F477144

General Info

Members Datasets Scaffolds Average Seq Length
718 343 718 252

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100560360|Ga0070708_1005603602
Length 266
Sequence MRRTNFVHCDQWGYHEKVLAHCSRIDAGLCMSPFADLQATELKILAGGSMTGSLNELGPQFERASGHKLTIHFDSTPNLIKQATSGEPFDLAVVPVDVFKDTAAKARFVPGPTIDIARVCYGVIVRAGTPKPDVSTPDALKQTLLNAQSITFLPESAAGAYVLSVFSRLGISEAMKAKTRPQAAPAQIAHAVAKGEADLGVFLVNVLIAPGVELAGPFPAELQQELVFTSAVAADSKNAEAAKAFINYLMTPTAAAVIKAKGMAPG

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
216 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
241 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
283 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
284 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
285 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
286 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
287 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
309 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
312 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
313 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
314 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
329 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
332 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
333 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
334 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
341 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
342 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
343 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.52
Nodule 0
Rhizoplane 12.26
Rhizosphere 77.72
Stem 0
Stem Tuber 0
Unclassified 2.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003828 3300001977 Bacteria 2377
2 JGI24737J22298_10020484 3300001990 Bacteria 2111
3 JGI24748J21848_1000524 3300002074 Bacteria 4194
4 JGI24738J21930_10017382 3300002075 Bacteria 1512
5 JGI24744J21845_10004801 3300002077 Bacteria 2795
6 JGI25404J52841_10003853 3300003659 Bacteria 3000
7 JGI25404J52841_10015330 3300003659 Bacteria 1663
8 JGI25405J52794_10045588 3300003911 Bacteria 933
9 Ga0070690_100021813 3300005330 Bacteria 3914
10 Ga0070670_100201244 3300005331 Bacteria 1730
11 Ga0070670_100531736 3300005331 Bacteria 1048
12 Ga0070677_10172808 3300005333 Bacteria 1023
13 Ga0070677_10209931 3300005333 Unclassified 945
14 Ga0068869_100277372 3300005334 Bacteria 1347
15 Ga0070666_10071962 3300005335 Bacteria 2354
16 Ga0070666_10237672 3300005335 Bacteria 1288
17 Ga0070680_100268906 3300005336 Bacteria 1443
18 Ga0070682_100122410 3300005337 Bacteria 1749
19 Ga0070682_100280581 3300005337 Bacteria 1214
20 Ga0068868_100022399 3300005338 Bacteria 4767
21 Ga0068868_100389111 3300005338 Bacteria 1201
22 Ga0068868_100521008 3300005338 Bacteria 1044
23 Ga0070660_100098830 3300005339 Bacteria 2310
24 Ga0070660_100112646 3300005339 Bacteria 2166
25 Ga0070689_100001662 3300005340 Bacteria 14205
26 Ga0070691_10011614 3300005341 Bacteria 4023
27 Ga0070687_100029272 3300005343 Bacteria 2680
28 Ga0070687_100092025 3300005343 Bacteria 1680
29 Ga0070661_100036904 3300005344 Bacteria 3554
30 Ga0070661_100267371 3300005344 Bacteria 1323
31 Ga0070661_100371460 3300005344 Bacteria 1126
32 Ga0070692_10027176 3300005345 Bacteria 2834
33 Ga0070668_100038142 3300005347 Bacteria 3671
34 Ga0070668_100343820 3300005347 Bacteria 1261
35 Ga0070669_100069685 3300005353 Bacteria 2598
36 Ga0070669_100096099 3300005353 Bacteria 2229
37 Ga0070675_100047606 3300005354 Bacteria 3513
38 Ga0070675_100728943 3300005354 Unclassified 904
39 Ga0070671_100019919 3300005355 Bacteria 5465
40 Ga0070671_100027961 3300005355 Bacteria 4643
41 Ga0070674_100027518 3300005356 Bacteria 3727
42 Ga0070674_100086602 3300005356 Bacteria 2250
43 Ga0070673_100230069 3300005364 Bacteria 1608
44 Ga0070688_100065983 3300005365 Bacteria 2302
45 Ga0070688_100174912 3300005365 Bacteria 1485
46 Ga0070688_100317403 3300005365 Unclassified 1131
47 Ga0070659_100058345 3300005366 Bacteria 3046
48 Ga0070667_100015429 3300005367 Bacteria 6316
49 Ga0070667_100162617 3300005367 Bacteria 1967
50 Ga0070667_100280910 3300005367 Bacteria 1495
51 Ga0070714_100240437 3300005435 Bacteria 1671
52 Ga0070713_100232416 3300005436 Bacteria 1677
53 Ga0070713_100391914 3300005436 Bacteria 1296
54 Ga0070713_100743772 3300005436 Bacteria 938
55 Ga0070701_10006562 3300005438 Bacteria 4905
56 Ga0070701_10261592 3300005438 Bacteria 1049
57 Ga0070705_100094405 3300005440 Bacteria 1873
58 Ga0070700_100062136 3300005441 Bacteria 2359
59 Ga0070708_100560360 3300005445 Bacteria 1078
60 Ga0070663_100076740 3300005455 Bacteria 2444
61 Ga0070663_100123633 3300005455 Bacteria 1957
62 Ga0070663_100173931 3300005455 Bacteria 1666
63 Ga0070678_100019754 3300005456 Bacteria 4403
64 Ga0070678_100067401 3300005456 Bacteria 2664
65 Ga0070678_100164381 3300005456 Bacteria 1801
66 Ga0070662_100148845 3300005457 Bacteria 1820
67 Ga0070662_100216435 3300005457 Bacteria 1526
68 Ga0068867_100058761 3300005459 Bacteria 2850
69 Ga0068867_100203594 3300005459 Bacteria 1586
70 Ga0070685_10072406 3300005466 Bacteria 2046
71 Ga0070698_100115178 3300005471 Bacteria 2653
72 Ga0070679_100608630 3300005530 Bacteria 1036
73 Ga0070684_100035117 3300005535 Bacteria 4289
74 Ga0070684_100107553 3300005535 Bacteria 2498
75 Ga0070697_100396478 3300005536 Bacteria 1197
76 Ga0068853_100156895 3300005539 Bacteria 2051
77 Ga0068853_100309214 3300005539 Bacteria 1463
78 Ga0068853_100641073 3300005539 Bacteria 1011
79 Ga0070672_100003299 3300005543 Bacteria 10449
80 Ga0070696_100146186 3300005546 Bacteria 1732
81 Ga0070693_100111908 3300005547 Bacteria 1681
82 Ga0070693_100164847 3300005547 Bacteria 1414
83 Ga0070693_100275982 3300005547 Bacteria 1124
84 Ga0070665_100041916 3300005548 Bacteria 4601
85 Ga0070665_100153300 3300005548 Bacteria 2306
86 Ga0070665_100597368 3300005548 Bacteria 1117
87 Ga0070664_100036292 3300005564 Bacteria 4140
88 Ga0070664_100102739 3300005564 Bacteria 2487
89 Ga0068857_100500721 3300005577 Bacteria 1140
90 Ga0068854_100061089 3300005578 Bacteria 2728
91 Ga0068854_100175615 3300005578 Bacteria 1670
92 Ga0068856_100003347 3300005614 Bacteria 16276
93 Ga0068856_100312836 3300005614 Bacteria 1588
94 Ga0068856_100379643 3300005614 Bacteria 1432
95 Ga0068852_100046625 3300005616 Bacteria 3694
96 Ga0068852_100129085 3300005616 Bacteria 2325
97 Ga0068859_100021148 3300005617 Bacteria 6529
98 Ga0068859_100163980 3300005617 Bacteria 2301
99 Ga0068864_100006339 3300005618 Bacteria 9703
100 Ga0068864_100089179 3300005618 Bacteria 2717
101 Ga0068864_100423324 3300005618 Bacteria 1269
102 Ga0068866_10004065 3300005718 Bacteria 6005
103 Ga0068861_100043820 3300005719 Bacteria 3361
104 Ga0068861_100190918 3300005719 Bacteria 1712
105 Ga0068861_100226964 3300005719 Bacteria 1582
106 Ga0068861_100393163 3300005719 Bacteria 1228
107 Ga0068861_100472242 3300005719 Bacteria 1128
108 Ga0068870_10116407 3300005840 Bacteria 1533
109 Ga0068863_100005456 3300005841 Bacteria 12531
110 Ga0068860_100008760 3300005843 Bacteria 10078
111 Ga0068860_100081543 3300005843 Bacteria 3076
112 Ga0068860_100100065 3300005843 Bacteria 2765
113 Ga0068862_100061588 3300005844 Bacteria 3226
114 Ga0068862_100098063 3300005844 Bacteria 2560
115 Ga0068862_100268495 3300005844 Bacteria 1559
116 Ga0068862_100271003 3300005844 Bacteria 1552
117 Ga0081455_10001734 3300005937 Bacteria 26379
118 Ga0081455_10015026 3300005937 Bacteria 7541
119 Ga0081455_10017479 3300005937 Bacteria 6872
120 Ga0081455_10040027 3300005937 Bacteria 4137
121 Ga0081455_10343491 3300005937 Bacteria 1055
122 Ga0081540_1000007 3300005983 Bacteria 205328
123 Ga0081540_1000105 3300005983 Bacteria 89863
124 Ga0081540_1003965 3300005983 Bacteria 11501
125 Ga0081540_1026858 3300005983 Bacteria 3275
126 Ga0070717_10064461 3300006028 Bacteria 3043
127 Ga0070717_10663546 3300006028 Bacteria 947
128 Ga0075365_10222696 3300006038 Bacteria 1324
129 Ga0075365_10263989 3300006038 Bacteria 1211
130 Ga0075365_10288284 3300006038 Bacteria 1155
131 Ga0075368_10031919 3300006042 Bacteria 2044
132 Ga0075368_10078818 3300006042 Bacteria 1338
133 Ga0075363_100033900 3300006048 Bacteria 2663
134 Ga0075363_100234600 3300006048 Bacteria 1054
135 Ga0070716_100170099 3300006173 Bacteria 1421
136 Ga0070712_100055550 3300006175 Bacteria 2774
137 Ga0070712_100080564 3300006175 Bacteria 2357
138 Ga0075362_10040333 3300006177 Bacteria 2056
139 Ga0075367_10068817 3300006178 Bacteria 2124
140 Ga0075367_10081807 3300006178 Bacteria 1954
141 Ga0075367_10162074 3300006178 Bacteria 1391
142 Ga0075367_10184526 3300006178 Bacteria 1301
143 Ga0075366_10062746 3300006195 Bacteria 2208
144 Ga0097621_100008674 3300006237 Bacteria 7339
145 Ga0097621_100100345 3300006237 Bacteria 2435
146 Ga0075370_10148644 3300006353 Bacteria 1373
147 Ga0068871_100026031 3300006358 Bacteria 4560
148 Ga0068871_100326895 3300006358 Bacteria 1352
149 Ga0068871_100610559 3300006358 Bacteria 992
150 Ga0075428_100027523 3300006844 Bacteria 6290
151 Ga0075430_100084022 3300006846 Bacteria 2667
152 Ga0075431_100122877 3300006847 Bacteria 2679
153 Ga0075431_100183347 3300006847 Bacteria 2148
154 Ga0075433_10027057 3300006852 Bacteria 4862
155 Ga0075434_100012519 3300006871 Bacteria 8046
156 Ga0075434_100014111 3300006871 Bacteria 7630
157 Ga0075434_100225504 3300006871 Bacteria 1893
158 Ga0075429_100472408 3300006880 Bacteria 1099
159 Ga0068865_100095558 3300006881 Bacteria 2165
160 Ga0068865_100467611 3300006881 Unclassified 1046
161 Ga0097620_100021146 3300006931 Bacteria 6529
162 Ga0097620_100163987 3300006931 Bacteria 2301
163 Ga0099794_10066421 3300007265 Bacteria 1760
164 Ga0099794_10163626 3300007265 Bacteria 1132
165 Ga0099795_10031853 3300007788 Bacteria 1819
166 Ga0105240_10255829 3300009093 Bacteria 2022
167 Ga0111539_10076949 3300009094 Bacteria 3928
168 Ga0111539_10293057 3300009094 Bacteria 1893
169 Ga0111539_10567908 3300009094 Bacteria 1321
170 Ga0105245_10027586 3300009098 Bacteria 5003
171 Ga0105245_10063788 3300009098 Bacteria 3328
172 Ga0105245_10258761 3300009098 Bacteria 1693
