 3300013308 | Bacteria | 903 |
| 220 | Ga0163163_10014945 | 3300014325 | Bacteria | 7154 |
| 221 | Ga0163163_10015790 | 3300014325 | Bacteria | 6993 |
| 222 | Ga0163163_10038493 | 3300014325 | Bacteria | 4662 |
| 223 | Ga0163163_10092019 | 3300014325 | Bacteria | 3047 |
| 224 | Ga0157380_10327978 | 3300014326 | Bacteria | 1422 |
| 225 | Ga0157377_10044111 | 3300014745 | Bacteria | 2485 |
| 226 | Ga0157379_10043542 | 3300014968 | Bacteria | 4008 |
| 227 | Ga0157376_10025997 | 3300014969 | Bacteria | 4619 |
| 228 | Ga0157376_10047907 | 3300014969 | Bacteria | 3531 |
| 229 | Ga0157376_10240321 | 3300014969 | Bacteria | 1687 |
| 230 | Ga0157376_10391642 | 3300014969 | Bacteria | 1341 |
| 231 | Ga0157376_10414288 | 3300014969 | Bacteria | 1306 |
| 232 | Ga0209758_1000125 | 3300025297 | Bacteria | 189869 |
| 233 | Ga0207697_10062448 | 3300025315 | Bacteria | 1551 |
| 234 | Ga0207682_10209306 | 3300025893 | Unclassified | 899 |
| 235 | Ga0207642_10003991 | 3300025899 | Bacteria | 4709 |
| 236 | Ga0207642_10176595 | 3300025899 | Bacteria | 1160 |
| 237 | Ga0207710_10005716 | 3300025900 | Bacteria | 5341 |
| 238 | Ga0207710_10197622 | 3300025900 | Bacteria | 992 |
| 239 | Ga0207688_10004677 | 3300025901 | Bacteria | 7461 |
| 240 | Ga0207688_10072244 | 3300025901 | Bacteria | 1960 |
| 241 | Ga0207688_10144546 | 3300025901 | Bacteria | 1401 |
| 242 | Ga0207680_10217828 | 3300025903 | Bacteria | 1307 |
| 243 | Ga0207645_10007388 | 3300025907 | Bacteria | 7770 |
| 244 | Ga0207645_10116104 | 3300025907 | Bacteria | 1735 |
| 245 | Ga0207645_10339229 | 3300025907 | Bacteria | 1004 |
| 246 | Ga0207643_10000794 | 3300025908 | Bacteria | 19261 |
| 247 | Ga0207654_10115797 | 3300025911 | Bacteria | 1675 |
| 248 | Ga0207671_10117360 | 3300025914 | Bacteria | 2031 |
| 249 | Ga0207671_10214644 | 3300025914 | Bacteria | 1506 |
| 250 | Ga0207693_10033602 | 3300025915 | Bacteria | 4046 |
| 251 | Ga0207663_10037576 | 3300025916 | Bacteria | 2920 |
| 252 | Ga0207660_10327421 | 3300025917 | Bacteria | 1224 |
| 253 | Ga0207662_10000424 | 3300025918 | Bacteria | 18665 |
| 254 | Ga0207662_10102114 | 3300025918 | Bacteria | 1778 |
| 255 | Ga0207662_10220715 | 3300025918 | Bacteria | 1234 |
| 256 | Ga0207657_10093633 | 3300025919 | Bacteria | 2502 |
| 257 | Ga0207657_10111110 | 3300025919 | Bacteria | 2263 |
| 258 | Ga0207649_10016093 | 3300025920 | Bacteria | 4212 |
| 259 | Ga0207649_10330285 | 3300025920 | Bacteria | 1123 |
| 260 | Ga0207649_10418610 | 3300025920 | Bacteria | 1006 |
| 261 | Ga0207652_10011695 | 3300025921 | Bacteria | 7082 |
| 262 | Ga0207652_10319609 | 3300025921 | Bacteria | 1401 |
| 263 | Ga0207681_10113290 | 3300025923 | Bacteria | 1977 |
| 264 | Ga0207694_10029408 | 3300025924 | Bacteria | 4193 |
| 265 | Ga0207694_10422766 | 3300025924 | Bacteria | 1110 |
| 266 | Ga0207650_10019548 | 3300025925 | Bacteria | 4762 |
| 267 | Ga0207650_10472360 | 3300025925 | Unclassified | 1046 |
| 268 | Ga0207659_10024969 | 3300025926 | Bacteria | 4011 |
| 269 | Ga0207687_10020983 | 3300025927 | Bacteria | 4337 |
| 270 | Ga0207687_10066178 | 3300025927 | Bacteria | 2568 |
| 271 | Ga0207700_10157416 | 3300025928 | Bacteria | 1884 |
| 272 | Ga0207700_10546522 | 3300025928 | Bacteria | 1028 |
| 273 | Ga0207700_10576234 | 3300025928 | Bacteria | 1000 |
| 274 | Ga0207664_10729915 | 3300025929 | Bacteria | 891 |
| 275 | Ga0207644_10015484 | 3300025931 | Bacteria | 5120 |
| 276 | Ga0207644_10029172 | 3300025931 | Bacteria | 3825 |
| 277 | Ga0207706_10018822 | 3300025933 | Bacteria | 6211 |
| 278 | Ga0207686_10167007 | 3300025934 | Bacteria | 1548 |
| 279 | Ga0207709_10017967 | 3300025935 | Bacteria | 3955 |
| 280 | Ga0207709_10153042 | 3300025935 | Bacteria | 1600 |
| 281 | Ga0207670_10053842 | 3300025936 | Bacteria | 2713 |
| 282 | Ga0207670_10087056 | 3300025936 | Bacteria | 2200 |
| 283 | Ga0207704_10071538 | 3300025938 | Bacteria | 2201 |
| 284 | Ga0207704_10206741 | 3300025938 | Bacteria | 1441 |
| 285 | Ga0207704_10614655 | 3300025938 | Unclassified | 891 |
| 286 | Ga0207665_10113190 | 3300025939 | Bacteria | 1909 |
| 287 | Ga0207691_10002691 | 3300025940 | Bacteria | 17379 |
| 288 | Ga0207711_10022868 | 3300025941 | Bacteria | 5232 |
| 289 | Ga0207711_10087104 | 3300025941 | Bacteria | 2739 |
| 290 | Ga0207689_10088660 | 3300025942 | Bacteria | 2541 |
| 291 | Ga0207689_10126834 | 3300025942 | Bacteria | 2099 |
| 292 | Ga0207689_10278928 | 3300025942 | Bacteria | 1384 |
| 293 | Ga0207661_10014563 | 3300025944 | Bacteria | 5769 |
| 294 | Ga0207679_10028966 | 3300025945 | Bacteria | 3850 |
| 295 | Ga0207679_10176092 | 3300025945 | Bacteria | 1766 |
| 296 | Ga0207667_10228090 | 3300025949 | Bacteria | 1907 |
| 297 | Ga0207651_10250583 | 3300025960 | Bacteria | 1449 |
| 298 | Ga0207712_10021041 | 3300025961 | Bacteria | 4278 |
| 299 | Ga0207712_10189533 | 3300025961 | Bacteria | 1622 |
| 300 | Ga0207712_10231411 | 3300025961 | Bacteria | 1484 |
| 301 | Ga0207668_10154049 | 3300025972 | Bacteria | 1783 |
| 302 | Ga0207640_10234715 | 3300025981 | Bacteria | 1413 |
| 303 | Ga0207677_10011070 | 3300026023 | Bacteria | 5127 |
| 304 | Ga0207677_10218335 | 3300026023 | Bacteria | 1527 |
| 305 | Ga0207677_10242156 | 3300026023 | Bacteria | 1460 |
| 306 | Ga0207677_10539596 | 3300026023 | Bacteria | 1015 |
| 307 | Ga0207703_10517122 | 3300026035 | Bacteria | 1122 |
| 308 | Ga0207639_10054996 | 3300026041 | Bacteria | 3044 |
| 309 | Ga0207639_10101798 | 3300026041 | Bacteria | 2324 |
| 310 | Ga0207639_10207058 | 3300026041 | Bacteria | 1686 |
| 311 | Ga0207678_10003923 | 3300026067 | Bacteria | 13383 |
| 312 | Ga0207678_10060137 | 3300026067 | Bacteria | 3268 |
| 313 | Ga0207678_10246715 | 3300026067 | Bacteria | 1529 |
| 314 | Ga0207678_10321441 | 3300026067 | Bacteria | 1331 |
| 315 | Ga0207708_10000784 | 3300026075 | Bacteria | 23952 |
| 316 | Ga0207708_10028255 | 3300026075 | Bacteria | 4247 |
| 317 | Ga0207708_10115077 | 3300026075 | Bacteria | 2091 |
| 318 | Ga0207708_10189790 | 3300026075 | Bacteria | 1635 |
| 319 | Ga0207702_10000548 | 3300026078 | Bacteria | 41978 |
| 320 | Ga0207702_10033740 | 3300026078 | Bacteria | 4276 |
| 321 | Ga0207702_10251491 | 3300026078 | Bacteria | 1660 |
| 322 | Ga0207641_10006530 | 3300026088 | Bacteria | 9810 |
| 323 | Ga0207648_10002310 | 3300026089 | Bacteria | 20581 |
| 324 | Ga0207648_10229800 | 3300026089 | Bacteria | 1650 |
| 325 | Ga0207676_10002295 | 3300026095 | Bacteria | 13719 |
| 326 | Ga0207676_10108437 | 3300026095 | Bacteria | 2318 |
| 327 | Ga0207676_10218661 | 3300026095 | Bacteria | 1695 |
| 328 | Ga0207674_10135379 | 3300026116 | Bacteria | 2426 |
| 329 | Ga0207675_100002371 | 3300026118 | Bacteria | 18651 |
| 330 | Ga0207675_100112829 | 3300026118 | Bacteria | 2566 |
| 331 | Ga0207675_100130814 | 3300026118 | Bacteria | 2380 |
| 332 | Ga0207683_10019832 | 3300026121 | Bacteria | 5743 |
| 333 | Ga0207683_10021694 | 3300026121 | Bacteria | 5504 |
| 334 | Ga0207683_10040045 | 3300026121 | Bacteria | 4087 |
| 335 | Ga0207683_10124367 | 3300026121 | Bacteria | 2317 |
| 336 | Ga0207683_10184101 | 3300026121 | Bacteria | 1894 |
| 337 | Ga0207698_10034409 | 3300026142 | Bacteria | 3693 |
| 338 | Ga0207698_10457529 | 3300026142 | Bacteria | 1233 |
| 339 | Ga0209179_1015555 | 3300027512 | Bacteria | 1415 |
| 340 | Ga0209588_1009865 | 3300027671 | Bacteria | 2862 |
| 341 | Ga0209813_10065818 | 3300027866 | Bacteria | 1168 |
| 342 | Ga0268266_10165814 | 3300028379 | Bacteria | 2001 |
| 343 | Ga0268266_10275628 | 3300028379 | Bacteria | 1563 |
| 344 | Ga0268266_10594340 | 3300028379 | Bacteria | 1063 |
| 345 | Ga0268265_10013453 | 3300028380 | Bacteria | 5560 |
| 346 | Ga0268265_10063828 | 3300028380 | Bacteria | 2835 |
| 347 | Ga0268265_10070998 | 3300028380 | Bacteria | 2710 |
| 348 | Ga0268265_10516126 | 3300028380 | Bacteria | 1129 |
| 349 | Ga0268264_10042233 | 3300028381 | Bacteria | 3775 |
| 350 | Ga0268264_10296560 | 3300028381 | Bacteria | 1520 |
| 351 | Ga0265334_10008302 | 3300028573 | Bacteria | 4418 |
| 352 | Ga0307517_10039620 | 3300028786 | Bacteria | 5167 |
| 353 | Ga0307515_10006012 | 3300028794 | Bacteria | 24419 |
| 354 | Ga0265330_10070693 | 3300031235 | Bacteria | 1510 |
| 355 | Ga0265332_10001513 | 3300031238 | Bacteria | 12909 |
| 356 | Ga0265332_10005019 | 3300031238 | Bacteria | 6151 |
| 357 | Ga0265332_10032406 | 3300031238 | Bacteria | 2278 |
| 358 | Ga0265325_10088971 | 3300031241 | Bacteria | 1525 |
| 359 | Ga0265329_10010128 | 3300031242 | Bacteria | 3478 |
| 360 | Ga0265329_10014396 | 3300031242 | Bacteria | 2795 |
| 361 | Ga0265340_10005971 | 3300031247 | Bacteria | 6729 |
| 362 | Ga0265339_10004623 | 3300031249 | Bacteria | 9354 |
| 363 | Ga0265339_10005449 | 3300031249 | Bacteria | 8477 |
| 364 | Ga0265331_10029831 | 3300031250 | Bacteria | 2720 |
| 365 | Ga0265331_10031762 | 3300031250 | Bacteria | 2622 |
| 366 | Ga0265331_10101952 | 3300031250 | Bacteria | 1320 |
| 367 | Ga0265331_10249441 | 3300031250 | Bacteria | 796 |
| 368 | Ga0265316_10046003 | 3300031344 | Bacteria | 3461 |
| 369 | Ga0307509_10135476 | 3300031507 | Bacteria | 2409 |
| 370 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 371 | Ga0265314_10004484 | 3300031711 | Bacteria | 12947 |
| 372 | Ga0265314_10042579 | 3300031711 | Bacteria | 3237 |
| 373 | Ga0265342_10002428 | 3300031712 | Bacteria | 16105 |
| 374 | Ga0265342_10005254 | 3300031712 | Bacteria | 9929 |
| 375 | Ga0265342_10160721 | 3300031712 | Bacteria | 1242 |
| 376 | Ga0307516_10126244 | 3300031730 | Bacteria | 2343 |
| 377 | Ga0307510_10016157 | 3300033180 | Bacteria | 8816 |
| 378 | Ga0373948_0033716 | 3300034817 | Bacteria | 1044 |
| 379 | Ga0373934_0123469 | 3300035086 | Bacteria | 1054 |
| 380 | Ga0373923_0001173 | 3300035111 | Bacteria | 7304 |
| 381 | Ga0373936_0242128 | 3300035113 | Bacteria | 804 |
| 382 | Ga0373945_0001390 | 3300035116 | Bacteria | 7348 |
| 383 | Ga0373945_0036020 | 3300035116 | Bacteria | 1771 |
| 384 | Ga0373953_0003727 | 3300035117 | Bacteria | 4785 |
| 385 | Ga0373954_0299384 | 3300035118 | Bacteria | 793 |
| 386 | Ga0373943_0008899 | 3300035170 | Bacteria | 4498 |
| 387 | Ga0373946_0012725 | 3300035171 | Bacteria | 3153 |
| 388 | Ga0373955_0002349 | 3300035172 | Bacteria | 8228 |
| 389 | Ga0373955_0088500 | 3300035172 | Bacteria | 1761 |
| 390 | Ga0373961_0021624 | 3300035241 | Bacteria | 1713 |
| 391 | Ga0373924_0002221 | 3300035410 | Bacteria | 6504 |
| 392 | Ga0373924_0017333 | 3300035410 | Bacteria | 2762 |
| 393 | Ga0373931_0057519 | 3300035691 | Bacteria | 2086 |
| 394 | Ga0373935_0000291 | 3300035692 | Bacteria | 24802 |