173 Ga0105247_10012572 3300009101 Bacteria 5084
174 Ga0114129_10050640 3300009147 Bacteria 5833
175 Ga0114129_10619074 3300009147 Bacteria 1401
176 Ga0105243_10020756 3300009148 Bacteria 4984
177 Ga0105243_10107981 3300009148 Bacteria 2323
178 Ga0105243_10420351 3300009148 Bacteria 1247
179 Ga0105243_10442065 3300009148 Bacteria 1218
180 Ga0105241_10093808 3300009174 Bacteria 2373
181 Ga0105241_10418413 3300009174 Bacteria 1179
182 Ga0105242_10085438 3300009176 Bacteria 2646
183 Ga0105248_10090371 3300009177 Bacteria 3448
184 Ga0105248_10095524 3300009177 Bacteria 3347
185 Ga0105248_10234721 3300009177 Bacteria 2065
186 Ga0105248_10283841 3300009177 Bacteria 1864
187 Ga0105248_10454036 3300009177 Bacteria 1444
188 Ga0105237_10059660 3300009545 Bacteria 3816
189 Ga0105237_10134764 3300009545 Bacteria 2464
190 Ga0105237_10625038 3300009545 Bacteria 1084
191 Ga0105238_10049666 3300009551 Bacteria 4224
192 Ga0105238_10232933 3300009551 Bacteria 1818
193 Ga0105238_10763859 3300009551 Bacteria 981
194 Ga0105249_10166479 3300009553 Bacteria 2134
195 Ga0105249_10218549 3300009553 Bacteria 1874
196 Ga0105249_10228388 3300009553 Bacteria 1835
197 Ga0099796_10026830 3300010159 Bacteria 1834
198 Ga0099796_10126705 3300010159 Bacteria 986
199 Ga0105239_10083385 3300010375 Bacteria 3520
200 Ga0105239_10146039 3300010375 Bacteria 2638
201 Ga0105239_10338932 3300010375 Bacteria 1696
202 Ga0105239_10569234 3300010375 Bacteria 1291
203 Ga0105246_10015760 3300011119 Bacteria 4778
204 Ga0157370_10556305 3300013104 Bacteria 1052
205 Ga0157374_10003239 3300013296 Bacteria 13672
206 Ga0157374_10200703 3300013296 Bacteria 1953
207 Ga0157374_10508647 3300013296 Bacteria 1210
208 Ga0157378_10009041 3300013297 Bacteria 8671
209 Ga0157378_10066261 3300013297 Bacteria 3234
210 Ga0157378_10552613 3300013297 Bacteria 1157
211 Ga0163162_10212560 3300013306 Bacteria 2064
212 Ga0163162_10386812 3300013306 Bacteria 1532
213 Ga0163162_10659944 3300013306 Bacteria 1169
214 Ga0163162_11048056 3300013306 Unclassified 923
215 Ga0157375_10047518 3300013308 Bacteria 4192
216 Ga0157375_10103459 3300013308 Bacteria 2935
217 Ga0157375_10156349 3300013308 Bacteria 2419
218 Ga0157375_10201898 3300013308 Bacteria 2144
219 Ga0157375_11166684 3300013308 Bacteria 903
220 Ga0163163_10014945 3300014325 Bacteria 7154
221 Ga0163163_10015790 3300014325 Bacteria 6993
222 Ga0163163_10038493 3300014325 Bacteria 4662
223 Ga0163163_10092019 3300014325 Bacteria 3047
224 Ga0157380_10327978 3300014326 Bacteria 1422
225 Ga0157377_10044111 3300014745 Bacteria 2485
226 Ga0157379_10043542 3300014968 Bacteria 4008
227 Ga0157376_10025997 3300014969 Bacteria 4619
228 Ga0157376_10047907 3300014969 Bacteria 3531
229 Ga0157376_10240321 3300014969 Bacteria 1687
230 Ga0157376_10391642 3300014969 Bacteria 1341
231 Ga0157376_10414288 3300014969 Bacteria 1306
232 Ga0209758_1000125 3300025297 Bacteria 189869
233 Ga0207697_10062448 3300025315 Bacteria 1551
234 Ga0207682_10209306 3300025893 Unclassified 899
235 Ga0207642_10003991 3300025899 Bacteria 4709
236 Ga0207642_10176595 3300025899 Bacteria 1160
237 Ga0207710_10005716 3300025900 Bacteria 5341
238 Ga0207710_10197622 3300025900 Bacteria 992
239 Ga0207688_10004677 3300025901 Bacteria 7461
240 Ga0207688_10072244 3300025901 Bacteria 1960
241 Ga0207688_10144546 3300025901 Bacteria 1401
242 Ga0207680_10217828 3300025903 Bacteria 1307
243 Ga0207645_10007388 3300025907 Bacteria 7770
244 Ga0207645_10116104 3300025907 Bacteria 1735
245 Ga0207645_10339229 3300025907 Bacteria 1004
246 Ga0207643_10000794 3300025908 Bacteria 19261
247 Ga0207654_10115797 3300025911 Bacteria 1675
248 Ga0207671_10117360 3300025914 Bacteria 2031
249 Ga0207671_10214644 3300025914 Bacteria 1506
250 Ga0207693_10033602 3300025915 Bacteria 4046
251 Ga0207663_10037576 3300025916 Bacteria 2920
252 Ga0207660_10327421 3300025917 Bacteria 1224
253 Ga0207662_10000424 3300025918 Bacteria 18665
254 Ga0207662_10102114 3300025918 Bacteria 1778
255 Ga0207662_10220715 3300025918 Bacteria 1234
256 Ga0207657_10093633 3300025919 Bacteria 2502
257 Ga0207657_10111110 3300025919 Bacteria 2263
258 Ga0207649_10016093 3300025920 Bacteria 4212
259 Ga0207649_10330285 3300025920 Bacteria 1123
260 Ga0207649_10418610 3300025920 Bacteria 1006
261 Ga0207652_10011695 3300025921 Bacteria 7082
262 Ga0207652_10319609 3300025921 Bacteria 1401
263 Ga0207681_10113290 3300025923 Bacteria 1977
264 Ga0207694_10029408 3300025924 Bacteria 4193
265 Ga0207694_10422766 3300025924 Bacteria 1110
266 Ga0207650_10019548 3300025925 Bacteria 4762
267 Ga0207650_10472360 3300025925 Unclassified 1046
268 Ga0207659_10024969 3300025926 Bacteria 4011
269 Ga0207687_10020983 3300025927 Bacteria 4337
270 Ga0207687_10066178 3300025927 Bacteria 2568
271 Ga0207700_10157416 3300025928 Bacteria 1884
272 Ga0207700_10546522 3300025928 Bacteria 1028
273 Ga0207700_10576234 3300025928 Bacteria 1000
274 Ga0207664_10729915 3300025929 Bacteria 891
275 Ga0207644_10015484 3300025931 Bacteria 5120
276 Ga0207644_10029172 3300025931 Bacteria 3825
277 Ga0207706_10018822 3300025933 Bacteria 6211
278 Ga0207686_10167007 3300025934 Bacteria 1548
279 Ga0207709_10017967 3300025935 Bacteria 3955
280 Ga0207709_10153042 3300025935 Bacteria 1600
281 Ga0207670_10053842 3300025936 Bacteria 2713
282 Ga0207670_10087056 3300025936 Bacteria 2200
283 Ga0207704_10071538 3300025938 Bacteria 2201
284 Ga0207704_10206741 3300025938 Bacteria 1441
285 Ga0207704_10614655 3300025938 Unclassified 891
286 Ga0207665_10113190 3300025939 Bacteria 1909
287 Ga0207691_10002691 3300025940 Bacteria 17379
288 Ga0207711_10022868 3300025941 Bacteria 5232
289 Ga0207711_10087104 3300025941 Bacteria 2739
290 Ga0207689_10088660 3300025942 Bacteria 2541
291 Ga0207689_10126834 3300025942 Bacteria 2099
292 Ga0207689_10278928 3300025942 Bacteria 1384
293 Ga0207661_10014563 3300025944 Bacteria 5769
294 Ga0207679_10028966 3300025945 Bacteria 3850
295 Ga0207679_10176092 3300025945 Bacteria 1766
296 Ga0207667_10228090 3300025949 Bacteria 1907
297 Ga0207651_10250583 3300025960 Bacteria 1449
298 Ga0207712_10021041 3300025961 Bacteria 4278
299 Ga0207712_10189533 3300025961 Bacteria 1622
300 Ga0207712_10231411 3300025961 Bacteria 1484
301 Ga0207668_10154049 3300025972 Bacteria 1783
302 Ga0207640_10234715 3300025981 Bacteria 1413
303 Ga0207677_10011070 3300026023 Bacteria 5127
304 Ga0207677_10218335 3300026023 Bacteria 1527
305 Ga0207677_10242156 3300026023 Bacteria 1460
306 Ga0207677_10539596 3300026023 Bacteria 1015
307 Ga0207703_10517122 3300026035 Bacteria 1122
308 Ga0207639_10054996 3300026041 Bacteria 3044
309 Ga0207639_10101798 3300026041 Bacteria 2324
310 Ga0207639_10207058 3300026041 Bacteria 1686
311 Ga0207678_10003923 3300026067 Bacteria 13383
312 Ga0207678_10060137 3300026067 Bacteria 3268
313 Ga0207678_10246715 3300026067 Bacteria 1529
314 Ga0207678_10321441 3300026067 Bacteria 1331
315 Ga0207708_10000784 3300026075 Bacteria 23952
316 Ga0207708_10028255 3300026075 Bacteria 4247
317 Ga0207708_10115077 3300026075 Bacteria 2091
318 Ga0207708_10189790 3300026075 Bacteria 1635
319 Ga0207702_10000548 3300026078 Bacteria 41978
320 Ga0207702_10033740 3300026078 Bacteria 4276
321 Ga0207702_10251491 3300026078 Bacteria 1660
322 Ga0207641_10006530 3300026088 Bacteria 9810
323 Ga0207648_10002310 3300026089 Bacteria 20581
324 Ga0207648_10229800 3300026089 Bacteria 1650
325 Ga0207676_10002295 3300026095 Bacteria 13719
326 Ga0207676_10108437 3300026095 Bacteria 2318
327 Ga0207676_10218661 3300026095 Bacteria 1695
328 Ga0207674_10135379 3300026116 Bacteria 2426
329 Ga0207675_100002371 3300026118 Bacteria 18651
330 Ga0207675_100112829 3300026118 Bacteria 2566
331 Ga0207675_100130814 3300026118 Bacteria 2380
332 Ga0207683_10019832 3300026121 Bacteria 5743
333 Ga0207683_10021694 3300026121 Bacteria 5504
334 Ga0207683_10040045 3300026121 Bacteria 4087
335 Ga0207683_10124367 3300026121 Bacteria 2317
336 Ga0207683_10184101 3300026121 Bacteria 1894
337 Ga0207698_10034409 3300026142 Bacteria 3693
338 Ga0207698_10457529 3300026142 Bacteria 1233
339 Ga0209179_1015555 3300027512 Bacteria 1415
340 Ga0209588_1009865 3300027671 Bacteria 2862
341 Ga0209813_10065818 3300027866 Bacteria 1168
342 Ga0268266_10165814 3300028379 Bacteria 2001
343 Ga0268266_10275628 3300028379 Bacteria 1563
344 Ga0268266_10594340 3300028379 Bacteria 1063
345 Ga0268265_10013453 3300028380 Bacteria 5560
346 Ga0268265_10063828 3300028380 Bacteria 2835
347 Ga0268265_10070998 3300028380 Bacteria 2710
348 Ga0268265_10516126 3300028380 Bacteria 1129
349 Ga0268264_10042233 3300028381 Bacteria 3775
350 Ga0268264_10296560 3300028381 Bacteria 1520
351 Ga0265334_10008302 3300028573 Bacteria 4418
352 Ga0307517_10039620 3300028786 Bacteria 5167
353 Ga0307515_10006012 3300028794 Bacteria 24419
354 Ga0265330_10070693 3300031235 Bacteria 1510
355 Ga0265332_10001513 3300031238 Bacteria 12909
356 Ga0265332_10005019 3300031238 Bacteria 6151
357 Ga0265332_10032406 3300031238 Bacteria 2278
358 Ga0265325_10088971 3300031241 Bacteria 1525
359 Ga0265329_10010128 3300031242 Bacteria 3478
360 Ga0265329_10014396 3300031242 Bacteria 2795
361 Ga0265340_10005971 3300031247 Bacteria 6729
362 Ga0265339_10004623 3300031249 Bacteria 9354
363 Ga0265339_10005449 3300031249 Bacteria 8477
364 Ga0265331_10029831 3300031250 Bacteria 2720
365 Ga0265331_10031762 3300031250 Bacteria 2622
366 Ga0265331_10101952 3300031250 Bacteria 1320
367 Ga0265331_10249441 3300031250 Bacteria 796
368 Ga0265316_10046003 3300031344 Bacteria 3461
369 Ga0307509_10135476 3300031507 Bacteria 2409
370 Ga0307508_10000032 3300031616 Bacteria 163293
371 Ga0265314_10004484 3300031711 Bacteria 12947
372 Ga0265314_10042579 3300031711 Bacteria 3237
373 Ga0265342_10002428 3300031712 Bacteria 16105
374 Ga0265342_10005254 3300031712 Bacteria 9929
375 Ga0265342_10160721 3300031712 Bacteria 1242
376 Ga0307516_10126244 3300031730 Bacteria 2343
377 Ga0307510_10016157 3300033180 Bacteria 8816
378 Ga0373948_0033716 3300034817 Bacteria 1044
379 Ga0373934_0123469 3300035086 Bacteria 1054
380 Ga0373923_0001173 3300035111 Bacteria 7304