| 395 | Ga0373935_0027445 | 3300035692 | Bacteria | 3518 |
| 396 | Ga0373935_0428586 | 3300035692 | Bacteria | 953 |
| 397 | Ga0373927_0002882 | 3300035695 | Bacteria | 12525 |
| 398 | Ga0373927_0010828 | 3300035695 | Bacteria | 6076 |
| 399 | Ga0373927_0013220 | 3300035695 | Bacteria | 5489 |
| 400 | Ga0373927_0017091 | 3300035695 | Bacteria | 4780 |
| 401 | Ga0373927_0025259 | 3300035695 | Bacteria | 3882 |
| 402 | Ga0373927_0173228 | 3300035695 | Bacteria | 1415 |
| 403 | Ga0373927_0330621 | 3300035695 | Bacteria | 1004 |
| 404 | Ga0373933_0191541 | 3300035724 | Bacteria | 1306 |
| 405 | Ga0373947_0005730 | 3300035725 | Bacteria | 7243 |
| 406 | Ga0373947_0010154 | 3300035725 | Bacteria | 5407 |
| 407 | Ga0373947_0024192 | 3300035725 | Bacteria | 3537 |
| 408 | Ga0373947_0025283 | 3300035725 | Bacteria | 3462 |
| 409 | Ga0373947_0028707 | 3300035725 | Bacteria | 3263 |
| 410 | Ga0373947_0036395 | 3300035725 | Bacteria | 2919 |
| 411 | Ga0373947_0205031 | 3300035725 | Bacteria | 1291 |
| 412 | Ga0373937_0000004 | 3300036401 | Bacteria | 212269 |
| 413 | Ga0373937_0007886 | 3300036401 | Bacteria | 9228 |
| 414 | Ga0373937_0033145 | 3300036401 | Bacteria | 4689 |
| 415 | Ga0373937_0325797 | 3300036401 | Unclassified | 1454 |
| 416 | Ga0373937_0612864 | 3300036401 | Bacteria | 1033 |
| 417 | Ga0373925_0000460 | 3300037068 | Bacteria | 41057 |
| 418 | Ga0373925_0012254 | 3300037068 | Bacteria | 6204 |
| 419 | Ga0373925_0023291 | 3300037068 | Bacteria | 4519 |
| 420 | Ga0373925_0090021 | 3300037068 | Bacteria | 2345 |
| 421 | Ga0373925_0096835 | 3300037068 | Bacteria | 2263 |
| 422 | Ga0373925_0108321 | 3300037068 | Bacteria | 2144 |
| 423 | Ga0373925_0118203 | 3300037068 | Bacteria | 2055 |
| 424 | Ga0373925_0210499 | 3300037068 | Bacteria | 1549 |
| 425 | Ga0373925_0505692 | 3300037068 | Bacteria | 992 |
| 426 | Ga0373925_0507438 | 3300037068 | Bacteria | 990 |
| 427 | Ga0436363_0335374 | 3300039450 | Unclassified | 2702 |
| 428 | Ga0451798_0887340 | 3300041458 | Unclassified | 909 |
| 429 | Ga0451843_0872454 | 3300041509 | Bacteria | 829 |
| 430 | Ga0466963_0427385 | 3300044694 | Bacteria | 934 |
| 431 | Ga0466967_0067366 | 3300045976 | Bacteria | 3193 |
| 432 | Ga0495617_021764 | 3300046452 | Bacteria | 2166 |
| 433 | Ga0495627_093152 | 3300046453 | Bacteria | 865 |
| 434 | Ga0495592_0000029 | 3300046454 | Bacteria | 131879 |
| 435 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 436 | Ga0495603_0039310 | 3300046455 | Bacteria | 2835 |
| 437 | Ga0495603_0050966 | 3300046455 | Bacteria | 2460 |
| 438 | Ga0495603_0052598 | 3300046455 | Bacteria | 2417 |
| 439 | Ga0495603_0062923 | 3300046455 | Bacteria | 2190 |
| 440 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 441 | Ga0495629_0257994 | 3300046459 | Bacteria | 1198 |
| 442 | Ga0495638_0103778 | 3300046460 | Bacteria | 1697 |
| 443 | Ga0495638_0189245 | 3300046460 | Bacteria | 1169 |
| 444 | Ga0495641_0003672 | 3300046461 | Bacteria | 11330 |
| 445 | Ga0495641_0017426 | 3300046461 | Bacteria | 3744 |
| 446 | Ga0495641_0019640 | 3300046461 | Bacteria | 3450 |
| 447 | Ga0495641_0158565 | 3300046461 | Bacteria | 1012 |
| 448 | Ga0495651_0001409 | 3300046462 | Bacteria | 18662 |
| 449 | Ga0495653_0000012 | 3300046463 | Bacteria | 266880 |
| 450 | Ga0495650_0060149 | 3300046471 | Bacteria | 1527 |
| 451 | Ga0495580_0005364 | 3300046472 | Bacteria | 10616 |
| 452 | Ga0495580_0047602 | 3300046472 | Bacteria | 3039 |
| 453 | Ga0495580_0293655 | 3300046472 | Bacteria | 1108 |
| 454 | Ga0495582_0000990 | 3300046473 | Bacteria | 15910 |
| 455 | Ga0495582_0025773 | 3300046473 | Bacteria | 3221 |
| 456 | Ga0495582_0226321 | 3300046473 | Bacteria | 1071 |
| 457 | Ga0495605_0026778 | 3300046474 | Bacteria | 2994 |
| 458 | Ga0495605_0176373 | 3300046474 | Bacteria | 942 |
| 459 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 460 | Ga0495639_0021776 | 3300046475 | Bacteria | 2808 |
| 461 | Ga0495639_0056218 | 3300046475 | Bacteria | 1796 |
| 462 | Ga0495662_0010406 | 3300046476 | Bacteria | 4557 |
| 463 | Ga0495664_0000004 | 3300046477 | Bacteria | 489411 |
| 464 | Ga0495664_0001505 | 3300046477 | Bacteria | 12344 |
| 465 | Ga0495664_0082445 | 3300046477 | Bacteria | 1929 |
| 466 | Ga0495664_0157547 | 3300046477 | Bacteria | 1378 |
| 467 | Ga0495664_0319671 | 3300046477 | Bacteria | 936 |
| 468 | Ga0495584_0017649 | 3300046491 | Bacteria | 3631 |
| 469 | Ga0495584_0062283 | 3300046491 | Bacteria | 1875 |
| 470 | Ga0495584_0243886 | 3300046491 | Bacteria | 914 |
| 471 | Ga0495585_0113784 | 3300046492 | Bacteria | 1437 |
| 472 | Ga0495594_0000128 | 3300046499 | Bacteria | 35750 |
| 473 | Ga0495608_0000017 | 3300046511 | Bacteria | 192929 |
| 474 | Ga0495608_0147239 | 3300046511 | Bacteria | 1502 |
| 475 | Ga0495616_0049664 | 3300046513 | Bacteria | 2102 |
| 476 | Ga0495618_0000006 | 3300046514 | Bacteria | 229906 |
| 477 | Ga0495618_0066500 | 3300046514 | Bacteria | 2291 |
| 478 | Ga0495618_0277958 | 3300046514 | Bacteria | 1045 |
| 479 | Ga0495620_0078562 | 3300046515 | Bacteria | 1338 |
| 480 | Ga0495628_0000001 | 3300046516 | Bacteria | 917742 |
| 481 | Ga0495630_0120545 | 3300046517 | Bacteria | 1990 |
| 482 | Ga0495630_0453158 | 3300046517 | Bacteria | 983 |
| 483 | Ga0495631_0205868 | 3300046518 | Bacteria | 841 |
| 484 | Ga0495632_0090785 | 3300046519 | Bacteria | 1448 |
| 485 | Ga0495644_0069798 | 3300046523 | Bacteria | 1320 |
| 486 | Ga0495663_0123259 | 3300046525 | Bacteria | 869 |
| 487 | Ga0495666_0070401 | 3300046526 | Bacteria | 1663 |
| 488 | Ga0495652_0000002 | 3300046529 | Bacteria | 946606 |
| 489 | Ga0495665_0006186 | 3300046531 | Bacteria | 6465 |
| 490 | Ga0495665_0094072 | 3300046531 | Bacteria | 1575 |
| 491 | Ga0495665_0211751 | 3300046531 | Bacteria | 1003 |
| 492 | Ga0495640_0000001 | 3300046533 | Bacteria | 853827 |
| 493 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 494 | Ga0495640_0119257 | 3300046533 | Bacteria | 1717 |
| 495 | Ga0495586_0142836 | 3300046535 | Bacteria | 1344 |
| 496 | Ga0495587_0000008 | 3300046536 | Bacteria | 271097 |
| 497 | Ga0495598_0001556 | 3300046537 | Bacteria | 4597 |
| 498 | Ga0495645_0000002 | 3300046543 | Bacteria | 651644 |
| 499 | Ga0495622_0037475 | 3300046557 | Bacteria | 2259 |
| 500 | Ga0495622_0071643 | 3300046557 | Bacteria | 1599 |
| 501 | Ga0495667_0000029 | 3300046559 | Bacteria | 151568 |
| 502 | Ga0495656_0020279 | 3300046615 | Bacteria | 2577 |
| 503 | Ga0495668_0055390 | 3300046616 | Bacteria | 2190 |
| 504 | Ga0495634_0001583 | 3300046642 | Bacteria | 19998 |
| 505 | Ga0495611_0208317 | 3300046648 | Bacteria | 911 |
| 506 | Ga0495625_0068851 | 3300046660 | Bacteria | 2487 |
| 507 | Ga0495635_0000002 | 3300046663 | Bacteria | 490490 |
| 508 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 509 | Ga0495661_0100548 | 3300046665 | Bacteria | 1628 |
| 510 | Ga0495588_0076469 | 3300046674 | Bacteria | 1745 |
| 511 | Ga0495588_0198910 | 3300046674 | Bacteria | 1058 |
| 512 | Ga0495657_0000459 | 3300046675 | Bacteria | 38116 |
| 513 | Ga0495599_0000104 | 3300046678 | Bacteria | 59442 |
| 514 | Ga0495623_0000691 | 3300046679 | Bacteria | 22400 |
| 515 | Ga0495646_0000064 | 3300046680 | Bacteria | 50992 |
| 516 | Ga0495647_0000394 | 3300046681 | Bacteria | 12460 |
| 517 | Ga0495658_0003203 | 3300046683 | Bacteria | 8153 |
| 518 | Ga0495658_0080898 | 3300046683 | Bacteria | 1906 |
| 519 | Ga0495658_0086047 | 3300046683 | Bacteria | 1854 |
| 520 | Ga0495658_0226303 | 3300046683 | Bacteria | 1172 |
| 521 | Ga0495669_0000650 | 3300046684 | Bacteria | 15146 |
| 522 | Ga0495669_0041655 | 3300046684 | Bacteria | 2040 |
| 523 | Ga0495613_0027954 | 3300046689 | Bacteria | 4198 |
| 524 | Ga0495613_0102792 | 3300046689 | Bacteria | 2063 |
| 525 | Ga0495613_0367519 | 3300046689 | Bacteria | 985 |
| 526 | Ga0495624_0023168 | 3300046690 | Bacteria | 4096 |
| 527 | Ga0495671_0093497 | 3300046692 | Bacteria | 1471 |
| 528 | Ga0495589_0035287 | 3300046794 | Bacteria | 2508 |
| 529 | Ga0495589_0042333 | 3300046794 | Bacteria | 2270 |
| 530 | Ga0495589_0164450 | 3300046794 | Bacteria | 1056 |
| 531 | Ga0495600_0000010 | 3300046809 | Bacteria | 143675 |
| 532 | Ga0495600_0125125 | 3300046809 | Bacteria | 1672 |
| 533 | Ga0495581_0003127 | 3300047315 | Bacteria | 9472 |
| 534 | Ga0495581_0027892 | 3300047315 | Bacteria | 3275 |
| 535 | Ga0495581_0078625 | 3300047315 | Bacteria | 1909 |
| 536 | Ga0495581_0082644 | 3300047315 | Bacteria | 1860 |
| 537 | Ga0495581_0089977 | 3300047315 | Bacteria | 1780 |
| 538 | Ga0495604_0000009 | 3300047317 | Bacteria | 326341 |
| 539 | Ga0495636_0160807 | 3300047318 | Bacteria | 1012 |
| 540 | Ga0495674_0000002 | 3300047319 | Bacteria | 642785 |
| 541 | Ga0495674_0008459 | 3300047319 | Bacteria | 9804 |
| 542 | Ga0495674_0182507 | 3300047319 | Bacteria | 1747 |
| 543 | Ga0495672_0060865 | 3300047320 | Bacteria | 2178 |
| 544 | Ga0495676_0056443 | 3300047321 | Bacteria | 3105 |
| 545 | Ga0495676_0082609 | 3300047321 | Bacteria | 2431 |
| 546 | Ga0495676_0094806 | 3300047321 | Bacteria | 2222 |
| 547 | Ga0495680_0000752 | 3300047322 | Bacteria | 36296 |
| 548 | Ga0495675_0000517 | 3300047444 | Bacteria | 25028 |
| 549 | Ga0495679_033846 | 3300047446 | Bacteria | 1630 |
| 550 | Ga0495684_0000006 | 3300047471 | Bacteria | 247568 |
| 551 | Ga0495593_0000439 | 3300047673 | Bacteria | 23237 |
| 552 | Ga0495593_0015688 | 3300047673 | Bacteria | 4287 |
| 553 | Ga0495593_0254338 | 3300047673 | Bacteria | 879 |
| 554 | Ga0495602_0000005 | 3300048088 | Bacteria | 325957 |
| 555 | Ga0495602_0097375 | 3300048088 | Bacteria | 2424 |
| 556 | Ga0495614_0072055 | 3300048089 | Bacteria | 1490 |
| 557 | Ga0496100_0008677 | 3300048903 | Bacteria | 5676 |
| 558 | Ga0496100_0010419 | 3300048903 | Bacteria | 5260 |
| 559 | Ga0496101_0002062 | 3300048904 | Bacteria | 12221 |
| 560 | Ga0496101_0040893 | 3300048904 | Bacteria | 3302 |
| 561 | Ga0496101_0144084 | 3300048904 | Bacteria | 1818 |
| 562 | Ga0496101_0148820 | 3300048904 | Bacteria | 1789 |
| 563 | Ga0496101_0311046 | 3300048904 | Bacteria | 1235 |
| 564 | Ga0496102_0001771 | 3300048905 | Bacteria | 18745 |
| 565 | Ga0496102_0009880 | 3300048905 | Bacteria | 8205 |
| 566 | Ga0496102_0017733 | 3300048905 | Bacteria | 6241 |
| 567 | Ga0496102_0300737 | 3300048905 | Bacteria | 1512 |
| 568 | Ga0496102_0525027 | 3300048905 | Bacteria | 1106 |
| 569 | Ga0496103_0005658 | 3300048906 | Bacteria | 7469 |
| 570 | Ga0496103_0017084 | 3300048906 | Bacteria | 4338 |
| 571 | Ga0496103_0049281 | 3300048906 | Bacteria | 2604 |
| 572 | Ga0496103_0098855 | 3300048906 | Bacteria | 1846 |