381 Ga0373936_0242128 3300035113 Bacteria 804
382 Ga0373945_0001390 3300035116 Bacteria 7348
383 Ga0373945_0036020 3300035116 Bacteria 1771
384 Ga0373953_0003727 3300035117 Bacteria 4785
385 Ga0373954_0299384 3300035118 Bacteria 793
386 Ga0373943_0008899 3300035170 Bacteria 4498
387 Ga0373946_0012725 3300035171 Bacteria 3153
388 Ga0373955_0002349 3300035172 Bacteria 8228
389 Ga0373955_0088500 3300035172 Bacteria 1761
390 Ga0373961_0021624 3300035241 Bacteria 1713
391 Ga0373924_0002221 3300035410 Bacteria 6504
392 Ga0373924_0017333 3300035410 Bacteria 2762
393 Ga0373931_0057519 3300035691 Bacteria 2086
394 Ga0373935_0000291 3300035692 Bacteria 24802
395 Ga0373935_0027445 3300035692 Bacteria 3518
396 Ga0373935_0428586 3300035692 Bacteria 953
397 Ga0373927_0002882 3300035695 Bacteria 12525
398 Ga0373927_0010828 3300035695 Bacteria 6076
399 Ga0373927_0013220 3300035695 Bacteria 5489
400 Ga0373927_0017091 3300035695 Bacteria 4780
401 Ga0373927_0025259 3300035695 Bacteria 3882
402 Ga0373927_0173228 3300035695 Bacteria 1415
403 Ga0373927_0330621 3300035695 Bacteria 1004
404 Ga0373933_0191541 3300035724 Bacteria 1306
405 Ga0373947_0005730 3300035725 Bacteria 7243
406 Ga0373947_0010154 3300035725 Bacteria 5407
407 Ga0373947_0024192 3300035725 Bacteria 3537
408 Ga0373947_0025283 3300035725 Bacteria 3462
409 Ga0373947_0028707 3300035725 Bacteria 3263
410 Ga0373947_0036395 3300035725 Bacteria 2919
411 Ga0373947_0205031 3300035725 Bacteria 1291
412 Ga0373937_0000004 3300036401 Bacteria 212269
413 Ga0373937_0007886 3300036401 Bacteria 9228
414 Ga0373937_0033145 3300036401 Bacteria 4689
415 Ga0373937_0325797 3300036401 Unclassified 1454
416 Ga0373937_0612864 3300036401 Bacteria 1033
417 Ga0373925_0000460 3300037068 Bacteria 41057
418 Ga0373925_0012254 3300037068 Bacteria 6204
419 Ga0373925_0023291 3300037068 Bacteria 4519
420 Ga0373925_0090021 3300037068 Bacteria 2345
421 Ga0373925_0096835 3300037068 Bacteria 2263
422 Ga0373925_0108321 3300037068 Bacteria 2144
423 Ga0373925_0118203 3300037068 Bacteria 2055
424 Ga0373925_0210499 3300037068 Bacteria 1549
425 Ga0373925_0505692 3300037068 Bacteria 992
426 Ga0373925_0507438 3300037068 Bacteria 990
427 Ga0436363_0335374 3300039450 Unclassified 2702
428 Ga0451798_0887340 3300041458 Unclassified 909
429 Ga0451843_0872454 3300041509 Bacteria 829
430 Ga0466963_0427385 3300044694 Bacteria 934
431 Ga0466967_0067366 3300045976 Bacteria 3193
432 Ga0495617_021764 3300046452 Bacteria 2166
433 Ga0495627_093152 3300046453 Bacteria 865
434 Ga0495592_0000029 3300046454 Bacteria 131879
435 Ga0495603_0000217 3300046455 Bacteria 29788
436 Ga0495603_0039310 3300046455 Bacteria 2835
437 Ga0495603_0050966 3300046455 Bacteria 2460
438 Ga0495603_0052598 3300046455 Bacteria 2417
439 Ga0495603_0062923 3300046455 Bacteria 2190
440 Ga0495629_0000862 3300046459 Bacteria 24478
441 Ga0495629_0257994 3300046459 Bacteria 1198
442 Ga0495638_0103778 3300046460 Bacteria 1697
443 Ga0495638_0189245 3300046460 Bacteria 1169
444 Ga0495641_0003672 3300046461 Bacteria 11330
445 Ga0495641_0017426 3300046461 Bacteria 3744
446 Ga0495641_0019640 3300046461 Bacteria 3450
447 Ga0495641_0158565 3300046461 Bacteria 1012
448 Ga0495651_0001409 3300046462 Bacteria 18662
449 Ga0495653_0000012 3300046463 Bacteria 266880
450 Ga0495650_0060149 3300046471 Bacteria 1527
451 Ga0495580_0005364 3300046472 Bacteria 10616
452 Ga0495580_0047602 3300046472 Bacteria 3039
453 Ga0495580_0293655 3300046472 Bacteria 1108
454 Ga0495582_0000990 3300046473 Bacteria 15910
455 Ga0495582_0025773 3300046473 Bacteria 3221
456 Ga0495582_0226321 3300046473 Bacteria 1071
457 Ga0495605_0026778 3300046474 Bacteria 2994
458 Ga0495605_0176373 3300046474 Bacteria 942
459 Ga0495639_0000544 3300046475 Bacteria 17562
460 Ga0495639_0021776 3300046475 Bacteria 2808
461 Ga0495639_0056218 3300046475 Bacteria 1796
462 Ga0495662_0010406 3300046476 Bacteria 4557
463 Ga0495664_0000004 3300046477 Bacteria 489411
464 Ga0495664_0001505 3300046477 Bacteria 12344
465 Ga0495664_0082445 3300046477 Bacteria 1929
466 Ga0495664_0157547 3300046477 Bacteria 1378
467 Ga0495664_0319671 3300046477 Bacteria 936
468 Ga0495584_0017649 3300046491 Bacteria 3631
469 Ga0495584_0062283 3300046491 Bacteria 1875
470 Ga0495584_0243886 3300046491 Bacteria 914
471 Ga0495585_0113784 3300046492 Bacteria 1437
472 Ga0495594_0000128 3300046499 Bacteria 35750
473 Ga0495608_0000017 3300046511 Bacteria 192929
474 Ga0495608_0147239 3300046511 Bacteria 1502
475 Ga0495616_0049664 3300046513 Bacteria 2102
476 Ga0495618_0000006 3300046514 Bacteria 229906
477 Ga0495618_0066500 3300046514 Bacteria 2291
478 Ga0495618_0277958 3300046514 Bacteria 1045
479 Ga0495620_0078562 3300046515 Bacteria 1338
480 Ga0495628_0000001 3300046516 Bacteria 917742
481 Ga0495630_0120545 3300046517 Bacteria 1990
482 Ga0495630_0453158 3300046517 Bacteria 983
483 Ga0495631_0205868 3300046518 Bacteria 841
484 Ga0495632_0090785 3300046519 Bacteria 1448
485 Ga0495644_0069798 3300046523 Bacteria 1320
486 Ga0495663_0123259 3300046525 Bacteria 869
487 Ga0495666_0070401 3300046526 Bacteria 1663
488 Ga0495652_0000002 3300046529 Bacteria 946606
489 Ga0495665_0006186 3300046531 Bacteria 6465
490 Ga0495665_0094072 3300046531 Bacteria 1575
491 Ga0495665_0211751 3300046531 Bacteria 1003
492 Ga0495640_0000001 3300046533 Bacteria 853827
493 Ga0495640_0002595 3300046533 Bacteria 14526
494 Ga0495640_0119257 3300046533 Bacteria 1717
495 Ga0495586_0142836 3300046535 Bacteria 1344
496 Ga0495587_0000008 3300046536 Bacteria 271097
497 Ga0495598_0001556 3300046537 Bacteria 4597
498 Ga0495645_0000002 3300046543 Bacteria 651644
499 Ga0495622_0037475 3300046557 Bacteria 2259
500 Ga0495622_0071643 3300046557 Bacteria 1599
501 Ga0495667_0000029 3300046559 Bacteria 151568
502 Ga0495656_0020279 3300046615 Bacteria 2577
503 Ga0495668_0055390 3300046616 Bacteria 2190
504 Ga0495634_0001583 3300046642 Bacteria 19998
505 Ga0495611_0208317 3300046648 Bacteria 911
506 Ga0495625_0068851 3300046660 Bacteria 2487
507 Ga0495635_0000002 3300046663 Bacteria 490490
508 Ga0495635_0000436 3300046663 Bacteria 26341
509 Ga0495661_0100548 3300046665 Bacteria 1628
510 Ga0495588_0076469 3300046674 Bacteria 1745
511 Ga0495588_0198910 3300046674 Bacteria 1058
512 Ga0495657_0000459 3300046675 Bacteria 38116
513 Ga0495599_0000104 3300046678 Bacteria 59442
514 Ga0495623_0000691 3300046679 Bacteria 22400
515 Ga0495646_0000064 3300046680 Bacteria 50992
516 Ga0495647_0000394 3300046681 Bacteria 12460
517 Ga0495658_0003203 3300046683 Bacteria 8153
518 Ga0495658_0080898 3300046683 Bacteria 1906
519 Ga0495658_0086047 3300046683 Bacteria 1854
520 Ga0495658_0226303 3300046683 Bacteria 1172
521 Ga0495669_0000650 3300046684 Bacteria 15146
522 Ga0495669_0041655 3300046684 Bacteria 2040
523 Ga0495613_0027954 3300046689 Bacteria 4198
524 Ga0495613_0102792 3300046689 Bacteria 2063
525 Ga0495613_0367519 3300046689 Bacteria 985
526 Ga0495624_0023168 3300046690 Bacteria 4096
527 Ga0495671_0093497 3300046692 Bacteria 1471
528 Ga0495589_0035287 3300046794 Bacteria 2508
529 Ga0495589_0042333 3300046794 Bacteria 2270
530 Ga0495589_0164450 3300046794 Bacteria 1056
531 Ga0495600_0000010 3300046809 Bacteria 143675
532 Ga0495600_0125125 3300046809 Bacteria 1672
533 Ga0495581_0003127 3300047315 Bacteria 9472
534 Ga0495581_0027892 3300047315 Bacteria 3275
535 Ga0495581_0078625 3300047315 Bacteria 1909
536 Ga0495581_0082644 3300047315 Bacteria 1860
537 Ga0495581_0089977 3300047315 Bacteria 1780
538 Ga0495604_0000009 3300047317 Bacteria 326341
539 Ga0495636_0160807 3300047318 Bacteria 1012
540 Ga0495674_0000002 3300047319 Bacteria 642785
541 Ga0495674_0008459 3300047319 Bacteria 9804
542 Ga0495674_0182507 3300047319 Bacteria 1747
543 Ga0495672_0060865 3300047320 Bacteria 2178
544 Ga0495676_0056443 3300047321 Bacteria 3105
545 Ga0495676_0082609 3300047321 Bacteria 2431
546 Ga0495676_0094806 3300047321 Bacteria 2222
547 Ga0495680_0000752 3300047322 Bacteria 36296
548 Ga0495675_0000517 3300047444 Bacteria 25028
549 Ga0495679_033846 3300047446 Bacteria 1630
550 Ga0495684_0000006 3300047471 Bacteria 247568
551 Ga0495593_0000439 3300047673 Bacteria 23237
552 Ga0495593_0015688 3300047673 Bacteria 4287
553 Ga0495593_0254338 3300047673 Bacteria 879
554 Ga0495602_0000005 3300048088 Bacteria 325957
555 Ga0495602_0097375 3300048088 Bacteria 2424
556 Ga0495614_0072055 3300048089 Bacteria 1490
557 Ga0496100_0008677 3300048903 Bacteria 5676
558 Ga0496100_0010419 3300048903 Bacteria 5260
559 Ga0496101_0002062 3300048904 Bacteria 12221
560 Ga0496101_0040893 3300048904 Bacteria 3302
561 Ga0496101_0144084 3300048904 Bacteria 1818
562 Ga0496101_0148820 3300048904 Bacteria 1789
563 Ga0496101_0311046 3300048904 Bacteria 1235
564 Ga0496102_0001771 3300048905 Bacteria 18745
565 Ga0496102_0009880 3300048905 Bacteria 8205
566 Ga0496102_0017733 3300048905 Bacteria 6241
567 Ga0496102_0300737 3300048905 Bacteria 1512
568 Ga0496102_0525027 3300048905 Bacteria 1106
569 Ga0496103_0005658 3300048906 Bacteria 7469
570 Ga0496103_0017084 3300048906 Bacteria 4338
571 Ga0496103_0049281 3300048906 Bacteria 2604
572 Ga0496103_0098855 3300048906 Bacteria 1846
573 Ga0496103_0148171 3300048906 Bacteria 1503
574 Ga0496103_0153370 3300048906 Bacteria 1476
575 Ga0496104_0001864 3300048907 Bacteria 18251
576 Ga0496104_0009785 3300048907 Bacteria 8547
577 Ga0496104_0013405 3300048907 Bacteria 7385
578 Ga0496104_0039870 3300048907 Bacteria 4399
579 Ga0496104_0082659 3300048907 Bacteria 3063
580 Ga0496104_0136187 3300048907 Bacteria 2360
581 Ga0496104_0360244 3300048907 Bacteria 1367
582 Ga0496105_0001436 3300048908 Bacteria 16761
583 Ga0496105_0002420 3300048908 Bacteria 13523
584 Ga0496105_0006858 3300048908 Bacteria 8763
585 Ga0496105_0012967 3300048908 Bacteria 6605
586 Ga0496105_0050186 3300048908 Bacteria 3446
587 Ga0496106_0020513 3300048909 Bacteria 4905
588 Ga0496106_0026257 3300048909 Bacteria 4335
589 Ga0496106_0080447 3300048909 Bacteria 2502
590 Ga0496106_0165987 3300048909 Unclassified 1748
591 Ga0496106_0175635 3300048909 Bacteria 1699
592 Ga0496107_0003490 3300048910 Bacteria 10516
593 Ga0496107_0012097 3300048910 Bacteria 6018
594 Ga0496107_0036192 3300048910 Bacteria 3540
595 Ga0496107_0081293 3300048910 Bacteria 2363
596 Ga0496107_0186014 3300048910 Bacteria 1543
597 Ga0496107_0192376 3300048910 Bacteria 1516
598 Ga0496108_0000386 3300048911 Bacteria 36634
599 Ga0496108_0002833 3300048911 Bacteria 13915
600 Ga0496108_0011203 3300048911 Bacteria 7286
601 Ga0496108_0019931 3300048911 Bacteria 5508
602 Ga0496108_0079232 3300048911 Bacteria 2781
603 Ga0496108_0308332 3300048911 Bacteria 1379
604 Ga0496109_0001313 3300048912 Bacteria 20515
605 Ga0496109_0004171 3300048912 Bacteria 12067
606 Ga0496109_0016420 3300048912 Bacteria 6472
607 Ga0496109_0128912 3300048912 Bacteria 2360
608 Ga0496109_0290514 3300048912 Bacteria 1541
609 Ga0496109_0640984 3300048912 Bacteria 999
610 Ga0496110_0055465 3300048913 Bacteria 3487
611 Ga0496110_0068174 3300048913 Bacteria 3148
612 Ga0496110_0087144 3300048913 Bacteria 2789
613 Ga0496110_0102662 3300048913 Bacteria 2564
614 Ga0496110_0179418 3300048913 Bacteria 1923
615 Ga0496111_0000388 3300048914 Bacteria 21996
616 Ga0496111_0012071 3300048914 Bacteria 5841
617 Ga0496111_0019842 3300048914 Bacteria 4674
618 Ga0496112_0000017 3300048915 Bacteria 191284
619 Ga0496112_0000426 3300048915 Bacteria 27828
620 Ga0496112_0013582 3300048915 Bacteria 7524
621 Ga0496112_0201840 3300048915 Bacteria 1947
622 Ga0496112_0206504 3300048915 Bacteria 1922
623 Ga0496112_0310408 3300048915 Bacteria 1522
624 Ga0496112_0351790 3300048915 Bacteria 1416
625 Ga0496112_0674532 3300048915 Bacteria 962
626 Ga0496113_0000395 3300048916 Bacteria 21041
627 Ga0496113_0039315 3300048916 Bacteria 3481
628 Ga0496113_0105066 3300048916 Bacteria 2192
629 Ga0496113_0111346 3300048916 Bacteria 2131
630 Ga0496113_0771676 3300048916 Unclassified 765
631 Ga0496114_0005094 3300048917 Bacteria 10241
632 Ga0496114_0028261 3300048917 Bacteria 4600
633 Ga0496114_0098347 3300048917 Bacteria 2495
634 Ga0496114_0155661 3300048917 Bacteria 1984
635 Ga0496115_0000535 3300048918 Bacteria 29580
636 Ga0496115_0009860 3300048918 Bacteria 7113
637 Ga0496115_0020774 3300048918 Bacteria 5066
638 Ga0496115_0024331 3300048918 Bacteria 4705
639 Ga0496115_0027378 3300048918 Bacteria 4457
640 Ga0496115_0030874 3300048918 Bacteria 4218
641 Ga0496115_0061373 3300048918 Bacteria 3030
642 Ga0496115_0278933 3300048918 Bacteria 1372
643 Ga0496115_0378115 3300048918 Bacteria 1152
644 Ga0496117_0030138 3300048920 Bacteria 4169
645 Ga0496119_0177624 3300048922 Bacteria 1119
646 Ga0496121_0024355 3300048924 Bacteria 5791
647 Ga0496121_0043531 3300048924 Bacteria 3887
648 Ga0496121_0124416 3300048924 Bacteria 1941
649 Ga0496124_0167459 3300048927 Bacteria 1706
650 Ga0496126_0019903 3300048929 Bacteria 6598
651 Ga0496126_0135596 3300048929 Bacteria 2124
652 Ga0496126_0289113 3300048929 Bacteria 1356
653 Ga0496126_0368417 3300048929 Bacteria 1172
654 Ga0495682_0052594 3300049460 Bacteria 1480
655 nmdc:mga03n38_160505_c1 3300050490 Bacteria 1138
656 nmdc:mga03n38_28157_c1 3300050490 Bacteria 2339
657 nmdc:mga03n38_58595_c1 3300050490 Bacteria 1745
658 nmdc:mga00v17_69404_c1 3300050491 Bacteria 2181
659 nmdc:mga0yw44_10144_c1 3300050492 Bacteria 4798
660 nmdc:mga0yw44_156426_c1 3300050492 Bacteria 1490
661 nmdc:mga06z11_155813_c1 3300050494 Bacteria 1302
662 nmdc:mga06z11_207641_c1 3300050494 Bacteria 1140
663 nmdc:mga06z11_215508_c1 3300050494 Bacteria 1120
664 nmdc:mga06z11_222403_c1 3300050494 Bacteria 1104
665 nmdc:mga06z11_5286_c1 3300050494 Bacteria 5169
666 nmdc:mga04h51_105806_c1 3300050495 Bacteria 1031
667 nmdc:mga07m45_137503_c1 3300050496 Bacteria 1414
668 nmdc:mga07m45_38017_c1 3300050496 Bacteria 2685
669 nmdc:mga05p37_6242_c1 3300050507 Bacteria 14032
670 nmdc:mga05p37_682404_c1 3300050507 Bacteria 1144
671 nmdc:mga09592_154205_c1 3300050508 Bacteria 1982
672 nmdc:mga0qj67_95982_c1 3300050509 Bacteria 2387
673 nmdc:mga06r32_127007_c1 3300050510 Bacteria 2519
674 nmdc:mga06r32_169452_c1 3300050510 Bacteria 2167
675 nmdc:mga06r32_54843_c1 3300050510 Bacteria 3822
676 nmdc:mga08y16_110342_c1 3300050511 Bacteria 2864
677 nmdc:mga0n895_18346_c1 3300050512 Bacteria 6471
678 nmdc:mga0n895_411548_c1 3300050512 Bacteria 1367
679 nmdc:mga0n895_56218_c1 3300050512 Bacteria 3876
680 nmdc:mga0rr50_236733_c1 3300050513 Bacteria 1512
681 nmdc:mga0a205_99385_c1 3300050515 Bacteria 2808
682 Ga0495601_0000002 3300053077 Bacteria 528704
683 Ga0495601_0021177 3300053077 Bacteria 3980
684 Ga0495601_0042386 3300053077 Bacteria 2856
685 Ga0495612_0000010 3300053078 Bacteria 227618
686 Ga0495655_0006829 3300053083 Bacteria 2094
687 Ga0495655_0028988 3300053083 Bacteria 1327
688 Ga0495655_0036411 3300053083 Bacteria 1230
689 Ga0495595_0000777 3300053084 Bacteria 12093
690 Ga0495619_0000019 3300053085 Bacteria 209518
691 Ga0495619_0020844 3300053085 Bacteria 4181
692 Ga0495619_0033342 3300053085 Bacteria 3344
693 Ga0495619_0175356 3300053085 Bacteria 1483
694 Ga0495619_0221361 3300053085 Unclassified 1311
695 Ga0500643_008988 3300053087 Bacteria 3860
696 Ga0500644_0001293 3300053088 Bacteria 6806
697 Ga0500651_0006213 3300053093 Bacteria 6869
698 Ga0500651_0069381 3300053093 Bacteria 2194
699 Ga0500566_0006011 3300053094 Bacteria 7218
700 Ga0500566_0031929 3300053094 Bacteria 3070
701 Ga0500641_0017678 3300053096 Bacteria 2671
702 Ga0500562_068420 3300053108 Bacteria 957
703 Ga0500595_000002 3300053119 Bacteria 1074388
704 Ga0500595_000537 3300053119 Bacteria 22809
705 Ga0500595_003301 3300053119 Bacteria 7598
706 Ga0500595_024557 3300053119 Bacteria 2102
707 Ga0500642_0081958 3300053130 Bacteria 1483
708 Ga0500568_0046742 3300053139 Bacteria 1717
709 Ga0500590_065714 3300053148 Bacteria 1813
710 Ga0500616_0000002 3300053153 Bacteria 1611257
711 Ga0500616_0046128 3300053153 Bacteria 2318
712 Ga0500616_0095147 3300053153 Bacteria 1466
713 Ga0500638_047821 3300053162 Bacteria 2070
714 Ga0500636_0010368 3300053177 Bacteria 5435
715 Ga0500637_0000042 3300053178 Bacteria 46215
716 Ga0500645_000099 3300053730 Bacteria 68426
717 Ga0500645_071614 3300053730 Bacteria 995
718 Ga0500661_000056 3300055283 Bacteria 17736

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0068851 Ga0495625_0068851_1687_2451 214
2 3300046517 Ga0495630_0453158 Ga0495630_0453158_15_668 215
3 3300046674 Ga0495588_0076469 Ga0495588_0076469_1082_1735 215
4 3300050490 nmdc:mga03n38_160505_c1 nmdc:mga03n38_160505_c1_471_1124 215
5 3300046519 Ga0495632_0090785 Ga0495632_0090785_343_1107 216
6 3300046692 Ga0495671_0093497 Ga0495671_0093497_331_1095 216
7 3300053148 Ga0500590_065714 Ga0500590_065714_985_1749 219
8 3300046455 Ga0495603_0039310 Ga0495603_0039310_1101_1865 223
9 3300046461 Ga0495641_0019640 Ga0495641_0019640_2550_3314 223
10 3300046683 Ga0495658_0086047 Ga0495658_0086047_948_1712 223
11 3300047315 Ga0495581_0027892 Ga0495581_0027892_465_1229 223
12 3300010375 Ga0105239_10146039 Ga0105239_101460393 228
13 3300026121 Ga0207683_10184101 Ga0207683_101841012 228
14 3300046557 Ga0495622_0071643 Ga0495622_0071643_650_1414 228
15 3300053119 Ga0500595_024557 Ga0500595_024557_1384_2085 229
16 3300053130 Ga0500642_0081958 Ga0500642_0081958_15_716 229
17 3300050512 nmdc:mga0n895_411548_c1 nmdc:mga0n895_411548_c1_252_1004 230
18 3300048916 Ga0496113_0771676 Ga0496113_0771676_45_752 231
19 3300006237 Ga0097621_100100345 Ga0097621_1001003452 232
20 3300009177 Ga0105248_10454036 Ga0105248_104540362 232
21 3300013297 Ga0157378_10009041 Ga0157378_100090417 232
22 3300028573 Ga0265334_10008302 Ga0265334_100083025 232
23 3300037068 Ga0373925_0210499 Ga0373925_0210499_809_1519 232
24 3300046452 Ga0495617_021764 Ga0495617_021764_863_1573 232
25 3300046475 Ga0495639_0021776 Ga0495639_0021776_918_1628 232
26 3300046648 Ga0495611_0208317 Ga0495611_0208317_16_726 232
27 3300046674 Ga0495588_0198910 Ga0495588_0198910_49_759 232
28 3300048906 Ga0496103_0049281 Ga0496103_0049281_41_751 232
29 3300048906 Ga0496103_0098855 Ga0496103_0098855_1115_1825 232
30 3300048907 Ga0496104_0082659 Ga0496104_0082659_2288_3052 232
31 3300048909 Ga0496106_0165987 Ga0496106_0165987_867_1631 232
32 3300048910 Ga0496107_0186014 Ga0496107_0186014_113_877 232
33 3300048918 Ga0496115_0027378 Ga0496115_0027378_818_1582 232
34 3300009147 Ga0114129_10619074 Ga0114129_106190741 233
35 3300050507 nmdc:mga05p37_682404_c1 nmdc:mga05p37_682404_c1_55_804 233
36 3300048929 Ga0496126_0289113 Ga0496126_0289113_115_831 234
37 3300053096 Ga0500641_0017678 Ga0500641_0017678_1904_2659 235
38 3300046531 Ga0495665_0094072 Ga0495665_0094072_47_757 236
39 3300048904 Ga0496101_0144084 Ga0496101_0144084_15_725 236
40 3300025929 Ga0207664_10729915 Ga0207664_107299151 237
41 3300007788 Ga0099795_10031853 Ga0099795_100318532 239
42 3300025939 Ga0207665_10113190 Ga0207665_101131902 239
43 3300035086 Ga0373934_0123469 Ga0373934_0123469_140_871 239
44 3300035113 Ga0373936_0242128 Ga0373936_0242128_33_764 239
45 3300035118 Ga0373954_0299384 Ga0373954_0299384_35_766 239
46 3300035172 Ga0373955_0088500 Ga0373955_0088500_146_877 239
47 3300035725 Ga0373947_0028707 Ga0373947_0028707_146_877 239
48 3300046455 Ga0495603_0052598 Ga0495603_0052598_71_802 239
49 3300046461 Ga0495641_0158565 Ga0495641_0158565_13_744 239
50 3300046473 Ga0495582_0226321 Ga0495582_0226321_63_794 239
51 3300046477 Ga0495664_0319671 Ga0495664_0319671_188_919 239
52 3300046689 Ga0495613_0367519 Ga0495613_0367519_45_776 239
53 3300047321 Ga0495676_0082609 Ga0495676_0082609_898_1629 239
54 3300006178 Ga0075367_10081807 Ga0075367_100818071 240
55 3300009094 Ga0111539_10567908 Ga0111539_105679082 240
56 3300006847 Ga0075431_100122877 Ga0075431_1001228772 242
57 3300006852 Ga0075433_10027057 Ga0075433_100270572 242
58 3300047318 Ga0495636_0160807 Ga0495636_0160807_74_838 242
59 3300048918 Ga0496115_0020774 Ga0496115_0020774_3966_4706 242
60 3300050510 nmdc:mga06r32_54843_c1 nmdc:mga06r32_54843_c1_1889_2653 242
61 3300050511 nmdc:mga08y16_110342_c1 nmdc:mga08y16_110342_c1_729_1493 242
62 3300050515 nmdc:mga0a205_99385_c1 nmdc:mga0a205_99385_c1_475_1239 242
63 3300003911 JGI25405J52794_10045588 JGI25405J52794_100455881 243