| 573 | Ga0496103_0148171 | 3300048906 | Bacteria | 1503 |
| 574 | Ga0496103_0153370 | 3300048906 | Bacteria | 1476 |
| 575 | Ga0496104_0001864 | 3300048907 | Bacteria | 18251 |
| 576 | Ga0496104_0009785 | 3300048907 | Bacteria | 8547 |
| 577 | Ga0496104_0013405 | 3300048907 | Bacteria | 7385 |
| 578 | Ga0496104_0039870 | 3300048907 | Bacteria | 4399 |
| 579 | Ga0496104_0082659 | 3300048907 | Bacteria | 3063 |
| 580 | Ga0496104_0136187 | 3300048907 | Bacteria | 2360 |
| 581 | Ga0496104_0360244 | 3300048907 | Bacteria | 1367 |
| 582 | Ga0496105_0001436 | 3300048908 | Bacteria | 16761 |
| 583 | Ga0496105_0002420 | 3300048908 | Bacteria | 13523 |
| 584 | Ga0496105_0006858 | 3300048908 | Bacteria | 8763 |
| 585 | Ga0496105_0012967 | 3300048908 | Bacteria | 6605 |
| 586 | Ga0496105_0050186 | 3300048908 | Bacteria | 3446 |
| 587 | Ga0496106_0020513 | 3300048909 | Bacteria | 4905 |
| 588 | Ga0496106_0026257 | 3300048909 | Bacteria | 4335 |
| 589 | Ga0496106_0080447 | 3300048909 | Bacteria | 2502 |
| 590 | Ga0496106_0165987 | 3300048909 | Unclassified | 1748 |
| 591 | Ga0496106_0175635 | 3300048909 | Bacteria | 1699 |
| 592 | Ga0496107_0003490 | 3300048910 | Bacteria | 10516 |
| 593 | Ga0496107_0012097 | 3300048910 | Bacteria | 6018 |
| 594 | Ga0496107_0036192 | 3300048910 | Bacteria | 3540 |
| 595 | Ga0496107_0081293 | 3300048910 | Bacteria | 2363 |
| 596 | Ga0496107_0186014 | 3300048910 | Bacteria | 1543 |
| 597 | Ga0496107_0192376 | 3300048910 | Bacteria | 1516 |
| 598 | Ga0496108_0000386 | 3300048911 | Bacteria | 36634 |
| 599 | Ga0496108_0002833 | 3300048911 | Bacteria | 13915 |
| 600 | Ga0496108_0011203 | 3300048911 | Bacteria | 7286 |
| 601 | Ga0496108_0019931 | 3300048911 | Bacteria | 5508 |
| 602 | Ga0496108_0079232 | 3300048911 | Bacteria | 2781 |
| 603 | Ga0496108_0308332 | 3300048911 | Bacteria | 1379 |
| 604 | Ga0496109_0001313 | 3300048912 | Bacteria | 20515 |
| 605 | Ga0496109_0004171 | 3300048912 | Bacteria | 12067 |
| 606 | Ga0496109_0016420 | 3300048912 | Bacteria | 6472 |
| 607 | Ga0496109_0128912 | 3300048912 | Bacteria | 2360 |
| 608 | Ga0496109_0290514 | 3300048912 | Bacteria | 1541 |
| 609 | Ga0496109_0640984 | 3300048912 | Bacteria | 999 |
| 610 | Ga0496110_0055465 | 3300048913 | Bacteria | 3487 |
| 611 | Ga0496110_0068174 | 3300048913 | Bacteria | 3148 |
| 612 | Ga0496110_0087144 | 3300048913 | Bacteria | 2789 |
| 613 | Ga0496110_0102662 | 3300048913 | Bacteria | 2564 |
| 614 | Ga0496110_0179418 | 3300048913 | Bacteria | 1923 |
| 615 | Ga0496111_0000388 | 3300048914 | Bacteria | 21996 |
| 616 | Ga0496111_0012071 | 3300048914 | Bacteria | 5841 |
| 617 | Ga0496111_0019842 | 3300048914 | Bacteria | 4674 |
| 618 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 619 | Ga0496112_0000426 | 3300048915 | Bacteria | 27828 |
| 620 | Ga0496112_0013582 | 3300048915 | Bacteria | 7524 |
| 621 | Ga0496112_0201840 | 3300048915 | Bacteria | 1947 |
| 622 | Ga0496112_0206504 | 3300048915 | Bacteria | 1922 |
| 623 | Ga0496112_0310408 | 3300048915 | Bacteria | 1522 |
| 624 | Ga0496112_0351790 | 3300048915 | Bacteria | 1416 |
| 625 | Ga0496112_0674532 | 3300048915 | Bacteria | 962 |
| 626 | Ga0496113_0000395 | 3300048916 | Bacteria | 21041 |
| 627 | Ga0496113_0039315 | 3300048916 | Bacteria | 3481 |
| 628 | Ga0496113_0105066 | 3300048916 | Bacteria | 2192 |
| 629 | Ga0496113_0111346 | 3300048916 | Bacteria | 2131 |
| 630 | Ga0496113_0771676 | 3300048916 | Unclassified | 765 |
| 631 | Ga0496114_0005094 | 3300048917 | Bacteria | 10241 |
| 632 | Ga0496114_0028261 | 3300048917 | Bacteria | 4600 |
| 633 | Ga0496114_0098347 | 3300048917 | Bacteria | 2495 |
| 634 | Ga0496114_0155661 | 3300048917 | Bacteria | 1984 |
| 635 | Ga0496115_0000535 | 3300048918 | Bacteria | 29580 |
| 636 | Ga0496115_0009860 | 3300048918 | Bacteria | 7113 |
| 637 | Ga0496115_0020774 | 3300048918 | Bacteria | 5066 |
| 638 | Ga0496115_0024331 | 3300048918 | Bacteria | 4705 |
| 639 | Ga0496115_0027378 | 3300048918 | Bacteria | 4457 |
| 640 | Ga0496115_0030874 | 3300048918 | Bacteria | 4218 |
| 641 | Ga0496115_0061373 | 3300048918 | Bacteria | 3030 |
| 642 | Ga0496115_0278933 | 3300048918 | Bacteria | 1372 |
| 643 | Ga0496115_0378115 | 3300048918 | Bacteria | 1152 |
| 644 | Ga0496117_0030138 | 3300048920 | Bacteria | 4169 |
| 645 | Ga0496119_0177624 | 3300048922 | Bacteria | 1119 |
| 646 | Ga0496121_0024355 | 3300048924 | Bacteria | 5791 |
| 647 | Ga0496121_0043531 | 3300048924 | Bacteria | 3887 |
| 648 | Ga0496121_0124416 | 3300048924 | Bacteria | 1941 |
| 649 | Ga0496124_0167459 | 3300048927 | Bacteria | 1706 |
| 650 | Ga0496126_0019903 | 3300048929 | Bacteria | 6598 |
| 651 | Ga0496126_0135596 | 3300048929 | Bacteria | 2124 |
| 652 | Ga0496126_0289113 | 3300048929 | Bacteria | 1356 |
| 653 | Ga0496126_0368417 | 3300048929 | Bacteria | 1172 |
| 654 | Ga0495682_0052594 | 3300049460 | Bacteria | 1480 |
| 655 | nmdc:mga03n38_160505_c1 | 3300050490 | Bacteria | 1138 |
| 656 | nmdc:mga03n38_28157_c1 | 3300050490 | Bacteria | 2339 |
| 657 | nmdc:mga03n38_58595_c1 | 3300050490 | Bacteria | 1745 |
| 658 | nmdc:mga00v17_69404_c1 | 3300050491 | Bacteria | 2181 |
| 659 | nmdc:mga0yw44_10144_c1 | 3300050492 | Bacteria | 4798 |
| 660 | nmdc:mga0yw44_156426_c1 | 3300050492 | Bacteria | 1490 |
| 661 | nmdc:mga06z11_155813_c1 | 3300050494 | Bacteria | 1302 |
| 662 | nmdc:mga06z11_207641_c1 | 3300050494 | Bacteria | 1140 |
| 663 | nmdc:mga06z11_215508_c1 | 3300050494 | Bacteria | 1120 |
| 664 | nmdc:mga06z11_222403_c1 | 3300050494 | Bacteria | 1104 |
| 665 | nmdc:mga06z11_5286_c1 | 3300050494 | Bacteria | 5169 |
| 666 | nmdc:mga04h51_105806_c1 | 3300050495 | Bacteria | 1031 |
| 667 | nmdc:mga07m45_137503_c1 | 3300050496 | Bacteria | 1414 |
| 668 | nmdc:mga07m45_38017_c1 | 3300050496 | Bacteria | 2685 |
| 669 | nmdc:mga05p37_6242_c1 | 3300050507 | Bacteria | 14032 |
| 670 | nmdc:mga05p37_682404_c1 | 3300050507 | Bacteria | 1144 |
| 671 | nmdc:mga09592_154205_c1 | 3300050508 | Bacteria | 1982 |
| 672 | nmdc:mga0qj67_95982_c1 | 3300050509 | Bacteria | 2387 |
| 673 | nmdc:mga06r32_127007_c1 | 3300050510 | Bacteria | 2519 |
| 674 | nmdc:mga06r32_169452_c1 | 3300050510 | Bacteria | 2167 |
| 675 | nmdc:mga06r32_54843_c1 | 3300050510 | Bacteria | 3822 |
| 676 | nmdc:mga08y16_110342_c1 | 3300050511 | Bacteria | 2864 |
| 677 | nmdc:mga0n895_18346_c1 | 3300050512 | Bacteria | 6471 |
| 678 | nmdc:mga0n895_411548_c1 | 3300050512 | Bacteria | 1367 |
| 679 | nmdc:mga0n895_56218_c1 | 3300050512 | Bacteria | 3876 |
| 680 | nmdc:mga0rr50_236733_c1 | 3300050513 | Bacteria | 1512 |
| 681 | nmdc:mga0a205_99385_c1 | 3300050515 | Bacteria | 2808 |
| 682 | Ga0495601_0000002 | 3300053077 | Bacteria | 528704 |
| 683 | Ga0495601_0021177 | 3300053077 | Bacteria | 3980 |
| 684 | Ga0495601_0042386 | 3300053077 | Bacteria | 2856 |
| 685 | Ga0495612_0000010 | 3300053078 | Bacteria | 227618 |
| 686 | Ga0495655_0006829 | 3300053083 | Bacteria | 2094 |
| 687 | Ga0495655_0028988 | 3300053083 | Bacteria | 1327 |
| 688 | Ga0495655_0036411 | 3300053083 | Bacteria | 1230 |
| 689 | Ga0495595_0000777 | 3300053084 | Bacteria | 12093 |
| 690 | Ga0495619_0000019 | 3300053085 | Bacteria | 209518 |
| 691 | Ga0495619_0020844 | 3300053085 | Bacteria | 4181 |
| 692 | Ga0495619_0033342 | 3300053085 | Bacteria | 3344 |
| 693 | Ga0495619_0175356 | 3300053085 | Bacteria | 1483 |
| 694 | Ga0495619_0221361 | 3300053085 | Unclassified | 1311 |
| 695 | Ga0500643_008988 | 3300053087 | Bacteria | 3860 |
| 696 | Ga0500644_0001293 | 3300053088 | Bacteria | 6806 |
| 697 | Ga0500651_0006213 | 3300053093 | Bacteria | 6869 |
| 698 | Ga0500651_0069381 | 3300053093 | Bacteria | 2194 |
| 699 | Ga0500566_0006011 | 3300053094 | Bacteria | 7218 |
| 700 | Ga0500566_0031929 | 3300053094 | Bacteria | 3070 |
| 701 | Ga0500641_0017678 | 3300053096 | Bacteria | 2671 |
| 702 | Ga0500562_068420 | 3300053108 | Bacteria | 957 |
| 703 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 704 | Ga0500595_000537 | 3300053119 | Bacteria | 22809 |
| 705 | Ga0500595_003301 | 3300053119 | Bacteria | 7598 |
| 706 | Ga0500595_024557 | 3300053119 | Bacteria | 2102 |
| 707 | Ga0500642_0081958 | 3300053130 | Bacteria | 1483 |
| 708 | Ga0500568_0046742 | 3300053139 | Bacteria | 1717 |
| 709 | Ga0500590_065714 | 3300053148 | Bacteria | 1813 |
| 710 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 711 | Ga0500616_0046128 | 3300053153 | Bacteria | 2318 |
| 712 | Ga0500616_0095147 | 3300053153 | Bacteria | 1466 |
| 713 | Ga0500638_047821 | 3300053162 | Bacteria | 2070 |
| 714 | Ga0500636_0010368 | 3300053177 | Bacteria | 5435 |
| 715 | Ga0500637_0000042 | 3300053178 | Bacteria | 46215 |
| 716 | Ga0500645_000099 | 3300053730 | Bacteria | 68426 |
| 717 | Ga0500645_071614 | 3300053730 | Bacteria | 995 |
| 718 | Ga0500661_000056 | 3300055283 | Bacteria | 17736 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0068851 | Ga0495625_0068851_1687_2451 | 214 |
| 2 | 3300046517 | Ga0495630_0453158 | Ga0495630_0453158_15_668 | 215 |
| 3 | 3300046674 | Ga0495588_0076469 | Ga0495588_0076469_1082_1735 | 215 |
| 4 | 3300050490 | nmdc:mga03n38_160505_c1 | nmdc:mga03n38_160505_c1_471_1124 | 215 |
| 5 | 3300046519 | Ga0495632_0090785 | Ga0495632_0090785_343_1107 | 216 |
| 6 | 3300046692 | Ga0495671_0093497 | Ga0495671_0093497_331_1095 | 216 |
| 7 | 3300053148 | Ga0500590_065714 | Ga0500590_065714_985_1749 | 219 |
| 8 | 3300046455 | Ga0495603_0039310 | Ga0495603_0039310_1101_1865 | 223 |
| 9 | 3300046461 | Ga0495641_0019640 | Ga0495641_0019640_2550_3314 | 223 |
| 10 | 3300046683 | Ga0495658_0086047 | Ga0495658_0086047_948_1712 | 223 |
| 11 | 3300047315 | Ga0495581_0027892 | Ga0495581_0027892_465_1229 | 223 |
| 12 | 3300010375 | Ga0105239_10146039 | Ga0105239_101460393 | 228 |
| 13 | 3300026121 | Ga0207683_10184101 | Ga0207683_101841012 | 228 |
| 14 | 3300046557 | Ga0495622_0071643 | Ga0495622_0071643_650_1414 | 228 |
| 15 | 3300053119 | Ga0500595_024557 | Ga0500595_024557_1384_2085 | 229 |
| 16 | 3300053130 | Ga0500642_0081958 | Ga0500642_0081958_15_716 | 229 |
| 17 | 3300050512 | nmdc:mga0n895_411548_c1 | nmdc:mga0n895_411548_c1_252_1004 | 230 |
| 18 | 3300048916 | Ga0496113_0771676 | Ga0496113_0771676_45_752 | 231 |
| 19 | 3300006237 | Ga0097621_100100345 | Ga0097621_1001003452 | 232 |
| 20 | 3300009177 | Ga0105248_10454036 | Ga0105248_104540362 | 232 |
| 21 | 3300013297 | Ga0157378_10009041 | Ga0157378_100090417 | 232 |
| 22 | 3300028573 | Ga0265334_10008302 | Ga0265334_100083025 | 232 |
| 23 | 3300037068 | Ga0373925_0210499 | Ga0373925_0210499_809_1519 | 232 |
| 24 | 3300046452 | Ga0495617_021764 | Ga0495617_021764_863_1573 | 232 |