64 3300005937 Ga0081455_10001734 Ga0081455_100017343 243
65 3300006871 Ga0075434_100014111 Ga0075434_10001411112 243
66 3300025918 Ga0207662_10220715 Ga0207662_102207152 243
67 3300035695 Ga0373927_0017091 Ga0373927_0017091_3351_4094 243
68 3300035725 Ga0373947_0036395 Ga0373947_0036395_1641_2384 243
69 3300037068 Ga0373925_0118203 Ga0373925_0118203_711_1454 243
70 3300046455 Ga0495603_0050966 Ga0495603_0050966_1417_2160 243
71 3300046472 Ga0495580_0293655 Ga0495580_0293655_63_806 243
72 3300046683 Ga0495658_0226303 Ga0495658_0226303_367_1110 243
73 3300047315 Ga0495581_0082644 Ga0495581_0082644_990_1733 243
74 3300050512 nmdc:mga0n895_18346_c1 nmdc:mga0n895_18346_c1_2654_3418 243
75 3300005937 Ga0081455_10015026 Ga0081455_100150267 244
76 3300025315 Ga0207697_10062448 Ga0207697_100624482 244
77 3300005435 Ga0070714_100240437 Ga0070714_1002404372 245
78 3300006038 Ga0075365_10288284 Ga0075365_102882842 245
79 3300031711 Ga0265314_10042579 Ga0265314_100425792 245
80 3300035725 Ga0373947_0205031 Ga0373947_0205031_188_937 245
81 3300036401 Ga0373937_0612864 Ga0373937_0612864_225_974 245
82 3300037068 Ga0373925_0505692 Ga0373925_0505692_197_946 245
83 3300048929 Ga0496126_0019903 Ga0496126_0019903_255_1007 245
84 3300053730 Ga0500645_071614 Ga0500645_071614_159_911 245
85 3300005336 Ga0070680_100268906 Ga0070680_1002689062 246
86 3300009177 Ga0105248_10283841 Ga0105248_102838412 246
87 3300013297 Ga0157378_10552613 Ga0157378_105526132 246
88 3300025917 Ga0207660_10327421 Ga0207660_103274212 246
89 3300031250 Ga0265331_10249441 Ga0265331_102494411 246
90 3300046460 Ga0495638_0189245 Ga0495638_0189245_55_810 246
91 3300049460 Ga0495682_0052594 Ga0495682_0052594_387_1142 246
92 3300050494 nmdc:mga06z11_215508_c1 nmdc:mga06z11_215508_c1_295_1050 246
93 3300053093 Ga0500651_0069381 Ga0500651_0069381_1188_1943 246
94 3300031711 Ga0265314_10004484 Ga0265314_1000448415 247
95 3300039450 Ga0436363_0335374 Ga0436363_0335374_88_843 247
96 3300044694 Ga0466963_0427385 Ga0466963_0427385_25_771 247
97 3300047673 Ga0495593_0254338 Ga0495593_0254338_69_824 247
98 3300005436 Ga0070713_100232416 Ga0070713_1002324162 248
99 3300009545 Ga0105237_10059660 Ga0105237_100596603 248
100 3300009551 Ga0105238_10049666 Ga0105238_100496662 248
101 3300025928 Ga0207700_10546522 Ga0207700_105465222 248
102 3300028794 Ga0307515_10006012 Ga0307515_1000601212 248
103 3300031235 Ga0265330_10070693 Ga0265330_100706932 248
104 3300031241 Ga0265325_10088971 Ga0265325_100889712 248
105 3300031250 Ga0265331_10101952 Ga0265331_101019522 248
106 3300031712 Ga0265342_10160721 Ga0265342_101607212 248
107 3300035695 Ga0373927_0013220 Ga0373927_0013220_3678_4436 248
108 3300035725 Ga0373947_0024192 Ga0373947_0024192_2134_2892 248
109 3300036401 Ga0373937_0325797 Ga0373937_0325797_653_1411 248
110 3300037068 Ga0373925_0507438 Ga0373925_0507438_71_829 248
111 3300046460 Ga0495638_0103778 Ga0495638_0103778_638_1396 248
112 3300048912 Ga0496109_0290514 Ga0496109_0290514_472_1230 248
113 3300048915 Ga0496112_0000017 Ga0496112_0000017_135078_135836 248
114 3300048918 Ga0496115_0024331 Ga0496115_0024331_3004_3750 248
115 3300048924 Ga0496121_0043531 Ga0496121_0043531_493_1254 248
116 3300053088 Ga0500644_0001293 Ga0500644_0001293_987_1745 248
117 3300053093 Ga0500651_0006213 Ga0500651_0006213_5669_6427 248
118 3300053119 Ga0500595_003301 Ga0500595_003301_1253_2032 248
119 3300053153 Ga0500616_0000002 Ga0500616_0000002_1041249_1042007 248
120 3300053153 Ga0500616_0095147 Ga0500616_0095147_608_1366 248
121 3300053730 Ga0500645_000099 Ga0500645_000099_15859_16617 248
122 3300005330 Ga0070690_100021813 Ga0070690_1000218132 249
123 3300005333 Ga0070677_10172808 Ga0070677_101728081 249
124 3300005333 Ga0070677_10209931 Ga0070677_102099311 249
125 3300005338 Ga0068868_100389111 Ga0068868_1003891112 249
126 3300005339 Ga0070660_100098830 Ga0070660_1000988302 249
127 3300005343 Ga0070687_100092025 Ga0070687_1000920252 249
128 3300005344 Ga0070661_100371460 Ga0070661_1003714602 249
129 3300005347 Ga0070668_100343820 Ga0070668_1003438202 249
130 3300005354 Ga0070675_100728943 Ga0070675_1007289431 249
131 3300005355 Ga0070671_100027961 Ga0070671_1000279613 249
132 3300005356 Ga0070674_100027518 Ga0070674_1000275183 249
133 3300005356 Ga0070674_100086602 Ga0070674_1000866022 249
134 3300005364 Ga0070673_100230069 Ga0070673_1002300691 249
135 3300005365 Ga0070688_100317403 Ga0070688_1003174031 249
136 3300005367 Ga0070667_100280910 Ga0070667_1002809101 249
137 3300005438 Ga0070701_10261592 Ga0070701_102615921 249
138 3300005441 Ga0070700_100062136 Ga0070700_1000621362 249
139 3300005455 Ga0070663_100076740 Ga0070663_1000767402 249
140 3300005456 Ga0070678_100019754 Ga0070678_1000197544 249
141 3300005456 Ga0070678_100164381 Ga0070678_1001643812 249
142 3300005457 Ga0070662_100216435 Ga0070662_1002164352 249
143 3300005459 Ga0068867_100203594 Ga0068867_1002035942 249
144 3300005539 Ga0068853_100309214 Ga0068853_1003092142 249
145 3300005539 Ga0068853_100641073 Ga0068853_1006410731 249
146 3300005547 Ga0070693_100164847 Ga0070693_1001648472 249
147 3300005547 Ga0070693_100275982 Ga0070693_1002759822 249
148 3300005548 Ga0070665_100153300 Ga0070665_1001533002 249
149 3300005548 Ga0070665_100597368 Ga0070665_1005973681 249
150 3300005578 Ga0068854_100175615 Ga0068854_1001756152 249
151 3300005618 Ga0068864_100089179 Ga0068864_1000891792 249
152 3300005719 Ga0068861_100393163 Ga0068861_1003931632 249
153 3300005719 Ga0068861_100472242 Ga0068861_1004722422 249
154 3300005843 Ga0068860_100100065 Ga0068860_1001000652 249
155 3300005844 Ga0068862_100098063 Ga0068862_1000980632 249
156 3300005844 Ga0068862_100268495 Ga0068862_1002684952 249
157 3300005983 Ga0081540_1026858 Ga0081540_10268583 249
158 3300006028 Ga0070717_10663546 Ga0070717_106635461 249
159 3300006038 Ga0075365_10263989 Ga0075365_102639891 249
160 3300006358 Ga0068871_100326895 Ga0068871_1003268952 249
161 3300006881 Ga0068865_100095558 Ga0068865_1000955582 249
162 3300006881 Ga0068865_100467611 Ga0068865_1004676112 249
163 3300009148 Ga0105243_10107981 Ga0105243_101079815 249
164 3300009177 Ga0105248_10090371 Ga0105248_100903714 249
165 3300009177 Ga0105248_10234721 Ga0105248_102347212 249
166 3300009553 Ga0105249_10166479 Ga0105249_101664792 249
167 3300009553 Ga0105249_10218549 Ga0105249_102185492 249
168 3300009553 Ga0105249_10228388 Ga0105249_102283882 249
169 3300010159 Ga0099796_10026830 Ga0099796_100268302 249
170 3300010375 Ga0105239_10569234 Ga0105239_105692342 249
171 3300013296 Ga0157374_10508647 Ga0157374_105086472 249
172 3300013306 Ga0163162_10386812 Ga0163162_103868122 249
173 3300013308 Ga0157375_10103459 Ga0157375_101034593 249
174 3300013308 Ga0157375_10201898 Ga0157375_102018982 249
175 3300014325 Ga0163163_10038493 Ga0163163_100384936 249
176 3300014326 Ga0157380_10327978 Ga0157380_103279782 249
177 3300014968 Ga0157379_10043542 Ga0157379_100435424 249
178 3300014969 Ga0157376_10240321 Ga0157376_102403212 249
179 3300014969 Ga0157376_10391642 Ga0157376_103916422 249
180 3300025893 Ga0207682_10209306 Ga0207682_102093061 249
181 3300025899 Ga0207642_10176595 Ga0207642_101765952 249
182 3300025907 Ga0207645_10116104 Ga0207645_101161042 249
183 3300025918 Ga0207662_10102114 Ga0207662_101021143 249
184 3300025919 Ga0207657_10111110 Ga0207657_101111102 249
185 3300025920 Ga0207649_10330285 Ga0207649_103302852 249
186 3300025931 Ga0207644_10029172 Ga0207644_100291723 249
187 3300025935 Ga0207709_10153042 Ga0207709_101530422 249
188 3300025936 Ga0207670_10053842 Ga0207670_100538422 249
189 3300025938 Ga0207704_10614655 Ga0207704_106146551 249
190 3300025941 Ga0207711_10087104 Ga0207711_100871042 249
191 3300025961 Ga0207712_10021041 Ga0207712_100210414 249
192 3300025972 Ga0207668_10154049 Ga0207668_101540492 249
193 3300026023 Ga0207677_10242156 Ga0207677_102421562 249
194 3300026041 Ga0207639_10207058 Ga0207639_102070582 249
195 3300026067 Ga0207678_10060137 Ga0207678_100601373 249
196 3300026067 Ga0207678_10246715 Ga0207678_102467152 249
197 3300026075 Ga0207708_10028255 Ga0207708_100282553 249
198 3300026075 Ga0207708_10189790 Ga0207708_101897902 249
199 3300026089 Ga0207648_10229800 Ga0207648_102298002 249
200 3300026095 Ga0207676_10108437 Ga0207676_101084372 249
201 3300026121 Ga0207683_10019832 Ga0207683_100198325 249
202 3300026121 Ga0207683_10021694 Ga0207683_100216945 249
203 3300026121 Ga0207683_10124367 Ga0207683_101243672 249
204 3300028379 Ga0268266_10275628 Ga0268266_102756282 249
205 3300028379 Ga0268266_10594340 Ga0268266_105943401 249
206 3300028380 Ga0268265_10063828 Ga0268265_100638282 249
207 3300028380 Ga0268265_10070998 Ga0268265_100709982 249
208 3300028786 Ga0307517_10039620 Ga0307517_100396202 249
209 3300031238 Ga0265332_10005019 Ga0265332_100050192 249
210 3300031238 Ga0265332_10032406 Ga0265332_100324062 249
211 3300031242 Ga0265329_10014396 Ga0265329_100143962 249
212 3300031249 Ga0265339_10005449 Ga0265339_100054496 249
213 3300031250 Ga0265331_10029831 Ga0265331_100298312 249
214 3300031712 Ga0265342_10005254 Ga0265342_100052542 249
215 3300031730 Ga0307516_10126244 Ga0307516_101262442 249
216 3300034817 Ga0373948_0033716 Ga0373948_0033716_214_963 249
217 3300035116 Ga0373945_0036020 Ga0373945_0036020_149_898 249
218 3300035241 Ga0373961_0021624 Ga0373961_0021624_914_1663 249
219 3300035691 Ga0373931_0057519 Ga0373931_0057519_1216_1965 249
220 3300035695 Ga0373927_0173228 Ga0373927_0173228_395_1159 249
221 3300037068 Ga0373925_0090021 Ga0373925_0090021_480_1235 249
222 3300041509 Ga0451843_0872454 Ga0451843_0872454_22_771 249
223 3300045976 Ga0466967_0067366 Ga0466967_0067366_604_1353 249
224 3300046453 Ga0495627_093152 Ga0495627_093152_42_791 249
225 3300046455 Ga0495603_0062923 Ga0495603_0062923_1199_1948 249
226 3300046459 Ga0495629_0257994 Ga0495629_0257994_220_981 249
227 3300046461 Ga0495641_0017426 Ga0495641_0017426_1335_2084 249
228 3300046471 Ga0495650_0060149 Ga0495650_0060149_384_1145 249
229 3300046472 Ga0495580_0047602 Ga0495580_0047602_568_1317 249