| 25 | 3300046475 | Ga0495639_0021776 | Ga0495639_0021776_918_1628 | 232 |
| 26 | 3300046648 | Ga0495611_0208317 | Ga0495611_0208317_16_726 | 232 |
| 27 | 3300046674 | Ga0495588_0198910 | Ga0495588_0198910_49_759 | 232 |
| 28 | 3300048906 | Ga0496103_0049281 | Ga0496103_0049281_41_751 | 232 |
| 29 | 3300048906 | Ga0496103_0098855 | Ga0496103_0098855_1115_1825 | 232 |
| 30 | 3300048907 | Ga0496104_0082659 | Ga0496104_0082659_2288_3052 | 232 |
| 31 | 3300048909 | Ga0496106_0165987 | Ga0496106_0165987_867_1631 | 232 |
| 32 | 3300048910 | Ga0496107_0186014 | Ga0496107_0186014_113_877 | 232 |
| 33 | 3300048918 | Ga0496115_0027378 | Ga0496115_0027378_818_1582 | 232 |
| 34 | 3300009147 | Ga0114129_10619074 | Ga0114129_106190741 | 233 |
| 35 | 3300050507 | nmdc:mga05p37_682404_c1 | nmdc:mga05p37_682404_c1_55_804 | 233 |
| 36 | 3300048929 | Ga0496126_0289113 | Ga0496126_0289113_115_831 | 234 |
| 37 | 3300053096 | Ga0500641_0017678 | Ga0500641_0017678_1904_2659 | 235 |
| 38 | 3300046531 | Ga0495665_0094072 | Ga0495665_0094072_47_757 | 236 |
| 39 | 3300048904 | Ga0496101_0144084 | Ga0496101_0144084_15_725 | 236 |
| 40 | 3300025929 | Ga0207664_10729915 | Ga0207664_107299151 | 237 |
| 41 | 3300007788 | Ga0099795_10031853 | Ga0099795_100318532 | 239 |
| 42 | 3300025939 | Ga0207665_10113190 | Ga0207665_101131902 | 239 |
| 43 | 3300035086 | Ga0373934_0123469 | Ga0373934_0123469_140_871 | 239 |
| 44 | 3300035113 | Ga0373936_0242128 | Ga0373936_0242128_33_764 | 239 |
| 45 | 3300035118 | Ga0373954_0299384 | Ga0373954_0299384_35_766 | 239 |
| 46 | 3300035172 | Ga0373955_0088500 | Ga0373955_0088500_146_877 | 239 |
| 47 | 3300035725 | Ga0373947_0028707 | Ga0373947_0028707_146_877 | 239 |
| 48 | 3300046455 | Ga0495603_0052598 | Ga0495603_0052598_71_802 | 239 |
| 49 | 3300046461 | Ga0495641_0158565 | Ga0495641_0158565_13_744 | 239 |
| 50 | 3300046473 | Ga0495582_0226321 | Ga0495582_0226321_63_794 | 239 |
| 51 | 3300046477 | Ga0495664_0319671 | Ga0495664_0319671_188_919 | 239 |
| 52 | 3300046689 | Ga0495613_0367519 | Ga0495613_0367519_45_776 | 239 |
| 53 | 3300047321 | Ga0495676_0082609 | Ga0495676_0082609_898_1629 | 239 |
| 54 | 3300006178 | Ga0075367_10081807 | Ga0075367_100818071 | 240 |
| 55 | 3300009094 | Ga0111539_10567908 | Ga0111539_105679082 | 240 |
| 56 | 3300006847 | Ga0075431_100122877 | Ga0075431_1001228772 | 242 |
| 57 | 3300006852 | Ga0075433_10027057 | Ga0075433_100270572 | 242 |
| 58 | 3300047318 | Ga0495636_0160807 | Ga0495636_0160807_74_838 | 242 |
| 59 | 3300048918 | Ga0496115_0020774 | Ga0496115_0020774_3966_4706 | 242 |
| 60 | 3300050510 | nmdc:mga06r32_54843_c1 | nmdc:mga06r32_54843_c1_1889_2653 | 242 |
| 61 | 3300050511 | nmdc:mga08y16_110342_c1 | nmdc:mga08y16_110342_c1_729_1493 | 242 |
| 62 | 3300050515 | nmdc:mga0a205_99385_c1 | nmdc:mga0a205_99385_c1_475_1239 | 242 |
| 63 | 3300003911 | JGI25405J52794_10045588 | JGI25405J52794_100455881 | 243 |
| 64 | 3300005937 | Ga0081455_10001734 | Ga0081455_100017343 | 243 |
| 65 | 3300006871 | Ga0075434_100014111 | Ga0075434_10001411112 | 243 |
| 66 | 3300025918 | Ga0207662_10220715 | Ga0207662_102207152 | 243 |
| 67 | 3300035695 | Ga0373927_0017091 | Ga0373927_0017091_3351_4094 | 243 |
| 68 | 3300035725 | Ga0373947_0036395 | Ga0373947_0036395_1641_2384 | 243 |
| 69 | 3300037068 | Ga0373925_0118203 | Ga0373925_0118203_711_1454 | 243 |
| 70 | 3300046455 | Ga0495603_0050966 | Ga0495603_0050966_1417_2160 | 243 |
| 71 | 3300046472 | Ga0495580_0293655 | Ga0495580_0293655_63_806 | 243 |
| 72 | 3300046683 | Ga0495658_0226303 | Ga0495658_0226303_367_1110 | 243 |
| 73 | 3300047315 | Ga0495581_0082644 | Ga0495581_0082644_990_1733 | 243 |
| 74 | 3300050512 | nmdc:mga0n895_18346_c1 | nmdc:mga0n895_18346_c1_2654_3418 | 243 |
| 75 | 3300005937 | Ga0081455_10015026 | Ga0081455_100150267 | 244 |
| 76 | 3300025315 | Ga0207697_10062448 | Ga0207697_100624482 | 244 |
| 77 | 3300005435 | Ga0070714_100240437 | Ga0070714_1002404372 | 245 |
| 78 | 3300006038 | Ga0075365_10288284 | Ga0075365_102882842 | 245 |
| 79 | 3300031711 | Ga0265314_10042579 | Ga0265314_100425792 | 245 |
| 80 | 3300035725 | Ga0373947_0205031 | Ga0373947_0205031_188_937 | 245 |
| 81 | 3300036401 | Ga0373937_0612864 | Ga0373937_0612864_225_974 | 245 |
| 82 | 3300037068 | Ga0373925_0505692 | Ga0373925_0505692_197_946 | 245 |
| 83 | 3300048929 | Ga0496126_0019903 | Ga0496126_0019903_255_1007 | 245 |
| 84 | 3300053730 | Ga0500645_071614 | Ga0500645_071614_159_911 | 245 |
| 85 | 3300005336 | Ga0070680_100268906 | Ga0070680_1002689062 | 246 |
| 86 | 3300009177 | Ga0105248_10283841 | Ga0105248_102838412 | 246 |
| 87 | 3300013297 | Ga0157378_10552613 | Ga0157378_105526132 | 246 |
| 88 | 3300025917 | Ga0207660_10327421 | Ga0207660_103274212 | 246 |
| 89 | 3300031250 | Ga0265331_10249441 | Ga0265331_102494411 | 246 |
| 90 | 3300046460 | Ga0495638_0189245 | Ga0495638_0189245_55_810 | 246 |
| 91 | 3300049460 | Ga0495682_0052594 | Ga0495682_0052594_387_1142 | 246 |
| 92 | 3300050494 | nmdc:mga06z11_215508_c1 | nmdc:mga06z11_215508_c1_295_1050 | 246 |
| 93 | 3300053093 | Ga0500651_0069381 | Ga0500651_0069381_1188_1943 | 246 |
| 94 | 3300031711 | Ga0265314_10004484 | Ga0265314_1000448415 | 247 |
| 95 | 3300039450 | Ga0436363_0335374 | Ga0436363_0335374_88_843 | 247 |
| 96 | 3300044694 | Ga0466963_0427385 | Ga0466963_0427385_25_771 | 247 |
| 97 | 3300047673 | Ga0495593_0254338 | Ga0495593_0254338_69_824 | 247 |
| 98 | 3300005436 | Ga0070713_100232416 | Ga0070713_1002324162 | 248 |
| 99 | 3300009545 | Ga0105237_10059660 | Ga0105237_100596603 | 248 |
| 100 | 3300009551 | Ga0105238_10049666 | Ga0105238_100496662 | 248 |
| 101 | 3300025928 | Ga0207700_10546522 | Ga0207700_105465222 | 248 |
| 102 | 3300028794 | Ga0307515_10006012 | Ga0307515_1000601212 | 248 |
| 103 | 3300031235 | Ga0265330_10070693 | Ga0265330_100706932 | 248 |
| 104 | 3300031241 | Ga0265325_10088971 | Ga0265325_100889712 | 248 |
| 105 | 3300031250 | Ga0265331_10101952 | Ga0265331_101019522 | 248 |
| 106 | 3300031712 | Ga0265342_10160721 | Ga0265342_101607212 | 248 |
| 107 | 3300035695 | Ga0373927_0013220 | Ga0373927_0013220_3678_4436 | 248 |
| 108 | 3300035725 | Ga0373947_0024192 | Ga0373947_0024192_2134_2892 | 248 |
| 109 | 3300036401 | Ga0373937_0325797 | Ga0373937_0325797_653_1411 | 248 |
| 110 | 3300037068 | Ga0373925_0507438 | Ga0373925_0507438_71_829 | 248 |
| 111 | 3300046460 | Ga0495638_0103778 | Ga0495638_0103778_638_1396 | 248 |
| 112 | 3300048912 | Ga0496109_0290514 | Ga0496109_0290514_472_1230 | 248 |
| 113 | 3300048915 | Ga0496112_0000017 | Ga0496112_0000017_135078_135836 | 248 |
| 114 | 3300048918 | Ga0496115_0024331 | Ga0496115_0024331_3004_3750 | 248 |
| 115 | 3300048924 | Ga0496121_0043531 | Ga0496121_0043531_493_1254 | 248 |
| 116 | 3300053088 | Ga0500644_0001293 | Ga0500644_0001293_987_1745 | 248 |
| 117 | 3300053093 | Ga0500651_0006213 | Ga0500651_0006213_5669_6427 | 248 |
| 118 | 3300053119 | Ga0500595_003301 | Ga0500595_003301_1253_2032 | 248 |
| 119 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1041249_1042007 | 248 |
| 120 | 3300053153 | Ga0500616_0095147 | Ga0500616_0095147_608_1366 | 248 |
| 121 | 3300053730 | Ga0500645_000099 | Ga0500645_000099_15859_16617 | 248 |
| 122 | 3300005330 | Ga0070690_100021813 | Ga0070690_1000218132 | 249 |
| 123 | 3300005333 | Ga0070677_10172808 | Ga0070677_101728081 | 249 |
| 124 | 3300005333 | Ga0070677_10209931 | Ga0070677_102099311 | 249 |
| 125 | 3300005338 | Ga0068868_100389111 | Ga0068868_1003891112 | 249 |
| 126 | 3300005339 | Ga0070660_100098830 | Ga0070660_1000988302 | 249 |
| 127 | 3300005343 | Ga0070687_100092025 | Ga0070687_1000920252 | 249 |
| 128 | 3300005344 | Ga0070661_100371460 | Ga0070661_1003714602 | 249 |
| 129 | 3300005347 | Ga0070668_100343820 | Ga0070668_1003438202 | 249 |
| 130 | 3300005354 | Ga0070675_100728943 | Ga0070675_1007289431 | 249 |
| 131 | 3300005355 | Ga0070671_100027961 | Ga0070671_1000279613 | 249 |
| 132 | 3300005356 | Ga0070674_100027518 | Ga0070674_1000275183 | 249 |
| 133 | 3300005356 | Ga0070674_100086602 | Ga0070674_1000866022 | 249 |
| 134 | 3300005364 | Ga0070673_100230069 | Ga0070673_1002300691 | 249 |
| 135 | 3300005365 | Ga0070688_100317403 | Ga0070688_1003174031 | 249 |
| 136 | 3300005367 | Ga0070667_100280910 | Ga0070667_1002809101 | 249 |
| 137 | 3300005438 | Ga0070701_10261592 | Ga0070701_102615921 | 249 |
| 138 | 3300005441 | Ga0070700_100062136 | Ga0070700_1000621362 | 249 |
| 139 | 3300005455 | Ga0070663_100076740 | Ga0070663_1000767402 | 249 |
| 140 | 3300005456 | Ga0070678_100019754 | Ga0070678_1000197544 | 249 |
| 141 | 3300005456 | Ga0070678_100164381 | Ga0070678_1001643812 | 249 |
| 142 | 3300005457 | Ga0070662_100216435 | Ga0070662_1002164352 | 249 |
| 143 | 3300005459 | Ga0068867_100203594 | Ga0068867_1002035942 | 249 |
| 144 | 3300005539 | Ga0068853_100309214 | Ga0068853_1003092142 | 249 |
| 145 | 3300005539 | Ga0068853_100641073 | Ga0068853_1006410731 | 249 |
| 146 | 3300005547 | Ga0070693_100164847 | Ga0070693_1001648472 | 249 |
| 147 | 3300005547 | Ga0070693_100275982 | Ga0070693_1002759822 | 249 |
| 148 | 3300005548 | Ga0070665_100153300 | Ga0070665_1001533002 | 249 |
| 149 | 3300005548 | Ga0070665_100597368 | Ga0070665_1005973681 | 249 |
| 150 | 3300005578 | Ga0068854_100175615 | Ga0068854_1001756152 | 249 |
| 151 | 3300005618 | Ga0068864_100089179 | Ga0068864_1000891792 | 249 |
| 152 | 3300005719 | Ga0068861_100393163 | Ga0068861_1003931632 | 249 |
| 153 | 3300005719 | Ga0068861_100472242 | Ga0068861_1004722422 | 249 |
| 154 | 3300005843 | Ga0068860_100100065 | Ga0068860_1001000652 | 249 |
| 155 | 3300005844 | Ga0068862_100098063 | Ga0068862_1000980632 | 249 |
| 156 | 3300005844 | Ga0068862_100268495 | Ga0068862_1002684952 | 249 |
| 157 | 3300005983 | Ga0081540_1026858 | Ga0081540_10268583 | 249 |
| 158 | 3300006028 | Ga0070717_10663546 | Ga0070717_106635461 | 249 |
| 159 | 3300006038 | Ga0075365_10263989 | Ga0075365_102639891 | 249 |
| 160 | 3300006358 | Ga0068871_100326895 | Ga0068871_1003268952 | 249 |
| 161 | 3300006881 | Ga0068865_100095558 | Ga0068865_1000955582 | 249 |
| 162 | 3300006881 | Ga0068865_100467611 | Ga0068865_1004676112 | 249 |
| 163 | 3300009148 | Ga0105243_10107981 | Ga0105243_101079815 | 249 |
| 164 | 3300009177 | Ga0105248_10090371 | Ga0105248_100903714 | 249 |
| 165 | 3300009177 | Ga0105248_10234721 | Ga0105248_102347212 | 249 |
| 166 | 3300009553 | Ga0105249_10166479 | Ga0105249_101664792 | 249 |
| 167 | 3300009553 | Ga0105249_10218549 | Ga0105249_102185492 | 249 |
| 168 | 3300009553 | Ga0105249_10228388 | Ga0105249_102283882 | 249 |