230 3300046474 Ga0495605_0026778 Ga0495605_0026778_2230_2979 249
231 3300046475 Ga0495639_0056218 Ga0495639_0056218_217_966 249
232 3300046477 Ga0495664_0082445 Ga0495664_0082445_443_1204 249
233 3300046491 Ga0495584_0017649 Ga0495584_0017649_2551_3300 249
234 3300046491 Ga0495584_0243886 Ga0495584_0243886_140_901 249
235 3300046492 Ga0495585_0113784 Ga0495585_0113784_276_1037 249
236 3300046511 Ga0495608_0147239 Ga0495608_0147239_620_1375 249
237 3300046514 Ga0495618_0277958 Ga0495618_0277958_36_791 249
238 3300046523 Ga0495644_0069798 Ga0495644_0069798_309_1058 249
239 3300046525 Ga0495663_0123259 Ga0495663_0123259_95_844 249
240 3300046535 Ga0495586_0142836 Ga0495586_0142836_461_1222 249
241 3300046537 Ga0495598_0001556 Ga0495598_0001556_3807_4556 249
242 3300046615 Ga0495656_0020279 Ga0495656_0020279_728_1477 249
243 3300046665 Ga0495661_0100548 Ga0495661_0100548_236_985 249
244 3300046684 Ga0495669_0000650 Ga0495669_0000650_2612_3373 249
245 3300046794 Ga0495589_0042333 Ga0495589_0042333_530_1279 249
246 3300046794 Ga0495589_0164450 Ga0495589_0164450_152_913 249
247 3300047315 Ga0495581_0078625 Ga0495581_0078625_598_1359 249
248 3300047315 Ga0495581_0089977 Ga0495581_0089977_94_855 249
249 3300047320 Ga0495672_0060865 Ga0495672_0060865_733_1494 249
250 3300047321 Ga0495676_0094806 Ga0495676_0094806_738_1487 249
251 3300047446 Ga0495679_033846 Ga0495679_033846_596_1345 249
252 3300048903 Ga0496100_0010419 Ga0496100_0010419_3715_4464 249
253 3300048904 Ga0496101_0002062 Ga0496101_0002062_2247_2996 249
254 3300048904 Ga0496101_0311046 Ga0496101_0311046_79_831 249
255 3300048905 Ga0496102_0300737 Ga0496102_0300737_619_1368 249
256 3300048905 Ga0496102_0525027 Ga0496102_0525027_122_883 249
257 3300048906 Ga0496103_0148171 Ga0496103_0148171_78_839 249
258 3300048907 Ga0496104_0001864 Ga0496104_0001864_1627_2379 249
259 3300048908 Ga0496105_0002420 Ga0496105_0002420_10957_11706 249
260 3300048908 Ga0496105_0012967 Ga0496105_0012967_1597_2349 249
261 3300048910 Ga0496107_0003490 Ga0496107_0003490_1850_2599 249
262 3300048910 Ga0496107_0192376 Ga0496107_0192376_319_1080 249
263 3300048911 Ga0496108_0011203 Ga0496108_0011203_6186_6935 249
264 3300048911 Ga0496108_0079232 Ga0496108_0079232_63_812 249
265 3300048912 Ga0496109_0004171 Ga0496109_0004171_9326_10075 249
266 3300048912 Ga0496109_0128912 Ga0496109_0128912_1597_2349 249
267 3300048913 Ga0496110_0087144 Ga0496110_0087144_739_1500 249
268 3300048914 Ga0496111_0019842 Ga0496111_0019842_2535_3284 249
269 3300048915 Ga0496112_0310408 Ga0496112_0310408_259_1008 249
270 3300048915 Ga0496112_0674532 Ga0496112_0674532_180_932 249
271 3300048916 Ga0496113_0105066 Ga0496113_0105066_1432_2181 249
272 3300048917 Ga0496114_0005094 Ga0496114_0005094_9269_10018 249
273 3300048917 Ga0496114_0098347 Ga0496114_0098347_838_1599 249
274 3300048918 Ga0496115_0061373 Ga0496115_0061373_341_1090 249
275 3300048918 Ga0496115_0278933 Ga0496115_0278933_354_1115 249
276 3300048929 Ga0496126_0135596 Ga0496126_0135596_1302_2063 249
277 3300053077 Ga0495601_0021177 Ga0495601_0021177_687_1442 249
278 3300053077 Ga0495601_0042386 Ga0495601_0042386_698_1459 249
279 3300053083 Ga0495655_0006829 Ga0495655_0006829_952_1701 249
280 3300053083 Ga0495655_0028988 Ga0495655_0028988_274_1035 249
281 3300053085 Ga0495619_0033342 Ga0495619_0033342_840_1595 249
282 3300053139 Ga0500568_0046742 Ga0500568_0046742_249_1013 249
283 3300003659 JGI25404J52841_10003853 JGI25404J52841_100038534 250
284 3300003659 JGI25404J52841_10015330 JGI25404J52841_100153303 250
285 3300005331 Ga0070670_100531736 Ga0070670_1005317362 250
286 3300005334 Ga0068869_100277372 Ga0068869_1002773722 250
287 3300005335 Ga0070666_10237672 Ga0070666_102376722 250
288 3300005337 Ga0070682_100280581 Ga0070682_1002805812 250
289 3300005338 Ga0068868_100022399 Ga0068868_1000223991 250
290 3300005338 Ga0068868_100521008 Ga0068868_1005210081 250
291 3300005344 Ga0070661_100267371 Ga0070661_1002673711 250
292 3300005353 Ga0070669_100096099 Ga0070669_1000960992 250
293 3300005365 Ga0070688_100174912 Ga0070688_1001749121 250
294 3300005436 Ga0070713_100743772 Ga0070713_1007437721 250
295 3300005455 Ga0070663_100173931 Ga0070663_1001739312 250
296 3300005456 Ga0070678_100067401 Ga0070678_1000674012 250
297 3300005530 Ga0070679_100608630 Ga0070679_1006086301 250
298 3300005535 Ga0070684_100107553 Ga0070684_1001075533 250
299 3300005536 Ga0070697_100396478 Ga0070697_1003964782 250
300 3300005539 Ga0068853_100156895 Ga0068853_1001568952 250
301 3300005564 Ga0070664_100102739 Ga0070664_1001027392 250
302 3300005616 Ga0068852_100129085 Ga0068852_1001290852 250
303 3300005617 Ga0068859_100163980 Ga0068859_1001639803 250
304 3300005719 Ga0068861_100043820 Ga0068861_1000438203 250
305 3300005719 Ga0068861_100226964 Ga0068861_1002269642 250
306 3300005843 Ga0068860_100081543 Ga0068860_1000815433 250
307 3300005844 Ga0068862_100271003 Ga0068862_1002710032 250
308 3300005937 Ga0081455_10017479 Ga0081455_100174795 250
309 3300005983 Ga0081540_1000007 Ga0081540_100000728 250
310 3300005983 Ga0081540_1000105 Ga0081540_100010514 250
311 3300005983 Ga0081540_1003965 Ga0081540_100396510 250
312 3300006038 Ga0075365_10222696 Ga0075365_102226962 250
313 3300006175 Ga0070712_100055550 Ga0070712_1000555503 250
314 3300006178 Ga0075367_10162074 Ga0075367_101620741 250
315 3300006358 Ga0068871_100610559 Ga0068871_1006105592 250
316 3300006871 Ga0075434_100225504 Ga0075434_1002255042 250
317 3300006931 Ga0097620_100163987 Ga0097620_1001639872 250
318 3300007265 Ga0099794_10066421 Ga0099794_100664212 250
319 3300007265 Ga0099794_10163626 Ga0099794_101636262 250
320 3300009093 Ga0105240_10255829 Ga0105240_102558293 250
321 3300009098 Ga0105245_10063788 Ga0105245_100637882 250
322 3300009098 Ga0105245_10258761 Ga0105245_102587612 250
323 3300009148 Ga0105243_10420351 Ga0105243_104203512 250
324 3300009148 Ga0105243_10442065 Ga0105243_104420652 250
325 3300009174 Ga0105241_10418413 Ga0105241_104184132 250
326 3300009545 Ga0105237_10625038 Ga0105237_106250382 250
327 3300009551 Ga0105238_10232933 Ga0105238_102329332 250
328 3300009551 Ga0105238_10763859 Ga0105238_107638592 250
329 3300010375 Ga0105239_10083385 Ga0105239_100833853 250
330 3300010375 Ga0105239_10338932 Ga0105239_103389322 250
331 3300013104 Ga0157370_10556305 Ga0157370_105563052 250
332 3300013296 Ga0157374_10200703 Ga0157374_102007032 250
333 3300013306 Ga0163162_10659944 Ga0163162_106599442 250
334 3300013306 Ga0163162_11048056 Ga0163162_110480562 250
335 3300013308 Ga0157375_10047518 Ga0157375_100475183 250
336 3300013308 Ga0157375_10156349 Ga0157375_101563492 250
337 3300013308 Ga0157375_11166684 Ga0157375_111666841 250
338 3300014325 Ga0163163_10092019 Ga0163163_100920193 250
339 3300014745 Ga0157377_10044111 Ga0157377_100441112 250
340 3300014969 Ga0157376_10047907 Ga0157376_100479072 250
341 3300014969 Ga0157376_10414288 Ga0157376_104142882 250
342 3300025900 Ga0207710_10197622 Ga0207710_101976222 250
343 3300025901 Ga0207688_10072244 Ga0207688_100722442 250
344 3300025901 Ga0207688_10144546 Ga0207688_101445462 250
345 3300025907 Ga0207645_10339229 Ga0207645_103392292 250
346 3300025914 Ga0207671_10214644 Ga0207671_102146442 250
347 3300025915 Ga0207693_10033602 Ga0207693_100336022 250
348 3300025920 Ga0207649_10418610 Ga0207649_104186102 250
349 3300025921 Ga0207652_10011695 Ga0207652_100116952 250
350 3300025924 Ga0207694_10029408 Ga0207694_100294082 250
351 3300025924 Ga0207694_10422766 Ga0207694_104227661 250
352 3300025925 Ga0207650_10472360 Ga0207650_104723601 250
353 3300025927 Ga0207687_10066178 Ga0207687_100661782 250
354 3300025928 Ga0207700_10576234 Ga0207700_105762341 250
355 3300025936 Ga0207670_10087056 Ga0207670_100870563 250
356 3300025938 Ga0207704_10206741 Ga0207704_102067412 250
357 3300025942 Ga0207689_10088660 Ga0207689_100886602 250
358 3300025942 Ga0207689_10126834 Ga0207689_101268343 250
359 3300025942 Ga0207689_10278928 Ga0207689_102789282 250
360 3300025945 Ga0207679_10176092 Ga0207679_101760922 250
361 3300025949 Ga0207667_10228090 Ga0207667_102280902 250
362 3300025960 Ga0207651_10250583 Ga0207651_102505832 250
363 3300025961 Ga0207712_10189533 Ga0207712_101895332 250
364 3300026023 Ga0207677_10218335 Ga0207677_102183352 250
365 3300026023 Ga0207677_10539596 Ga0207677_105395962 250
366 3300026041 Ga0207639_10101798 Ga0207639_101017982 250
367 3300026067 Ga0207678_10321441 Ga0207678_103214412 250
368 3300026075 Ga0207708_10115077 Ga0207708_101150772 250
369 3300026095 Ga0207676_10218661 Ga0207676_102186612 250
370 3300026116 Ga0207674_10135379 Ga0207674_101353793 250
371 3300026118 Ga0207675_100112829 Ga0207675_1001128292 250
372 3300026118 Ga0207675_100130814 Ga0207675_1001308141 250
373 3300026121 Ga0207683_10040045 Ga0207683_100400452 250
374 3300026142 Ga0207698_10034409 Ga0207698_100344093 250
375 3300027671 Ga0209588_1009865 Ga0209588_10098652 250
376 3300028380 Ga0268265_10516126 Ga0268265_105161261 250
377 3300028381 Ga0268264_10296560 Ga0268264_102965602 250
378 3300031238 Ga0265332_10001513 Ga0265332_1000151310 250
379 3300031242 Ga0265329_10010128 Ga0265329_100101283 250
380 3300031247 Ga0265340_10005971 Ga0265340_100059713 250
381 3300031249 Ga0265339_10004623 Ga0265339_100046232 250
382 3300031250 Ga0265331_10031762 Ga0265331_100317622 250
383 3300031344 Ga0265316_10046003 Ga0265316_100460034 250
384 3300031507 Ga0307509_10135476 Ga0307509_101354763 250
385 3300031616 Ga0307508_10000032 Ga0307508_1000003276 250
386 3300031712 Ga0265342_10002428 Ga0265342_1000242814 250
387 3300033180 Ga0307510_10016157 Ga0307510_100161573 250
388 3300035170 Ga0373943_0008899 Ga0373943_0008899_931_1695 250
389 3300035410 Ga0373924_0017333 Ga0373924_0017333_708_1472 250
390 3300035692 Ga0373935_0027445 Ga0373935_0027445_1944_2708 250
391 3300035692 Ga0373935_0428586 Ga0373935_0428586_34_798 250
392 3300035695 Ga0373927_0002882 Ga0373927_0002882_889_1653 250
393 3300035725 Ga0373947_0025283 Ga0373947_0025283_957_1721 250
394 3300036401 Ga0373937_0007886 Ga0373937_0007886_7577_8329 250