| 169 | 3300010159 | Ga0099796_10026830 | Ga0099796_100268302 | 249 |
| 170 | 3300010375 | Ga0105239_10569234 | Ga0105239_105692342 | 249 |
| 171 | 3300013296 | Ga0157374_10508647 | Ga0157374_105086472 | 249 |
| 172 | 3300013306 | Ga0163162_10386812 | Ga0163162_103868122 | 249 |
| 173 | 3300013308 | Ga0157375_10103459 | Ga0157375_101034593 | 249 |
| 174 | 3300013308 | Ga0157375_10201898 | Ga0157375_102018982 | 249 |
| 175 | 3300014325 | Ga0163163_10038493 | Ga0163163_100384936 | 249 |
| 176 | 3300014326 | Ga0157380_10327978 | Ga0157380_103279782 | 249 |
| 177 | 3300014968 | Ga0157379_10043542 | Ga0157379_100435424 | 249 |
| 178 | 3300014969 | Ga0157376_10240321 | Ga0157376_102403212 | 249 |
| 179 | 3300014969 | Ga0157376_10391642 | Ga0157376_103916422 | 249 |
| 180 | 3300025893 | Ga0207682_10209306 | Ga0207682_102093061 | 249 |
| 181 | 3300025899 | Ga0207642_10176595 | Ga0207642_101765952 | 249 |
| 182 | 3300025907 | Ga0207645_10116104 | Ga0207645_101161042 | 249 |
| 183 | 3300025918 | Ga0207662_10102114 | Ga0207662_101021143 | 249 |
| 184 | 3300025919 | Ga0207657_10111110 | Ga0207657_101111102 | 249 |
| 185 | 3300025920 | Ga0207649_10330285 | Ga0207649_103302852 | 249 |
| 186 | 3300025931 | Ga0207644_10029172 | Ga0207644_100291723 | 249 |
| 187 | 3300025935 | Ga0207709_10153042 | Ga0207709_101530422 | 249 |
| 188 | 3300025936 | Ga0207670_10053842 | Ga0207670_100538422 | 249 |
| 189 | 3300025938 | Ga0207704_10614655 | Ga0207704_106146551 | 249 |
| 190 | 3300025941 | Ga0207711_10087104 | Ga0207711_100871042 | 249 |
| 191 | 3300025961 | Ga0207712_10021041 | Ga0207712_100210414 | 249 |
| 192 | 3300025972 | Ga0207668_10154049 | Ga0207668_101540492 | 249 |
| 193 | 3300026023 | Ga0207677_10242156 | Ga0207677_102421562 | 249 |
| 194 | 3300026041 | Ga0207639_10207058 | Ga0207639_102070582 | 249 |
| 195 | 3300026067 | Ga0207678_10060137 | Ga0207678_100601373 | 249 |
| 196 | 3300026067 | Ga0207678_10246715 | Ga0207678_102467152 | 249 |
| 197 | 3300026075 | Ga0207708_10028255 | Ga0207708_100282553 | 249 |
| 198 | 3300026075 | Ga0207708_10189790 | Ga0207708_101897902 | 249 |
| 199 | 3300026089 | Ga0207648_10229800 | Ga0207648_102298002 | 249 |
| 200 | 3300026095 | Ga0207676_10108437 | Ga0207676_101084372 | 249 |
| 201 | 3300026121 | Ga0207683_10019832 | Ga0207683_100198325 | 249 |
| 202 | 3300026121 | Ga0207683_10021694 | Ga0207683_100216945 | 249 |
| 203 | 3300026121 | Ga0207683_10124367 | Ga0207683_101243672 | 249 |
| 204 | 3300028379 | Ga0268266_10275628 | Ga0268266_102756282 | 249 |
| 205 | 3300028379 | Ga0268266_10594340 | Ga0268266_105943401 | 249 |
| 206 | 3300028380 | Ga0268265_10063828 | Ga0268265_100638282 | 249 |
| 207 | 3300028380 | Ga0268265_10070998 | Ga0268265_100709982 | 249 |
| 208 | 3300028786 | Ga0307517_10039620 | Ga0307517_100396202 | 249 |
| 209 | 3300031238 | Ga0265332_10005019 | Ga0265332_100050192 | 249 |
| 210 | 3300031238 | Ga0265332_10032406 | Ga0265332_100324062 | 249 |
| 211 | 3300031242 | Ga0265329_10014396 | Ga0265329_100143962 | 249 |
| 212 | 3300031249 | Ga0265339_10005449 | Ga0265339_100054496 | 249 |
| 213 | 3300031250 | Ga0265331_10029831 | Ga0265331_100298312 | 249 |
| 214 | 3300031712 | Ga0265342_10005254 | Ga0265342_100052542 | 249 |
| 215 | 3300031730 | Ga0307516_10126244 | Ga0307516_101262442 | 249 |
| 216 | 3300034817 | Ga0373948_0033716 | Ga0373948_0033716_214_963 | 249 |
| 217 | 3300035116 | Ga0373945_0036020 | Ga0373945_0036020_149_898 | 249 |
| 218 | 3300035241 | Ga0373961_0021624 | Ga0373961_0021624_914_1663 | 249 |
| 219 | 3300035691 | Ga0373931_0057519 | Ga0373931_0057519_1216_1965 | 249 |
| 220 | 3300035695 | Ga0373927_0173228 | Ga0373927_0173228_395_1159 | 249 |
| 221 | 3300037068 | Ga0373925_0090021 | Ga0373925_0090021_480_1235 | 249 |
| 222 | 3300041509 | Ga0451843_0872454 | Ga0451843_0872454_22_771 | 249 |
| 223 | 3300045976 | Ga0466967_0067366 | Ga0466967_0067366_604_1353 | 249 |
| 224 | 3300046453 | Ga0495627_093152 | Ga0495627_093152_42_791 | 249 |
| 225 | 3300046455 | Ga0495603_0062923 | Ga0495603_0062923_1199_1948 | 249 |
| 226 | 3300046459 | Ga0495629_0257994 | Ga0495629_0257994_220_981 | 249 |
| 227 | 3300046461 | Ga0495641_0017426 | Ga0495641_0017426_1335_2084 | 249 |
| 228 | 3300046471 | Ga0495650_0060149 | Ga0495650_0060149_384_1145 | 249 |
| 229 | 3300046472 | Ga0495580_0047602 | Ga0495580_0047602_568_1317 | 249 |
| 230 | 3300046474 | Ga0495605_0026778 | Ga0495605_0026778_2230_2979 | 249 |
| 231 | 3300046475 | Ga0495639_0056218 | Ga0495639_0056218_217_966 | 249 |
| 232 | 3300046477 | Ga0495664_0082445 | Ga0495664_0082445_443_1204 | 249 |
| 233 | 3300046491 | Ga0495584_0017649 | Ga0495584_0017649_2551_3300 | 249 |
| 234 | 3300046491 | Ga0495584_0243886 | Ga0495584_0243886_140_901 | 249 |
| 235 | 3300046492 | Ga0495585_0113784 | Ga0495585_0113784_276_1037 | 249 |
| 236 | 3300046511 | Ga0495608_0147239 | Ga0495608_0147239_620_1375 | 249 |
| 237 | 3300046514 | Ga0495618_0277958 | Ga0495618_0277958_36_791 | 249 |
| 238 | 3300046523 | Ga0495644_0069798 | Ga0495644_0069798_309_1058 | 249 |
| 239 | 3300046525 | Ga0495663_0123259 | Ga0495663_0123259_95_844 | 249 |
| 240 | 3300046535 | Ga0495586_0142836 | Ga0495586_0142836_461_1222 | 249 |
| 241 | 3300046537 | Ga0495598_0001556 | Ga0495598_0001556_3807_4556 | 249 |
| 242 | 3300046615 | Ga0495656_0020279 | Ga0495656_0020279_728_1477 | 249 |
| 243 | 3300046665 | Ga0495661_0100548 | Ga0495661_0100548_236_985 | 249 |
| 244 | 3300046684 | Ga0495669_0000650 | Ga0495669_0000650_2612_3373 | 249 |
| 245 | 3300046794 | Ga0495589_0042333 | Ga0495589_0042333_530_1279 | 249 |
| 246 | 3300046794 | Ga0495589_0164450 | Ga0495589_0164450_152_913 | 249 |
| 247 | 3300047315 | Ga0495581_0078625 | Ga0495581_0078625_598_1359 | 249 |
| 248 | 3300047315 | Ga0495581_0089977 | Ga0495581_0089977_94_855 | 249 |
| 249 | 3300047320 | Ga0495672_0060865 | Ga0495672_0060865_733_1494 | 249 |
| 250 | 3300047321 | Ga0495676_0094806 | Ga0495676_0094806_738_1487 | 249 |
| 251 | 3300047446 | Ga0495679_033846 | Ga0495679_033846_596_1345 | 249 |
| 252 | 3300048903 | Ga0496100_0010419 | Ga0496100_0010419_3715_4464 | 249 |
| 253 | 3300048904 | Ga0496101_0002062 | Ga0496101_0002062_2247_2996 | 249 |
| 254 | 3300048904 | Ga0496101_0311046 | Ga0496101_0311046_79_831 | 249 |
| 255 | 3300048905 | Ga0496102_0300737 | Ga0496102_0300737_619_1368 | 249 |
| 256 | 3300048905 | Ga0496102_0525027 | Ga0496102_0525027_122_883 | 249 |
| 257 | 3300048906 | Ga0496103_0148171 | Ga0496103_0148171_78_839 | 249 |
| 258 | 3300048907 | Ga0496104_0001864 | Ga0496104_0001864_1627_2379 | 249 |
| 259 | 3300048908 | Ga0496105_0002420 | Ga0496105_0002420_10957_11706 | 249 |
| 260 | 3300048908 | Ga0496105_0012967 | Ga0496105_0012967_1597_2349 | 249 |
| 261 | 3300048910 | Ga0496107_0003490 | Ga0496107_0003490_1850_2599 | 249 |
| 262 | 3300048910 | Ga0496107_0192376 | Ga0496107_0192376_319_1080 | 249 |
| 263 | 3300048911 | Ga0496108_0011203 | Ga0496108_0011203_6186_6935 | 249 |
| 264 | 3300048911 | Ga0496108_0079232 | Ga0496108_0079232_63_812 | 249 |
| 265 | 3300048912 | Ga0496109_0004171 | Ga0496109_0004171_9326_10075 | 249 |
| 266 | 3300048912 | Ga0496109_0128912 | Ga0496109_0128912_1597_2349 | 249 |
| 267 | 3300048913 | Ga0496110_0087144 | Ga0496110_0087144_739_1500 | 249 |
| 268 | 3300048914 | Ga0496111_0019842 | Ga0496111_0019842_2535_3284 | 249 |
| 269 | 3300048915 | Ga0496112_0310408 | Ga0496112_0310408_259_1008 | 249 |
| 270 | 3300048915 | Ga0496112_0674532 | Ga0496112_0674532_180_932 | 249 |
| 271 | 3300048916 | Ga0496113_0105066 | Ga0496113_0105066_1432_2181 | 249 |
| 272 | 3300048917 | Ga0496114_0005094 | Ga0496114_0005094_9269_10018 | 249 |
| 273 | 3300048917 | Ga0496114_0098347 | Ga0496114_0098347_838_1599 | 249 |
| 274 | 3300048918 | Ga0496115_0061373 | Ga0496115_0061373_341_1090 | 249 |
| 275 | 3300048918 | Ga0496115_0278933 | Ga0496115_0278933_354_1115 | 249 |
| 276 | 3300048929 | Ga0496126_0135596 | Ga0496126_0135596_1302_2063 | 249 |
| 277 | 3300053077 | Ga0495601_0021177 | Ga0495601_0021177_687_1442 | 249 |
| 278 | 3300053077 | Ga0495601_0042386 | Ga0495601_0042386_698_1459 | 249 |
| 279 | 3300053083 | Ga0495655_0006829 | Ga0495655_0006829_952_1701 | 249 |
| 280 | 3300053083 | Ga0495655_0028988 | Ga0495655_0028988_274_1035 | 249 |
| 281 | 3300053085 | Ga0495619_0033342 | Ga0495619_0033342_840_1595 | 249 |
| 282 | 3300053139 | Ga0500568_0046742 | Ga0500568_0046742_249_1013 | 249 |
| 283 | 3300003659 | JGI25404J52841_10003853 | JGI25404J52841_100038534 | 250 |
| 284 | 3300003659 | JGI25404J52841_10015330 | JGI25404J52841_100153303 | 250 |
| 285 | 3300005331 | Ga0070670_100531736 | Ga0070670_1005317362 | 250 |
| 286 | 3300005334 | Ga0068869_100277372 | Ga0068869_1002773722 | 250 |
| 287 | 3300005335 | Ga0070666_10237672 | Ga0070666_102376722 | 250 |
| 288 | 3300005337 | Ga0070682_100280581 | Ga0070682_1002805812 | 250 |
| 289 | 3300005338 | Ga0068868_100022399 | Ga0068868_1000223991 | 250 |
| 290 | 3300005338 | Ga0068868_100521008 | Ga0068868_1005210081 | 250 |
| 291 | 3300005344 | Ga0070661_100267371 | Ga0070661_1002673711 | 250 |
| 292 | 3300005353 | Ga0070669_100096099 | Ga0070669_1000960992 | 250 |
| 293 | 3300005365 | Ga0070688_100174912 | Ga0070688_1001749121 | 250 |
| 294 | 3300005436 | Ga0070713_100743772 | Ga0070713_1007437721 | 250 |
| 295 | 3300005455 | Ga0070663_100173931 | Ga0070663_1001739312 | 250 |
| 296 | 3300005456 | Ga0070678_100067401 | Ga0070678_1000674012 | 250 |
| 297 | 3300005530 | Ga0070679_100608630 | Ga0070679_1006086301 | 250 |
| 298 | 3300005535 | Ga0070684_100107553 | Ga0070684_1001075533 | 250 |
| 299 | 3300005536 | Ga0070697_100396478 | Ga0070697_1003964782 | 250 |
| 300 | 3300005539 | Ga0068853_100156895 | Ga0068853_1001568952 | 250 |
| 301 | 3300005564 | Ga0070664_100102739 | Ga0070664_1001027392 | 250 |
| 302 | 3300005616 | Ga0068852_100129085 | Ga0068852_1001290852 | 250 |
| 303 | 3300005617 | Ga0068859_100163980 | Ga0068859_1001639803 | 250 |
| 304 | 3300005719 | Ga0068861_100043820 | Ga0068861_1000438203 | 250 |
| 305 | 3300005719 | Ga0068861_100226964 | Ga0068861_1002269642 | 250 |
| 306 | 3300005843 | Ga0068860_100081543 | Ga0068860_1000815433 | 250 |
| 307 | 3300005844 | Ga0068862_100271003 | Ga0068862_1002710032 | 250 |
| 308 | 3300005937 | Ga0081455_10017479 | Ga0081455_100174795 | 250 |
| 309 | 3300005983 | Ga0081540_1000007 | Ga0081540_100000728 | 250 |
| 310 | 3300005983 | Ga0081540_1000105 | Ga0081540_100010514 | 250 |
| 311 | 3300005983 | Ga0081540_1003965 | Ga0081540_100396510 | 250 |
| 312 | 3300006038 | Ga0075365_10222696 | Ga0075365_102226962 | 250 |