395 3300036401 Ga0373937_0033145 Ga0373937_0033145_2052_2816 250
396 3300037068 Ga0373925_0023291 Ga0373925_0023291_323_1087 250
397 3300037068 Ga0373925_0108321 Ga0373925_0108321_266_1030 250
398 3300041458 Ga0451798_0887340 Ga0451798_0887340_99_863 250
399 3300046455 Ga0495603_0000217 Ga0495603_0000217_26611_27375 250
400 3300046459 Ga0495629_0000862 Ga0495629_0000862_11602_12366 250
401 3300046461 Ga0495641_0003672 Ga0495641_0003672_379_1143 250
402 3300046472 Ga0495580_0005364 Ga0495580_0005364_9695_10459 250
403 3300046473 Ga0495582_0000990 Ga0495582_0000990_15126_15890 250
404 3300046475 Ga0495639_0000544 Ga0495639_0000544_10772_11536 250
405 3300046477 Ga0495664_0001505 Ga0495664_0001505_2341_3105 250
406 3300046477 Ga0495664_0157547 Ga0495664_0157547_32_796 250
407 3300046499 Ga0495594_0000128 Ga0495594_0000128_34967_35731 250
408 3300046514 Ga0495618_0066500 Ga0495618_0066500_932_1696 250
409 3300046515 Ga0495620_0078562 Ga0495620_0078562_208_972 250
410 3300046518 Ga0495631_0205868 Ga0495631_0205868_59_823 250
411 3300046526 Ga0495666_0070401 Ga0495666_0070401_626_1390 250
412 3300046531 Ga0495665_0006186 Ga0495665_0006186_4555_5319 250
413 3300046531 Ga0495665_0211751 Ga0495665_0211751_84_851 250
414 3300046533 Ga0495640_0002595 Ga0495640_0002595_4334_5098 250
415 3300046642 Ga0495634_0001583 Ga0495634_0001583_1908_2672 250
416 3300046663 Ga0495635_0000436 Ga0495635_0000436_5725_6489 250
417 3300046681 Ga0495647_0000394 Ga0495647_0000394_10792_11556 250
418 3300046683 Ga0495658_0003203 Ga0495658_0003203_4741_5505 250
419 3300046689 Ga0495613_0102792 Ga0495613_0102792_628_1392 250
420 3300046690 Ga0495624_0023168 Ga0495624_0023168_156_920 250
421 3300046809 Ga0495600_0125125 Ga0495600_0125125_49_813 250
422 3300047315 Ga0495581_0003127 Ga0495581_0003127_6262_7026 250
423 3300047319 Ga0495674_0008459 Ga0495674_0008459_186_950 250
424 3300047319 Ga0495674_0182507 Ga0495674_0182507_386_1153 250
425 3300047673 Ga0495593_0000439 Ga0495593_0000439_2380_3144 250
426 3300048088 Ga0495602_0097375 Ga0495602_0097375_755_1522 250
427 3300048089 Ga0495614_0072055 Ga0495614_0072055_279_1043 250
428 3300048904 Ga0496101_0148820 Ga0496101_0148820_10_774 250
429 3300048905 Ga0496102_0001771 Ga0496102_0001771_6650_7414 250
430 3300048906 Ga0496103_0153370 Ga0496103_0153370_44_808 250
431 3300048907 Ga0496104_0136187 Ga0496104_0136187_176_940 250
432 3300048907 Ga0496104_0360244 Ga0496104_0360244_311_1075 250
433 3300048908 Ga0496105_0050186 Ga0496105_0050186_657_1421 250
434 3300048909 Ga0496106_0080447 Ga0496106_0080447_1216_1980 250
435 3300048910 Ga0496107_0036192 Ga0496107_0036192_949_1713 250
436 3300048910 Ga0496107_0081293 Ga0496107_0081293_46_810 250
437 3300048911 Ga0496108_0019931 Ga0496108_0019931_4104_4868 250
438 3300048911 Ga0496108_0308332 Ga0496108_0308332_142_906 250
439 3300048912 Ga0496109_0640984 Ga0496109_0640984_169_933 250
440 3300048913 Ga0496110_0055465 Ga0496110_0055465_1400_2164 250
441 3300048913 Ga0496110_0179418 Ga0496110_0179418_928_1692 250
442 3300048915 Ga0496112_0013582 Ga0496112_0013582_5719_6483 250
443 3300048915 Ga0496112_0206504 Ga0496112_0206504_945_1709 250
444 3300048915 Ga0496112_0351790 Ga0496112_0351790_26_790 250
445 3300048916 Ga0496113_0111346 Ga0496113_0111346_258_1022 250
446 3300048918 Ga0496115_0000535 Ga0496115_0000535_27521_28285 250
447 3300048918 Ga0496115_0378115 Ga0496115_0378115_376_1140 250
448 3300048920 Ga0496117_0030138 Ga0496117_0030138_457_1242 250
449 3300048922 Ga0496119_0177624 Ga0496119_0177624_130_915 250
450 3300048924 Ga0496121_0024355 Ga0496121_0024355_724_1509 250
451 3300048924 Ga0496121_0124416 Ga0496121_0124416_316_1080 250
452 3300048927 Ga0496124_0167459 Ga0496124_0167459_915_1679 250
453 3300048929 Ga0496126_0368417 Ga0496126_0368417_175_939 250
454 3300050492 nmdc:mga0yw44_156426_c1 nmdc:mga0yw44_156426_c1_128_892 250
455 3300050494 nmdc:mga06z11_155813_c1 nmdc:mga06z11_155813_c1_46_810 250
456 3300050494 nmdc:mga06z11_222403_c1 nmdc:mga06z11_222403_c1_250_1014 250
457 3300050496 nmdc:mga07m45_38017_c1 nmdc:mga07m45_38017_c1_536_1300 250
458 3300053085 Ga0495619_0175356 Ga0495619_0175356_74_841 250
459 3300053085 Ga0495619_0221361 Ga0495619_0221361_285_1037 250
460 3300053094 Ga0500566_0006011 Ga0500566_0006011_2528_3292 250
461 3300053108 Ga0500562_068420 Ga0500562_068420_67_831 250
462 3300053119 Ga0500595_000537 Ga0500595_000537_376_1140 250
463 3300053162 Ga0500638_047821 Ga0500638_047821_959_1723 250
464 3300053177 Ga0500636_0010368 Ga0500636_0010368_1930_2682 250
465 3300053178 Ga0500637_0000042 Ga0500637_0000042_12479_13243 250
466 3300055283 Ga0500661_000056 Ga0500661_000056_4704_5468 250
467 3300006042 Ga0075368_10031919 Ga0075368_100319193 251
468 3300010159 Ga0099796_10126705 Ga0099796_101267052 251
469 3300025928 Ga0207700_10157416 Ga0207700_101574162 251
470 3300027512 Ga0209179_1015555 Ga0209179_10155552 251
471 3300027866 Ga0209813_10065818 Ga0209813_100658182 251
472 3300048907 Ga0496104_0039870 Ga0496104_0039870_177_935 251
473 3300050490 nmdc:mga03n38_58595_c1 nmdc:mga03n38_58595_c1_387_1148 251
474 3300050495 nmdc:mga04h51_105806_c1 nmdc:mga04h51_105806_c1_165_926 251
475 3300005614 Ga0068856_100003347 Ga0068856_1000033473 252
476 3300005937 Ga0081455_10343491 Ga0081455_103434912 252
477 3300026078 Ga0207702_10000548 Ga0207702_1000054832 252
478 3300006048 Ga0075363_100033900 Ga0075363_1000339003 253
479 3300006178 Ga0075367_10184526 Ga0075367_101845262 253
480 3300006195 Ga0075366_10062746 Ga0075366_100627462 253
481 3300025297 Ga0209758_1000125 Ga0209758_100012570 253
482 3300050494 nmdc:mga06z11_207641_c1 nmdc:mga06z11_207641_c1_14_787 253
483 3300050496 nmdc:mga07m45_137503_c1 nmdc:mga07m45_137503_c1_272_1045 253
484 3300053153 Ga0500616_0046128 Ga0500616_0046128_1360_2121 253
485 3300006846 Ga0075430_100084022 Ga0075430_1000840223 254
486 3300006880 Ga0075429_100472408 Ga0075429_1004724082 254
487 3300035111 Ga0373923_0001173 Ga0373923_0001173_1406_2170 254
488 3300035116 Ga0373945_0001390 Ga0373945_0001390_5799_6563 254
489 3300035117 Ga0373953_0003727 Ga0373953_0003727_1482_2246 254
490 3300035172 Ga0373955_0002349 Ga0373955_0002349_5276_6040 254
491 3300035410 Ga0373924_0002221 Ga0373924_0002221_5719_6483 254
492 3300035692 Ga0373935_0000291 Ga0373935_0000291_5011_5775 254
493 3300035695 Ga0373927_0010828 Ga0373927_0010828_3885_4649 254
494 3300035724 Ga0373933_0191541 Ga0373933_0191541_18_782 254
495 3300035725 Ga0373947_0005730 Ga0373947_0005730_3473_4237 254
496 3300036401 Ga0373937_0000004 Ga0373937_0000004_113762_114526 254
497 3300037068 Ga0373925_0000460 Ga0373925_0000460_3551_4315 254
498 3300046454 Ga0495592_0000029 Ga0495592_0000029_100343_101107 254
499 3300046462 Ga0495651_0001409 Ga0495651_0001409_15644_16408 254
500 3300046463 Ga0495653_0000012 Ga0495653_0000012_251546_252310 254
501 3300046476 Ga0495662_0010406 Ga0495662_0010406_638_1402 254
502 3300046477 Ga0495664_0000004 Ga0495664_0000004_130007_130771 254
503 3300046511 Ga0495608_0000017 Ga0495608_0000017_129994_130758 254
504 3300046514 Ga0495618_0000006 Ga0495618_0000006_89100_89864 254
505 3300046516 Ga0495628_0000001 Ga0495628_0000001_129996_130760 254
506 3300046529 Ga0495652_0000002 Ga0495652_0000002_344530_345294 254
507 3300046533 Ga0495640_0000001 Ga0495640_0000001_438534_439298 254
508 3300046536 Ga0495587_0000008 Ga0495587_0000008_130214_130978 254
509 3300046543 Ga0495645_0000002 Ga0495645_0000002_130009_130773 254
510 3300046559 Ga0495667_0000029 Ga0495667_0000029_130005_130769 254
511 3300046663 Ga0495635_0000002 Ga0495635_0000002_356164_356928 254
512 3300046675 Ga0495657_0000459 Ga0495657_0000459_14520_15284 254
513 3300046678 Ga0495599_0000104 Ga0495599_0000104_51722_52486 254
514 3300046679 Ga0495623_0000691 Ga0495623_0000691_13924_14688 254
515 3300046680 Ga0495646_0000064 Ga0495646_0000064_30489_31253 254
516 3300046689 Ga0495613_0027954 Ga0495613_0027954_607_1371 254
517 3300046809 Ga0495600_0000010 Ga0495600_0000010_135245_136009 254
518 3300047317 Ga0495604_0000009 Ga0495604_0000009_195532_196296 254
519 3300047319 Ga0495674_0000002 Ga0495674_0000002_129997_130761 254
520 3300047322 Ga0495680_0000752 Ga0495680_0000752_21469_22233 254
521 3300047444 Ga0495675_0000517 Ga0495675_0000517_1290_2054 254
522 3300047471 Ga0495684_0000006 Ga0495684_0000006_129956_130720 254
523 3300047673 Ga0495593_0015688 Ga0495593_0015688_639_1403 254
524 3300048088 Ga0495602_0000005 Ga0495602_0000005_214913_215677 254
525 3300050491 nmdc:mga00v17_69404_c1 nmdc:mga00v17_69404_c1_195_959 254
526 3300050508 nmdc:mga09592_154205_c1 nmdc:mga09592_154205_c1_198_962 254
527 3300050509 nmdc:mga0qj67_95982_c1 nmdc:mga0qj67_95982_c1_335_1099 254
528 3300050510 nmdc:mga06r32_169452_c1 nmdc:mga06r32_169452_c1_151_915 254
529 3300053077 Ga0495601_0000002 Ga0495601_0000002_180701_181465 254
530 3300053078 Ga0495612_0000010 Ga0495612_0000010_116589_117353 254
531 3300053084 Ga0495595_0000777 Ga0495595_0000777_7745_8509 254
532 3300053085 Ga0495619_0000019 Ga0495619_0000019_140037_140801 254
533 3300005445 Ga0070708_100560360 Ga0070708_1005603602 255
534 3300005471 Ga0070698_100115178 Ga0070698_1001151782 255
535 3300005937 Ga0081455_10040027 Ga0081455_100400272 255
536 3300046491 Ga0495584_0062283 Ga0495584_0062283_468_1235 255
537 3300006847 Ga0075431_100183347 Ga0075431_1001833472 256
538 3300001977 JGI24746J21847_1003828 JGI24746J21847_10038282 257
539 3300001990 JGI24737J22298_10020484 JGI24737J22298_100204843 257
540 3300002074 JGI24748J21848_1000524 JGI24748J21848_10005243 257
541 3300002075 JGI24738J21930_10017382 JGI24738J21930_100173822 257
542 3300002077 JGI24744J21845_10004801 JGI24744J21845_100048014 257
543 3300005331 Ga0070670_100201244 Ga0070670_1002012442 257
544 3300005335 Ga0070666_10071962 Ga0070666_100719622 257
545 3300005337 Ga0070682_100122410 Ga0070682_1001224102 257
546 3300005339 Ga0070660_100112646 Ga0070660_1001126462 257
547 3300005340 Ga0070689_100001662 Ga0070689_1000016626 257
548 3300005341 Ga0070691_10011614 Ga0070691_100116141 257