| 313 | 3300006175 | Ga0070712_100055550 | Ga0070712_1000555503 | 250 |
| 314 | 3300006178 | Ga0075367_10162074 | Ga0075367_101620741 | 250 |
| 315 | 3300006358 | Ga0068871_100610559 | Ga0068871_1006105592 | 250 |
| 316 | 3300006871 | Ga0075434_100225504 | Ga0075434_1002255042 | 250 |
| 317 | 3300006931 | Ga0097620_100163987 | Ga0097620_1001639872 | 250 |
| 318 | 3300007265 | Ga0099794_10066421 | Ga0099794_100664212 | 250 |
| 319 | 3300007265 | Ga0099794_10163626 | Ga0099794_101636262 | 250 |
| 320 | 3300009093 | Ga0105240_10255829 | Ga0105240_102558293 | 250 |
| 321 | 3300009098 | Ga0105245_10063788 | Ga0105245_100637882 | 250 |
| 322 | 3300009098 | Ga0105245_10258761 | Ga0105245_102587612 | 250 |
| 323 | 3300009148 | Ga0105243_10420351 | Ga0105243_104203512 | 250 |
| 324 | 3300009148 | Ga0105243_10442065 | Ga0105243_104420652 | 250 |
| 325 | 3300009174 | Ga0105241_10418413 | Ga0105241_104184132 | 250 |
| 326 | 3300009545 | Ga0105237_10625038 | Ga0105237_106250382 | 250 |
| 327 | 3300009551 | Ga0105238_10232933 | Ga0105238_102329332 | 250 |
| 328 | 3300009551 | Ga0105238_10763859 | Ga0105238_107638592 | 250 |
| 329 | 3300010375 | Ga0105239_10083385 | Ga0105239_100833853 | 250 |
| 330 | 3300010375 | Ga0105239_10338932 | Ga0105239_103389322 | 250 |
| 331 | 3300013104 | Ga0157370_10556305 | Ga0157370_105563052 | 250 |
| 332 | 3300013296 | Ga0157374_10200703 | Ga0157374_102007032 | 250 |
| 333 | 3300013306 | Ga0163162_10659944 | Ga0163162_106599442 | 250 |
| 334 | 3300013306 | Ga0163162_11048056 | Ga0163162_110480562 | 250 |
| 335 | 3300013308 | Ga0157375_10047518 | Ga0157375_100475183 | 250 |
| 336 | 3300013308 | Ga0157375_10156349 | Ga0157375_101563492 | 250 |
| 337 | 3300013308 | Ga0157375_11166684 | Ga0157375_111666841 | 250 |
| 338 | 3300014325 | Ga0163163_10092019 | Ga0163163_100920193 | 250 |
| 339 | 3300014745 | Ga0157377_10044111 | Ga0157377_100441112 | 250 |
| 340 | 3300014969 | Ga0157376_10047907 | Ga0157376_100479072 | 250 |
| 341 | 3300014969 | Ga0157376_10414288 | Ga0157376_104142882 | 250 |
| 342 | 3300025900 | Ga0207710_10197622 | Ga0207710_101976222 | 250 |
| 343 | 3300025901 | Ga0207688_10072244 | Ga0207688_100722442 | 250 |
| 344 | 3300025901 | Ga0207688_10144546 | Ga0207688_101445462 | 250 |
| 345 | 3300025907 | Ga0207645_10339229 | Ga0207645_103392292 | 250 |
| 346 | 3300025914 | Ga0207671_10214644 | Ga0207671_102146442 | 250 |
| 347 | 3300025915 | Ga0207693_10033602 | Ga0207693_100336022 | 250 |
| 348 | 3300025920 | Ga0207649_10418610 | Ga0207649_104186102 | 250 |
| 349 | 3300025921 | Ga0207652_10011695 | Ga0207652_100116952 | 250 |
| 350 | 3300025924 | Ga0207694_10029408 | Ga0207694_100294082 | 250 |
| 351 | 3300025924 | Ga0207694_10422766 | Ga0207694_104227661 | 250 |
| 352 | 3300025925 | Ga0207650_10472360 | Ga0207650_104723601 | 250 |
| 353 | 3300025927 | Ga0207687_10066178 | Ga0207687_100661782 | 250 |
| 354 | 3300025928 | Ga0207700_10576234 | Ga0207700_105762341 | 250 |
| 355 | 3300025936 | Ga0207670_10087056 | Ga0207670_100870563 | 250 |
| 356 | 3300025938 | Ga0207704_10206741 | Ga0207704_102067412 | 250 |
| 357 | 3300025942 | Ga0207689_10088660 | Ga0207689_100886602 | 250 |
| 358 | 3300025942 | Ga0207689_10126834 | Ga0207689_101268343 | 250 |
| 359 | 3300025942 | Ga0207689_10278928 | Ga0207689_102789282 | 250 |
| 360 | 3300025945 | Ga0207679_10176092 | Ga0207679_101760922 | 250 |
| 361 | 3300025949 | Ga0207667_10228090 | Ga0207667_102280902 | 250 |
| 362 | 3300025960 | Ga0207651_10250583 | Ga0207651_102505832 | 250 |
| 363 | 3300025961 | Ga0207712_10189533 | Ga0207712_101895332 | 250 |
| 364 | 3300026023 | Ga0207677_10218335 | Ga0207677_102183352 | 250 |
| 365 | 3300026023 | Ga0207677_10539596 | Ga0207677_105395962 | 250 |
| 366 | 3300026041 | Ga0207639_10101798 | Ga0207639_101017982 | 250 |
| 367 | 3300026067 | Ga0207678_10321441 | Ga0207678_103214412 | 250 |
| 368 | 3300026075 | Ga0207708_10115077 | Ga0207708_101150772 | 250 |
| 369 | 3300026095 | Ga0207676_10218661 | Ga0207676_102186612 | 250 |
| 370 | 3300026116 | Ga0207674_10135379 | Ga0207674_101353793 | 250 |
| 371 | 3300026118 | Ga0207675_100112829 | Ga0207675_1001128292 | 250 |
| 372 | 3300026118 | Ga0207675_100130814 | Ga0207675_1001308141 | 250 |
| 373 | 3300026121 | Ga0207683_10040045 | Ga0207683_100400452 | 250 |
| 374 | 3300026142 | Ga0207698_10034409 | Ga0207698_100344093 | 250 |
| 375 | 3300027671 | Ga0209588_1009865 | Ga0209588_10098652 | 250 |
| 376 | 3300028380 | Ga0268265_10516126 | Ga0268265_105161261 | 250 |
| 377 | 3300028381 | Ga0268264_10296560 | Ga0268264_102965602 | 250 |
| 378 | 3300031238 | Ga0265332_10001513 | Ga0265332_1000151310 | 250 |
| 379 | 3300031242 | Ga0265329_10010128 | Ga0265329_100101283 | 250 |
| 380 | 3300031247 | Ga0265340_10005971 | Ga0265340_100059713 | 250 |
| 381 | 3300031249 | Ga0265339_10004623 | Ga0265339_100046232 | 250 |
| 382 | 3300031250 | Ga0265331_10031762 | Ga0265331_100317622 | 250 |
| 383 | 3300031344 | Ga0265316_10046003 | Ga0265316_100460034 | 250 |
| 384 | 3300031507 | Ga0307509_10135476 | Ga0307509_101354763 | 250 |
| 385 | 3300031616 | Ga0307508_10000032 | Ga0307508_1000003276 | 250 |
| 386 | 3300031712 | Ga0265342_10002428 | Ga0265342_1000242814 | 250 |
| 387 | 3300033180 | Ga0307510_10016157 | Ga0307510_100161573 | 250 |
| 388 | 3300035170 | Ga0373943_0008899 | Ga0373943_0008899_931_1695 | 250 |
| 389 | 3300035410 | Ga0373924_0017333 | Ga0373924_0017333_708_1472 | 250 |
| 390 | 3300035692 | Ga0373935_0027445 | Ga0373935_0027445_1944_2708 | 250 |
| 391 | 3300035692 | Ga0373935_0428586 | Ga0373935_0428586_34_798 | 250 |
| 392 | 3300035695 | Ga0373927_0002882 | Ga0373927_0002882_889_1653 | 250 |
| 393 | 3300035725 | Ga0373947_0025283 | Ga0373947_0025283_957_1721 | 250 |
| 394 | 3300036401 | Ga0373937_0007886 | Ga0373937_0007886_7577_8329 | 250 |
| 395 | 3300036401 | Ga0373937_0033145 | Ga0373937_0033145_2052_2816 | 250 |
| 396 | 3300037068 | Ga0373925_0023291 | Ga0373925_0023291_323_1087 | 250 |
| 397 | 3300037068 | Ga0373925_0108321 | Ga0373925_0108321_266_1030 | 250 |
| 398 | 3300041458 | Ga0451798_0887340 | Ga0451798_0887340_99_863 | 250 |
| 399 | 3300046455 | Ga0495603_0000217 | Ga0495603_0000217_26611_27375 | 250 |
| 400 | 3300046459 | Ga0495629_0000862 | Ga0495629_0000862_11602_12366 | 250 |
| 401 | 3300046461 | Ga0495641_0003672 | Ga0495641_0003672_379_1143 | 250 |
| 402 | 3300046472 | Ga0495580_0005364 | Ga0495580_0005364_9695_10459 | 250 |
| 403 | 3300046473 | Ga0495582_0000990 | Ga0495582_0000990_15126_15890 | 250 |
| 404 | 3300046475 | Ga0495639_0000544 | Ga0495639_0000544_10772_11536 | 250 |
| 405 | 3300046477 | Ga0495664_0001505 | Ga0495664_0001505_2341_3105 | 250 |
| 406 | 3300046477 | Ga0495664_0157547 | Ga0495664_0157547_32_796 | 250 |
| 407 | 3300046499 | Ga0495594_0000128 | Ga0495594_0000128_34967_35731 | 250 |
| 408 | 3300046514 | Ga0495618_0066500 | Ga0495618_0066500_932_1696 | 250 |
| 409 | 3300046515 | Ga0495620_0078562 | Ga0495620_0078562_208_972 | 250 |
| 410 | 3300046518 | Ga0495631_0205868 | Ga0495631_0205868_59_823 | 250 |
| 411 | 3300046526 | Ga0495666_0070401 | Ga0495666_0070401_626_1390 | 250 |
| 412 | 3300046531 | Ga0495665_0006186 | Ga0495665_0006186_4555_5319 | 250 |
| 413 | 3300046531 | Ga0495665_0211751 | Ga0495665_0211751_84_851 | 250 |
| 414 | 3300046533 | Ga0495640_0002595 | Ga0495640_0002595_4334_5098 | 250 |
| 415 | 3300046642 | Ga0495634_0001583 | Ga0495634_0001583_1908_2672 | 250 |
| 416 | 3300046663 | Ga0495635_0000436 | Ga0495635_0000436_5725_6489 | 250 |
| 417 | 3300046681 | Ga0495647_0000394 | Ga0495647_0000394_10792_11556 | 250 |
| 418 | 3300046683 | Ga0495658_0003203 | Ga0495658_0003203_4741_5505 | 250 |
| 419 | 3300046689 | Ga0495613_0102792 | Ga0495613_0102792_628_1392 | 250 |
| 420 | 3300046690 | Ga0495624_0023168 | Ga0495624_0023168_156_920 | 250 |
| 421 | 3300046809 | Ga0495600_0125125 | Ga0495600_0125125_49_813 | 250 |
| 422 | 3300047315 | Ga0495581_0003127 | Ga0495581_0003127_6262_7026 | 250 |
| 423 | 3300047319 | Ga0495674_0008459 | Ga0495674_0008459_186_950 | 250 |
| 424 | 3300047319 | Ga0495674_0182507 | Ga0495674_0182507_386_1153 | 250 |
| 425 | 3300047673 | Ga0495593_0000439 | Ga0495593_0000439_2380_3144 | 250 |
| 426 | 3300048088 | Ga0495602_0097375 | Ga0495602_0097375_755_1522 | 250 |
| 427 | 3300048089 | Ga0495614_0072055 | Ga0495614_0072055_279_1043 | 250 |
| 428 | 3300048904 | Ga0496101_0148820 | Ga0496101_0148820_10_774 | 250 |
| 429 | 3300048905 | Ga0496102_0001771 | Ga0496102_0001771_6650_7414 | 250 |
| 430 | 3300048906 | Ga0496103_0153370 | Ga0496103_0153370_44_808 | 250 |
| 431 | 3300048907 | Ga0496104_0136187 | Ga0496104_0136187_176_940 | 250 |
| 432 | 3300048907 | Ga0496104_0360244 | Ga0496104_0360244_311_1075 | 250 |
| 433 | 3300048908 | Ga0496105_0050186 | Ga0496105_0050186_657_1421 | 250 |
| 434 | 3300048909 | Ga0496106_0080447 | Ga0496106_0080447_1216_1980 | 250 |
| 435 | 3300048910 | Ga0496107_0036192 | Ga0496107_0036192_949_1713 | 250 |
| 436 | 3300048910 | Ga0496107_0081293 | Ga0496107_0081293_46_810 | 250 |
| 437 | 3300048911 | Ga0496108_0019931 | Ga0496108_0019931_4104_4868 | 250 |
| 438 | 3300048911 | Ga0496108_0308332 | Ga0496108_0308332_142_906 | 250 |
| 439 | 3300048912 | Ga0496109_0640984 | Ga0496109_0640984_169_933 | 250 |
| 440 | 3300048913 | Ga0496110_0055465 | Ga0496110_0055465_1400_2164 | 250 |
| 441 | 3300048913 | Ga0496110_0179418 | Ga0496110_0179418_928_1692 | 250 |
| 442 | 3300048915 | Ga0496112_0013582 | Ga0496112_0013582_5719_6483 | 250 |
| 443 | 3300048915 | Ga0496112_0206504 | Ga0496112_0206504_945_1709 | 250 |
| 444 | 3300048915 | Ga0496112_0351790 | Ga0496112_0351790_26_790 | 250 |
| 445 | 3300048916 | Ga0496113_0111346 | Ga0496113_0111346_258_1022 | 250 |
| 446 | 3300048918 | Ga0496115_0000535 | Ga0496115_0000535_27521_28285 | 250 |
| 447 | 3300048918 | Ga0496115_0378115 | Ga0496115_0378115_376_1140 | 250 |
| 448 | 3300048920 | Ga0496117_0030138 | Ga0496117_0030138_457_1242 | 250 |
| 449 | 3300048922 | Ga0496119_0177624 | Ga0496119_0177624_130_915 | 250 |
| 450 | 3300048924 | Ga0496121_0024355 | Ga0496121_0024355_724_1509 | 250 |
| 451 | 3300048924 | Ga0496121_0124416 | Ga0496121_0124416_316_1080 | 250 |
| 452 | 3300048927 | Ga0496124_0167459 | Ga0496124_0167459_915_1679 | 250 |
| 453 | 3300048929 | Ga0496126_0368417 | Ga0496126_0368417_175_939 | 250 |
| 454 | 3300050492 | nmdc:mga0yw44_156426_c1 | nmdc:mga0yw44_156426_c1_128_892 | 250 |
| 455 | 3300050494 | nmdc:mga06z11_155813_c1 | nmdc:mga06z11_155813_c1_46_810 | 250 |
| 456 | 3300050494 | nmdc:mga06z11_222403_c1 | nmdc:mga06z11_222403_c1_250_1014 | 250 |
| 457 | 3300050496 | nmdc:mga07m45_38017_c1 | nmdc:mga07m45_38017_c1_536_1300 | 250 |
| 458 | 3300053085 | Ga0495619_0175356 | Ga0495619_0175356_74_841 | 250 |
| 459 | 3300053085 | Ga0495619_0221361 | Ga0495619_0221361_285_1037 | 250 |
| 460 | 3300053094 | Ga0500566_0006011 | Ga0500566_0006011_2528_3292 | 250 |
| 461 | 3300053108 | Ga0500562_068420 | Ga0500562_068420_67_831 | 250 |
| 462 | 3300053119 | Ga0500595_000537 | Ga0500595_000537_376_1140 | 250 |
| 463 | 3300053162 | Ga0500638_047821 | Ga0500638_047821_959_1723 | 250 |
| 464 | 3300053177 | Ga0500636_0010368 | Ga0500636_0010368_1930_2682 | 250 |
| 465 | 3300053178 | Ga0500637_0000042 | Ga0500637_0000042_12479_13243 | 250 |
| 466 | 3300055283 | Ga0500661_000056 | Ga0500661_000056_4704_5468 | 250 |
| 467 | 3300006042 | Ga0075368_10031919 | Ga0075368_100319193 | 251 |
| 468 | 3300010159 | Ga0099796_10126705 | Ga0099796_101267052 | 251 |
| 469 | 3300025928 | Ga0207700_10157416 | Ga0207700_101574162 | 251 |
| 470 | 3300027512 | Ga0209179_1015555 | Ga0209179_10155552 | 251 |
| 471 | 3300027866 | Ga0209813_10065818 | Ga0209813_100658182 | 251 |
| 472 | 3300048907 | Ga0496104_0039870 | Ga0496104_0039870_177_935 | 251 |
| 473 | 3300050490 | nmdc:mga03n38_58595_c1 | nmdc:mga03n38_58595_c1_387_1148 | 251 |
| 474 | 3300050495 | nmdc:mga04h51_105806_c1 | nmdc:mga04h51_105806_c1_165_926 | 251 |
| 475 | 3300005614 | Ga0068856_100003347 | Ga0068856_1000033473 | 252 |
| 476 | 3300005937 | Ga0081455_10343491 | Ga0081455_103434912 | 252 |
| 477 | 3300026078 | Ga0207702_10000548 | Ga0207702_1000054832 | 252 |
| 478 | 3300006048 | Ga0075363_100033900 | Ga0075363_1000339003 | 253 |
| 479 | 3300006178 | Ga0075367_10184526 | Ga0075367_101845262 | 253 |
| 480 | 3300006195 | Ga0075366_10062746 | Ga0075366_100627462 | 253 |
| 481 | 3300025297 | Ga0209758_1000125 | Ga0209758_100012570 | 253 |
| 482 | 3300050494 | nmdc:mga06z11_207641_c1 | nmdc:mga06z11_207641_c1_14_787 | 253 |
| 483 | 3300050496 | nmdc:mga07m45_137503_c1 | nmdc:mga07m45_137503_c1_272_1045 | 253 |
| 484 | 3300053153 | Ga0500616_0046128 | Ga0500616_0046128_1360_2121 | 253 |
| 485 | 3300006846 | Ga0075430_100084022 | Ga0075430_1000840223 | 254 |
| 486 | 3300006880 | Ga0075429_100472408 | Ga0075429_1004724082 | 254 |
| 487 | 3300035111 | Ga0373923_0001173 | Ga0373923_0001173_1406_2170 | 254 |
| 488 | 3300035116 | Ga0373945_0001390 | Ga0373945_0001390_5799_6563 | 254 |
| 489 | 3300035117 | Ga0373953_0003727 | Ga0373953_0003727_1482_2246 | 254 |
| 490 | 3300035172 | Ga0373955_0002349 | Ga0373955_0002349_5276_6040 | 254 |
| 491 | 3300035410 | Ga0373924_0002221 | Ga0373924_0002221_5719_6483 | 254 |
| 492 | 3300035692 | Ga0373935_0000291 | Ga0373935_0000291_5011_5775 | 254 |
| 493 | 3300035695 | Ga0373927_0010828 | Ga0373927_0010828_3885_4649 | 254 |
| 494 | 3300035724 | Ga0373933_0191541 | Ga0373933_0191541_18_782 | 254 |
| 495 | 3300035725 | Ga0373947_0005730 | Ga0373947_0005730_3473_4237 | 254 |
| 496 | 3300036401 | Ga0373937_0000004 | Ga0373937_0000004_113762_114526 | 254 |
| 497 | 3300037068 | Ga0373925_0000460 | Ga0373925_0000460_3551_4315 | 254 |
| 498 | 3300046454 | Ga0495592_0000029 | Ga0495592_0000029_100343_101107 | 254 |
| 499 | 3300046462 | Ga0495651_0001409 | Ga0495651_0001409_15644_16408 | 254 |
| 500 | 3300046463 | Ga0495653_0000012 | Ga0495653_0000012_251546_252310 | 254 |
| 501 | 3300046476 | Ga0495662_0010406 | Ga0495662_0010406_638_1402 | 254 |
| 502 | 3300046477 | Ga0495664_0000004 | Ga0495664_0000004_130007_130771 | 254 |
| 503 | 3300046511 | Ga0495608_0000017 | Ga0495608_0000017_129994_130758 | 254 |
| 504 | 3300046514 | Ga0495618_0000006 | Ga0495618_0000006_89100_89864 | 254 |
| 505 | 3300046516 | Ga0495628_0000001 | Ga0495628_0000001_129996_130760 | 254 |
| 506 | 3300046529 | Ga0495652_0000002 | Ga0495652_0000002_344530_345294 | 254 |
| 507 | 3300046533 | Ga0495640_0000001 | Ga0495640_0000001_438534_439298 | 254 |
| 508 | 3300046536 | Ga0495587_0000008 | Ga0495587_0000008_130214_130978 | 254 |
| 509 | 3300046543 | Ga0495645_0000002 | Ga0495645_0000002_130009_130773 | 254 |
| 510 | 3300046559 | Ga0495667_0000029 | Ga0495667_0000029_130005_130769 | 254 |
| 511 | 3300046663 | Ga0495635_0000002 | Ga0495635_0000002_356164_356928 | 254 |
| 512 | 3300046675 | Ga0495657_0000459 | Ga0495657_0000459_14520_15284 | 254 |
| 513 | 3300046678 | Ga0495599_0000104 | Ga0495599_0000104_51722_52486 | 254 |
| 514 | 3300046679 | Ga0495623_0000691 | Ga0495623_0000691_13924_14688 | 254 |
| 515 | 3300046680 | Ga0495646_0000064 | Ga0495646_0000064_30489_31253 | 254 |
| 516 | 3300046689 | Ga0495613_0027954 | Ga0495613_0027954_607_1371 | 254 |
| 517 | 3300046809 | Ga0495600_0000010 | Ga0495600_0000010_135245_136009 | 254 |
| 518 | 3300047317 | Ga0495604_0000009 | Ga0495604_0000009_195532_196296 | 254 |
| 519 | 3300047319 | Ga0495674_0000002 | Ga0495674_0000002_129997_130761 | 254 |
| 520 | 3300047322 | Ga0495680_0000752 | Ga0495680_0000752_21469_22233 | 254 |
| 521 | 3300047444 | Ga0495675_0000517 | Ga0495675_0000517_1290_2054 | 254 |
| 522 | 3300047471 | Ga0495684_0000006 | Ga0495684_0000006_129956_130720 | 254 |
| 523 | 3300047673 | Ga0495593_0015688 | Ga0495593_0015688_639_1403 | 254 |
| 524 | 3300048088 | Ga0495602_0000005 | Ga0495602_0000005_214913_215677 | 254 |
| 525 | 3300050491 | nmdc:mga00v17_69404_c1 | nmdc:mga00v17_69404_c1_195_959 | 254 |
| 526 | 3300050508 | nmdc:mga09592_154205_c1 | nmdc:mga09592_154205_c1_198_962 | 254 |
| 527 | 3300050509 | nmdc:mga0qj67_95982_c1 | nmdc:mga0qj67_95982_c1_335_1099 | 254 |
| 528 | 3300050510 | nmdc:mga06r32_169452_c1 | nmdc:mga06r32_169452_c1_151_915 | 254 |
| 529 | 3300053077 | Ga0495601_0000002 | Ga0495601_0000002_180701_181465 | 254 |
| 530 | 3300053078 | Ga0495612_0000010 | Ga0495612_0000010_116589_117353 | 254 |
| 531 | 3300053084 | Ga0495595_0000777 | Ga0495595_0000777_7745_8509 | 254 |
| 532 | 3300053085 | Ga0495619_0000019 | Ga0495619_0000019_140037_140801 | 254 |
| 533 | 3300005445 | Ga0070708_100560360 | Ga0070708_1005603602 | 255 |
| 534 | 3300005471 | Ga0070698_100115178 | Ga0070698_1001151782 | 255 |
| 535 | 3300005937 | Ga0081455_10040027 | Ga0081455_100400272 | 255 |
| 536 | 3300046491 | Ga0495584_0062283 | Ga0495584_0062283_468_1235 | 255 |
| 537 | 3300006847 | Ga0075431_100183347 | Ga0075431_1001833472 | 256 |
| 538 | 3300001977 | JGI24746J21847_1003828 | JGI24746J21847_10038282 | 257 |
| 539 | 3300001990 | JGI24737J22298_10020484 | JGI24737J22298_100204843 | 257 |
| 540 | 3300002074 | JGI24748J21848_1000524 | JGI24748J21848_10005243 | 257 |
| 541 | 3300002075 | JGI24738J21930_10017382 | JGI24738J21930_100173822 | 257 |
| 542 | 3300002077 | JGI24744J21845_10004801 | JGI24744J21845_100048014 | 257 |
| 543 | 3300005331 | Ga0070670_100201244 | Ga0070670_1002012442 | 257 |
| 544 | 3300005335 | Ga0070666_10071962 | Ga0070666_100719622 | 257 |
| 545 | 3300005337 | Ga0070682_100122410 | Ga0070682_1001224102 | 257 |
| 546 | 3300005339 | Ga0070660_100112646 | Ga0070660_1001126462 | 257 |
| 547 | 3300005340 | Ga0070689_100001662 | Ga0070689_1000016626 | 257 |
| 548 | 3300005341 | Ga0070691_10011614 | Ga0070691_100116141 | 257 |
| 549 | 3300005343 | Ga0070687_100029272 | Ga0070687_1000292724 | 257 |
| 550 | 3300005344 | Ga0070661_100036904 | Ga0070661_1000369043 | 257 |
| 551 | 3300005345 | Ga0070692_10027176 | Ga0070692_100271762 | 257 |
| 552 | 3300005347 | Ga0070668_100038142 | Ga0070668_1000381423 | 257 |
| 553 | 3300005353 | Ga0070669_100069685 | Ga0070669_1000696852 | 257 |
| 554 | 3300005354 | Ga0070675_100047606 | Ga0070675_1000476063 | 257 |
| 555 | 3300005355 | Ga0070671_100019919 | Ga0070671_1000199194 | 257 |
| 556 | 3300005365 | Ga0070688_100065983 | Ga0070688_1000659832 | 257 |
| 557 | 3300005366 | Ga0070659_100058345 | Ga0070659_1000583452 | 257 |
| 558 | 3300005367 | Ga0070667_100015429 | Ga0070667_1000154294 | 257 |
| 559 | 3300005367 | Ga0070667_100162617 | Ga0070667_1001626173 | 257 |
| 560 | 3300005436 | Ga0070713_100391914 | Ga0070713_1003919142 | 257 |
| 561 | 3300005438 | Ga0070701_10006562 | Ga0070701_100065625 | 257 |
| 562 | 3300005440 | Ga0070705_100094405 | Ga0070705_1000944052 | 257 |
| 563 | 3300005455 | Ga0070663_100123633 | Ga0070663_1001236333 | 257 |
| 564 | 3300005457 | Ga0070662_100148845 | Ga0070662_1001488453 | 257 |
| 565 | 3300005459 | Ga0068867_100058761 | Ga0068867_1000587614 | 257 |
| 566 | 3300005466 | Ga0070685_10072406 | Ga0070685_100724063 | 257 |
| 567 | 3300005535 | Ga0070684_100035117 | Ga0070684_1000351172 | 257 |
| 568 | 3300005543 | Ga0070672_100003299 | Ga0070672_1000032994 | 257 |
| 569 | 3300005546 | Ga0070696_100146186 | Ga0070696_1001461862 | 257 |
| 570 | 3300005547 | Ga0070693_100111908 | Ga0070693_1001119082 | 257 |
| 571 | 3300005548 | Ga0070665_100041916 | Ga0070665_1000419162 | 257 |
| 572 | 3300005564 | Ga0070664_100036292 | Ga0070664_1000362925 | 257 |
| 573 | 3300005577 | Ga0068857_100500721 | Ga0068857_1005007212 | 257 |
| 574 | 3300005578 | Ga0068854_100061089 | Ga0068854_1000610892 | 257 |
| 575 | 3300005614 | Ga0068856_100312836 | Ga0068856_1003128362 | 257 |
| 576 | 3300005614 | Ga0068856_100379643 | Ga0068856_1003796432 | 257 |
| 577 | 3300005616 | Ga0068852_100046625 | Ga0068852_1000466251 | 257 |
| 578 | 3300005617 | Ga0068859_100021148 | Ga0068859_1000211486 | 257 |
| 579 | 3300005618 | Ga0068864_100006339 | Ga0068864_1000063395 | 257 |
| 580 | 3300005618 | Ga0068864_100423324 | Ga0068864_1004233242 | 257 |
| 581 | 3300005718 | Ga0068866_10004065 | Ga0068866_100040652 | 257 |
| 582 | 3300005719 | Ga0068861_100190918 | Ga0068861_1001909183 | 257 |
| 583 | 3300005840 | Ga0068870_10116407 | Ga0068870_101164071 | 257 |
| 584 | 3300005841 | Ga0068863_100005456 | Ga0068863_10000545614 | 257 |
| 585 | 3300005843 | Ga0068860_100008760 | Ga0068860_1000087604 | 257 |
| 586 | 3300005844 | Ga0068862_100061588 | Ga0068862_1000615883 | 257 |
| 587 | 3300006028 | Ga0070717_10064461 | Ga0070717_100644614 | 257 |
| 588 | 3300006042 | Ga0075368_10078818 | Ga0075368_100788182 | 257 |
| 589 | 3300006048 | Ga0075363_100234600 | Ga0075363_1002346001 | 257 |
| 590 | 3300006173 | Ga0070716_100170099 | Ga0070716_1001700992 | 257 |
| 591 | 3300006175 | Ga0070712_100080564 | Ga0070712_1000805642 | 257 |
| 592 | 3300006177 | Ga0075362_10040333 | Ga0075362_100403332 | 257 |
| 593 | 3300006178 | Ga0075367_10068817 | Ga0075367_100688172 | 257 |
| 594 | 3300006237 | Ga0097621_100008674 | Ga0097621_1000086745 | 257 |
| 595 | 3300006353 | Ga0075370_10148644 | Ga0075370_101486442 | 257 |
| 596 | 3300006358 | Ga0068871_100026031 | Ga0068871_1000260313 | 257 |