549 3300005343 Ga0070687_100029272 Ga0070687_1000292724 257
550 3300005344 Ga0070661_100036904 Ga0070661_1000369043 257
551 3300005345 Ga0070692_10027176 Ga0070692_100271762 257
552 3300005347 Ga0070668_100038142 Ga0070668_1000381423 257
553 3300005353 Ga0070669_100069685 Ga0070669_1000696852 257
554 3300005354 Ga0070675_100047606 Ga0070675_1000476063 257
555 3300005355 Ga0070671_100019919 Ga0070671_1000199194 257
556 3300005365 Ga0070688_100065983 Ga0070688_1000659832 257
557 3300005366 Ga0070659_100058345 Ga0070659_1000583452 257
558 3300005367 Ga0070667_100015429 Ga0070667_1000154294 257
559 3300005367 Ga0070667_100162617 Ga0070667_1001626173 257
560 3300005436 Ga0070713_100391914 Ga0070713_1003919142 257
561 3300005438 Ga0070701_10006562 Ga0070701_100065625 257
562 3300005440 Ga0070705_100094405 Ga0070705_1000944052 257
563 3300005455 Ga0070663_100123633 Ga0070663_1001236333 257
564 3300005457 Ga0070662_100148845 Ga0070662_1001488453 257
565 3300005459 Ga0068867_100058761 Ga0068867_1000587614 257
566 3300005466 Ga0070685_10072406 Ga0070685_100724063 257
567 3300005535 Ga0070684_100035117 Ga0070684_1000351172 257
568 3300005543 Ga0070672_100003299 Ga0070672_1000032994 257
569 3300005546 Ga0070696_100146186 Ga0070696_1001461862 257
570 3300005547 Ga0070693_100111908 Ga0070693_1001119082 257
571 3300005548 Ga0070665_100041916 Ga0070665_1000419162 257
572 3300005564 Ga0070664_100036292 Ga0070664_1000362925 257
573 3300005577 Ga0068857_100500721 Ga0068857_1005007212 257
574 3300005578 Ga0068854_100061089 Ga0068854_1000610892 257
575 3300005614 Ga0068856_100312836 Ga0068856_1003128362 257
576 3300005614 Ga0068856_100379643 Ga0068856_1003796432 257
577 3300005616 Ga0068852_100046625 Ga0068852_1000466251 257
578 3300005617 Ga0068859_100021148 Ga0068859_1000211486 257
579 3300005618 Ga0068864_100006339 Ga0068864_1000063395 257
580 3300005618 Ga0068864_100423324 Ga0068864_1004233242 257
581 3300005718 Ga0068866_10004065 Ga0068866_100040652 257
582 3300005719 Ga0068861_100190918 Ga0068861_1001909183 257
583 3300005840 Ga0068870_10116407 Ga0068870_101164071 257
584 3300005841 Ga0068863_100005456 Ga0068863_10000545614 257
585 3300005843 Ga0068860_100008760 Ga0068860_1000087604 257
586 3300005844 Ga0068862_100061588 Ga0068862_1000615883 257
587 3300006028 Ga0070717_10064461 Ga0070717_100644614 257
588 3300006042 Ga0075368_10078818 Ga0075368_100788182 257
589 3300006048 Ga0075363_100234600 Ga0075363_1002346001 257
590 3300006173 Ga0070716_100170099 Ga0070716_1001700992 257
591 3300006175 Ga0070712_100080564 Ga0070712_1000805642 257
592 3300006177 Ga0075362_10040333 Ga0075362_100403332 257
593 3300006178 Ga0075367_10068817 Ga0075367_100688172 257
594 3300006237 Ga0097621_100008674 Ga0097621_1000086745 257
595 3300006353 Ga0075370_10148644 Ga0075370_101486442 257
596 3300006358 Ga0068871_100026031 Ga0068871_1000260313 257
597 3300006844 Ga0075428_100027523 Ga0075428_1000275235 257
598 3300006871 Ga0075434_100012519 Ga0075434_1000125196 257
599 3300006931 Ga0097620_100021146 Ga0097620_1000211462 257
600 3300009094 Ga0111539_10076949 Ga0111539_100769494 257
601 3300009094 Ga0111539_10293057 Ga0111539_102930573 257
602 3300009098 Ga0105245_10027586 Ga0105245_100275863 257
603 3300009101 Ga0105247_10012572 Ga0105247_100125722 257
604 3300009147 Ga0114129_10050640 Ga0114129_100506405 257
605 3300009148 Ga0105243_10020756 Ga0105243_100207565 257
606 3300009174 Ga0105241_10093808 Ga0105241_100938082 257
607 3300009176 Ga0105242_10085438 Ga0105242_100854383 257
608 3300009177 Ga0105248_10095524 Ga0105248_100955242 257
609 3300009545 Ga0105237_10134764 Ga0105237_101347642 257
610 3300011119 Ga0105246_10015760 Ga0105246_100157603 257
611 3300013296 Ga0157374_10003239 Ga0157374_100032398 257
612 3300013297 Ga0157378_10066261 Ga0157378_100662612 257
613 3300013306 Ga0163162_10212560 Ga0163162_102125602 257
614 3300014325 Ga0163163_10014945 Ga0163163_100149455 257
615 3300014325 Ga0163163_10015790 Ga0163163_100157904 257
616 3300014969 Ga0157376_10025997 Ga0157376_100259975 257
617 3300025899 Ga0207642_10003991 Ga0207642_100039914 257
618 3300025900 Ga0207710_10005716 Ga0207710_100057164 257
619 3300025901 Ga0207688_10004677 Ga0207688_100046776 257
620 3300025903 Ga0207680_10217828 Ga0207680_102178281 257
621 3300025907 Ga0207645_10007388 Ga0207645_100073882 257
622 3300025908 Ga0207643_10000794 Ga0207643_1000079417 257
623 3300025911 Ga0207654_10115797 Ga0207654_101157971 257
624 3300025914 Ga0207671_10117360 Ga0207671_101173602 257
625 3300025916 Ga0207663_10037576 Ga0207663_100375763 257
626 3300025918 Ga0207662_10000424 Ga0207662_1000042417 257
627 3300025919 Ga0207657_10093633 Ga0207657_100936334 257
628 3300025920 Ga0207649_10016093 Ga0207649_100160934 257
629 3300025921 Ga0207652_10319609 Ga0207652_103196092 257
630 3300025923 Ga0207681_10113290 Ga0207681_101132902 257
631 3300025925 Ga0207650_10019548 Ga0207650_100195484 257
632 3300025926 Ga0207659_10024969 Ga0207659_100249691 257
633 3300025927 Ga0207687_10020983 Ga0207687_100209833 257
634 3300025931 Ga0207644_10015484 Ga0207644_100154845 257
635 3300025933 Ga0207706_10018822 Ga0207706_100188224 257
636 3300025934 Ga0207686_10167007 Ga0207686_101670071 257
637 3300025935 Ga0207709_10017967 Ga0207709_100179672 257
638 3300025938 Ga0207704_10071538 Ga0207704_100715383 257
639 3300025940 Ga0207691_10002691 Ga0207691_1000269111 257
640 3300025941 Ga0207711_10022868 Ga0207711_100228685 257
641 3300025944 Ga0207661_10014563 Ga0207661_100145636 257
642 3300025945 Ga0207679_10028966 Ga0207679_100289662 257
643 3300025961 Ga0207712_10231411 Ga0207712_102314112 257
644 3300025981 Ga0207640_10234715 Ga0207640_102347152 257
645 3300026023 Ga0207677_10011070 Ga0207677_100110704 257
646 3300026035 Ga0207703_10517122 Ga0207703_105171222 257
647 3300026041 Ga0207639_10054996 Ga0207639_100549964 257
648 3300026067 Ga0207678_10003923 Ga0207678_1000392315 257
649 3300026075 Ga0207708_10000784 Ga0207708_100007845 257
650 3300026078 Ga0207702_10033740 Ga0207702_100337403 257
651 3300026078 Ga0207702_10251491 Ga0207702_102514912 257
652 3300026088 Ga0207641_10006530 Ga0207641_100065307 257
653 3300026089 Ga0207648_10002310 Ga0207648_1000231021 257
654 3300026095 Ga0207676_10002295 Ga0207676_100022956 257
655 3300026118 Ga0207675_100002371 Ga0207675_10000237110 257
656 3300026142 Ga0207698_10457529 Ga0207698_104575291 257
657 3300028379 Ga0268266_10165814 Ga0268266_101658143 257
658 3300028380 Ga0268265_10013453 Ga0268265_100134532 257
659 3300028381 Ga0268264_10042233 Ga0268264_100422334 257
660 3300035171 Ga0373946_0012725 Ga0373946_0012725_736_1509 257
661 3300035695 Ga0373927_0025259 Ga0373927_0025259_1901_2674 257
662 3300035695 Ga0373927_0330621 Ga0373927_0330621_16_792 257
663 3300035725 Ga0373947_0010154 Ga0373947_0010154_3408_4181 257
664 3300037068 Ga0373925_0012254 Ga0373925_0012254_2476_3249 257
665 3300037068 Ga0373925_0096835 Ga0373925_0096835_187_963 257
666 3300046473 Ga0495582_0025773 Ga0495582_0025773_1720_2493 257
667 3300046474 Ga0495605_0176373 Ga0495605_0176373_17_790 257
668 3300046513 Ga0495616_0049664 Ga0495616_0049664_631_1404 257
669 3300046517 Ga0495630_0120545 Ga0495630_0120545_167_940 257
670 3300046533 Ga0495640_0119257 Ga0495640_0119257_547_1323 257
671 3300046557 Ga0495622_0037475 Ga0495622_0037475_1031_1804 257
672 3300046616 Ga0495668_0055390 Ga0495668_0055390_983_1756 257
673 3300046683 Ga0495658_0080898 Ga0495658_0080898_296_1069 257
674 3300046684 Ga0495669_0041655 Ga0495669_0041655_250_1023 257
675 3300046794 Ga0495589_0035287 Ga0495589_0035287_671_1444 257
676 3300047321 Ga0495676_0056443 Ga0495676_0056443_1206_1979 257
677 3300048903 Ga0496100_0008677 Ga0496100_0008677_3066_3839 257
678 3300048904 Ga0496101_0040893 Ga0496101_0040893_1247_2020 257
679 3300048905 Ga0496102_0009880 Ga0496102_0009880_2016_2792 257
680 3300048905 Ga0496102_0017733 Ga0496102_0017733_1940_2713 257
681 3300048906 Ga0496103_0005658 Ga0496103_0005658_622_1395 257
682 3300048906 Ga0496103_0017084 Ga0496103_0017084_1912_2688 257
683 3300048907 Ga0496104_0009785 Ga0496104_0009785_4901_5677 257
684 3300048907 Ga0496104_0013405 Ga0496104_0013405_996_1769 257
685 3300048908 Ga0496105_0001436 Ga0496105_0001436_10054_10827 257
686 3300048908 Ga0496105_0006858 Ga0496105_0006858_7667_8443 257
687 3300048909 Ga0496106_0020513 Ga0496106_0020513_733_1509 257
688 3300048909 Ga0496106_0026257 Ga0496106_0026257_868_1641 257
689 3300048909 Ga0496106_0175635 Ga0496106_0175635_108_881 257
690 3300048910 Ga0496107_0012097 Ga0496107_0012097_3431_4204 257
691 3300048911 Ga0496108_0000386 Ga0496108_0000386_1754_2530 257
692 3300048911 Ga0496108_0002833 Ga0496108_0002833_2919_3692 257
693 3300048912 Ga0496109_0001313 Ga0496109_0001313_2364_3140 257
694 3300048912 Ga0496109_0016420 Ga0496109_0016420_1815_2588 257
695 3300048913 Ga0496110_0068174 Ga0496110_0068174_1897_2673 257
696 3300048913 Ga0496110_0102662 Ga0496110_0102662_742_1515 257
697 3300048914 Ga0496111_0000388 Ga0496111_0000388_9057_9833 257
698 3300048914 Ga0496111_0012071 Ga0496111_0012071_4201_4974 257
699 3300048915 Ga0496112_0000426 Ga0496112_0000426_25426_26202 257
700 3300048915 Ga0496112_0201840 Ga0496112_0201840_868_1641 257
701 3300048916 Ga0496113_0000395 Ga0496113_0000395_19300_20076 257
702 3300048916 Ga0496113_0039315 Ga0496113_0039315_1554_2327 257
703 3300048917 Ga0496114_0028261 Ga0496114_0028261_2749_3522 257
704 3300048917 Ga0496114_0155661 Ga0496114_0155661_134_907 257
705 3300048918 Ga0496115_0009860 Ga0496115_0009860_6149_6925 257
706 3300048918 Ga0496115_0030874 Ga0496115_0030874_307_1080 257
707 3300050490 nmdc:mga03n38_28157_c1 nmdc:mga03n38_28157_c1_249_1022 257
708 3300050492 nmdc:mga0yw44_10144_c1 nmdc:mga0yw44_10144_c1_1581_2354 257
709 3300050494 nmdc:mga06z11_5286_c1 nmdc:mga06z11_5286_c1_2793_3566 257
710 3300050507 nmdc:mga05p37_6242_c1 nmdc:mga05p37_6242_c1_4893_5669 257
711 3300050510 nmdc:mga06r32_127007_c1 nmdc:mga06r32_127007_c1_1441_2217 257
712 3300050512 nmdc:mga0n895_56218_c1 nmdc:mga0n895_56218_c1_2363_3139 257