| 597 | 3300006844 | Ga0075428_100027523 | Ga0075428_1000275235 | 257 |
| 598 | 3300006871 | Ga0075434_100012519 | Ga0075434_1000125196 | 257 |
| 599 | 3300006931 | Ga0097620_100021146 | Ga0097620_1000211462 | 257 |
| 600 | 3300009094 | Ga0111539_10076949 | Ga0111539_100769494 | 257 |
| 601 | 3300009094 | Ga0111539_10293057 | Ga0111539_102930573 | 257 |
| 602 | 3300009098 | Ga0105245_10027586 | Ga0105245_100275863 | 257 |
| 603 | 3300009101 | Ga0105247_10012572 | Ga0105247_100125722 | 257 |
| 604 | 3300009147 | Ga0114129_10050640 | Ga0114129_100506405 | 257 |
| 605 | 3300009148 | Ga0105243_10020756 | Ga0105243_100207565 | 257 |
| 606 | 3300009174 | Ga0105241_10093808 | Ga0105241_100938082 | 257 |
| 607 | 3300009176 | Ga0105242_10085438 | Ga0105242_100854383 | 257 |
| 608 | 3300009177 | Ga0105248_10095524 | Ga0105248_100955242 | 257 |
| 609 | 3300009545 | Ga0105237_10134764 | Ga0105237_101347642 | 257 |
| 610 | 3300011119 | Ga0105246_10015760 | Ga0105246_100157603 | 257 |
| 611 | 3300013296 | Ga0157374_10003239 | Ga0157374_100032398 | 257 |
| 612 | 3300013297 | Ga0157378_10066261 | Ga0157378_100662612 | 257 |
| 613 | 3300013306 | Ga0163162_10212560 | Ga0163162_102125602 | 257 |
| 614 | 3300014325 | Ga0163163_10014945 | Ga0163163_100149455 | 257 |
| 615 | 3300014325 | Ga0163163_10015790 | Ga0163163_100157904 | 257 |
| 616 | 3300014969 | Ga0157376_10025997 | Ga0157376_100259975 | 257 |
| 617 | 3300025899 | Ga0207642_10003991 | Ga0207642_100039914 | 257 |
| 618 | 3300025900 | Ga0207710_10005716 | Ga0207710_100057164 | 257 |
| 619 | 3300025901 | Ga0207688_10004677 | Ga0207688_100046776 | 257 |
| 620 | 3300025903 | Ga0207680_10217828 | Ga0207680_102178281 | 257 |
| 621 | 3300025907 | Ga0207645_10007388 | Ga0207645_100073882 | 257 |
| 622 | 3300025908 | Ga0207643_10000794 | Ga0207643_1000079417 | 257 |
| 623 | 3300025911 | Ga0207654_10115797 | Ga0207654_101157971 | 257 |
| 624 | 3300025914 | Ga0207671_10117360 | Ga0207671_101173602 | 257 |
| 625 | 3300025916 | Ga0207663_10037576 | Ga0207663_100375763 | 257 |
| 626 | 3300025918 | Ga0207662_10000424 | Ga0207662_1000042417 | 257 |
| 627 | 3300025919 | Ga0207657_10093633 | Ga0207657_100936334 | 257 |
| 628 | 3300025920 | Ga0207649_10016093 | Ga0207649_100160934 | 257 |
| 629 | 3300025921 | Ga0207652_10319609 | Ga0207652_103196092 | 257 |
| 630 | 3300025923 | Ga0207681_10113290 | Ga0207681_101132902 | 257 |
| 631 | 3300025925 | Ga0207650_10019548 | Ga0207650_100195484 | 257 |
| 632 | 3300025926 | Ga0207659_10024969 | Ga0207659_100249691 | 257 |
| 633 | 3300025927 | Ga0207687_10020983 | Ga0207687_100209833 | 257 |
| 634 | 3300025931 | Ga0207644_10015484 | Ga0207644_100154845 | 257 |
| 635 | 3300025933 | Ga0207706_10018822 | Ga0207706_100188224 | 257 |
| 636 | 3300025934 | Ga0207686_10167007 | Ga0207686_101670071 | 257 |
| 637 | 3300025935 | Ga0207709_10017967 | Ga0207709_100179672 | 257 |
| 638 | 3300025938 | Ga0207704_10071538 | Ga0207704_100715383 | 257 |
| 639 | 3300025940 | Ga0207691_10002691 | Ga0207691_1000269111 | 257 |
| 640 | 3300025941 | Ga0207711_10022868 | Ga0207711_100228685 | 257 |
| 641 | 3300025944 | Ga0207661_10014563 | Ga0207661_100145636 | 257 |
| 642 | 3300025945 | Ga0207679_10028966 | Ga0207679_100289662 | 257 |
| 643 | 3300025961 | Ga0207712_10231411 | Ga0207712_102314112 | 257 |
| 644 | 3300025981 | Ga0207640_10234715 | Ga0207640_102347152 | 257 |
| 645 | 3300026023 | Ga0207677_10011070 | Ga0207677_100110704 | 257 |
| 646 | 3300026035 | Ga0207703_10517122 | Ga0207703_105171222 | 257 |
| 647 | 3300026041 | Ga0207639_10054996 | Ga0207639_100549964 | 257 |
| 648 | 3300026067 | Ga0207678_10003923 | Ga0207678_1000392315 | 257 |
| 649 | 3300026075 | Ga0207708_10000784 | Ga0207708_100007845 | 257 |
| 650 | 3300026078 | Ga0207702_10033740 | Ga0207702_100337403 | 257 |
| 651 | 3300026078 | Ga0207702_10251491 | Ga0207702_102514912 | 257 |
| 652 | 3300026088 | Ga0207641_10006530 | Ga0207641_100065307 | 257 |
| 653 | 3300026089 | Ga0207648_10002310 | Ga0207648_1000231021 | 257 |
| 654 | 3300026095 | Ga0207676_10002295 | Ga0207676_100022956 | 257 |
| 655 | 3300026118 | Ga0207675_100002371 | Ga0207675_10000237110 | 257 |
| 656 | 3300026142 | Ga0207698_10457529 | Ga0207698_104575291 | 257 |
| 657 | 3300028379 | Ga0268266_10165814 | Ga0268266_101658143 | 257 |
| 658 | 3300028380 | Ga0268265_10013453 | Ga0268265_100134532 | 257 |
| 659 | 3300028381 | Ga0268264_10042233 | Ga0268264_100422334 | 257 |
| 660 | 3300035171 | Ga0373946_0012725 | Ga0373946_0012725_736_1509 | 257 |
| 661 | 3300035695 | Ga0373927_0025259 | Ga0373927_0025259_1901_2674 | 257 |
| 662 | 3300035695 | Ga0373927_0330621 | Ga0373927_0330621_16_792 | 257 |
| 663 | 3300035725 | Ga0373947_0010154 | Ga0373947_0010154_3408_4181 | 257 |
| 664 | 3300037068 | Ga0373925_0012254 | Ga0373925_0012254_2476_3249 | 257 |
| 665 | 3300037068 | Ga0373925_0096835 | Ga0373925_0096835_187_963 | 257 |
| 666 | 3300046473 | Ga0495582_0025773 | Ga0495582_0025773_1720_2493 | 257 |
| 667 | 3300046474 | Ga0495605_0176373 | Ga0495605_0176373_17_790 | 257 |
| 668 | 3300046513 | Ga0495616_0049664 | Ga0495616_0049664_631_1404 | 257 |
| 669 | 3300046517 | Ga0495630_0120545 | Ga0495630_0120545_167_940 | 257 |
| 670 | 3300046533 | Ga0495640_0119257 | Ga0495640_0119257_547_1323 | 257 |
| 671 | 3300046557 | Ga0495622_0037475 | Ga0495622_0037475_1031_1804 | 257 |
| 672 | 3300046616 | Ga0495668_0055390 | Ga0495668_0055390_983_1756 | 257 |
| 673 | 3300046683 | Ga0495658_0080898 | Ga0495658_0080898_296_1069 | 257 |
| 674 | 3300046684 | Ga0495669_0041655 | Ga0495669_0041655_250_1023 | 257 |
| 675 | 3300046794 | Ga0495589_0035287 | Ga0495589_0035287_671_1444 | 257 |
| 676 | 3300047321 | Ga0495676_0056443 | Ga0495676_0056443_1206_1979 | 257 |
| 677 | 3300048903 | Ga0496100_0008677 | Ga0496100_0008677_3066_3839 | 257 |
| 678 | 3300048904 | Ga0496101_0040893 | Ga0496101_0040893_1247_2020 | 257 |
| 679 | 3300048905 | Ga0496102_0009880 | Ga0496102_0009880_2016_2792 | 257 |
| 680 | 3300048905 | Ga0496102_0017733 | Ga0496102_0017733_1940_2713 | 257 |
| 681 | 3300048906 | Ga0496103_0005658 | Ga0496103_0005658_622_1395 | 257 |
| 682 | 3300048906 | Ga0496103_0017084 | Ga0496103_0017084_1912_2688 | 257 |
| 683 | 3300048907 | Ga0496104_0009785 | Ga0496104_0009785_4901_5677 | 257 |
| 684 | 3300048907 | Ga0496104_0013405 | Ga0496104_0013405_996_1769 | 257 |
| 685 | 3300048908 | Ga0496105_0001436 | Ga0496105_0001436_10054_10827 | 257 |
| 686 | 3300048908 | Ga0496105_0006858 | Ga0496105_0006858_7667_8443 | 257 |
| 687 | 3300048909 | Ga0496106_0020513 | Ga0496106_0020513_733_1509 | 257 |
| 688 | 3300048909 | Ga0496106_0026257 | Ga0496106_0026257_868_1641 | 257 |
| 689 | 3300048909 | Ga0496106_0175635 | Ga0496106_0175635_108_881 | 257 |
| 690 | 3300048910 | Ga0496107_0012097 | Ga0496107_0012097_3431_4204 | 257 |
| 691 | 3300048911 | Ga0496108_0000386 | Ga0496108_0000386_1754_2530 | 257 |
| 692 | 3300048911 | Ga0496108_0002833 | Ga0496108_0002833_2919_3692 | 257 |
| 693 | 3300048912 | Ga0496109_0001313 | Ga0496109_0001313_2364_3140 | 257 |
| 694 | 3300048912 | Ga0496109_0016420 | Ga0496109_0016420_1815_2588 | 257 |
| 695 | 3300048913 | Ga0496110_0068174 | Ga0496110_0068174_1897_2673 | 257 |
| 696 | 3300048913 | Ga0496110_0102662 | Ga0496110_0102662_742_1515 | 257 |
| 697 | 3300048914 | Ga0496111_0000388 | Ga0496111_0000388_9057_9833 | 257 |
| 698 | 3300048914 | Ga0496111_0012071 | Ga0496111_0012071_4201_4974 | 257 |
| 699 | 3300048915 | Ga0496112_0000426 | Ga0496112_0000426_25426_26202 | 257 |
| 700 | 3300048915 | Ga0496112_0201840 | Ga0496112_0201840_868_1641 | 257 |
| 701 | 3300048916 | Ga0496113_0000395 | Ga0496113_0000395_19300_20076 | 257 |
| 702 | 3300048916 | Ga0496113_0039315 | Ga0496113_0039315_1554_2327 | 257 |
| 703 | 3300048917 | Ga0496114_0028261 | Ga0496114_0028261_2749_3522 | 257 |
| 704 | 3300048917 | Ga0496114_0155661 | Ga0496114_0155661_134_907 | 257 |
| 705 | 3300048918 | Ga0496115_0009860 | Ga0496115_0009860_6149_6925 | 257 |
| 706 | 3300048918 | Ga0496115_0030874 | Ga0496115_0030874_307_1080 | 257 |
| 707 | 3300050490 | nmdc:mga03n38_28157_c1 | nmdc:mga03n38_28157_c1_249_1022 | 257 |
| 708 | 3300050492 | nmdc:mga0yw44_10144_c1 | nmdc:mga0yw44_10144_c1_1581_2354 | 257 |
| 709 | 3300050494 | nmdc:mga06z11_5286_c1 | nmdc:mga06z11_5286_c1_2793_3566 | 257 |
| 710 | 3300050507 | nmdc:mga05p37_6242_c1 | nmdc:mga05p37_6242_c1_4893_5669 | 257 |
| 711 | 3300050510 | nmdc:mga06r32_127007_c1 | nmdc:mga06r32_127007_c1_1441_2217 | 257 |
| 712 | 3300050512 | nmdc:mga0n895_56218_c1 | nmdc:mga0n895_56218_c1_2363_3139 | 257 |
| 713 | 3300050513 | nmdc:mga0rr50_236733_c1 | nmdc:mga0rr50_236733_c1_415_1191 | 257 |
| 714 | 3300053083 | Ga0495655_0036411 | Ga0495655_0036411_380_1153 | 257 |
| 715 | 3300053085 | Ga0495619_0020844 | Ga0495619_0020844_364_1140 | 257 |
| 716 | 3300053087 | Ga0500643_008988 | Ga0500643_008988_1402_2184 | 257 |
| 717 | 3300053094 | Ga0500566_0031929 | Ga0500566_0031929_11_793 | 257 |
| 718 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_936876_937658 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3axf-assembly3.cif.gz_C | perrhenate binding to a11c/r153c moda mutant | 0.8953 | 31 | 257 |
| 4xxu-assembly1.cif.gz_B | moda - chromate bound | 0.8901 | 31 | 257 |
| 7tav-assembly6.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8796 | 31 | 256 |
| 7tav-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8787 | 31 | 257 |
| 3axf-assembly3.cif.gz_C | perrhenate binding to a11c/r153c moda mutant | 0.8772 | 31 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kd5C01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9067 | 31 | 257 | 3.40.190.10 |
| 1atgA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9 | 33 | 257 | 3.40.190.10 |
| 4rxlA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8994 | 33 | 108 | 3.40.190.10 |
| 4kd5C01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8857 | 31 | 257 | 3.40.190.10 |
| 2h5yB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8827 | 30 | 257 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1R146-F1-model_v4 | deleted | 0.9659 | 81 | 257 |
|
| AF-A0A520GGA9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9639 | 63 | 257 |
GO:0015689
GO:0030973 |
| AF-A0A4V1R146-F1-model_v4 | deleted | 0.9606 | 81 | 257 |
|
| AF-A0A520GGA9-F1-model_v4 | ABC transporter substrate-binding protein | 0.9591 | 63 | 257 |
GO:0015689
GO:0030973 |
| AF-A0A127EYM7-F1-model_v4 | Molybdate ABC transporter periplasmic-binding protein | 0.959 | 31 | 257 |
GO:0015689
GO:0030973 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar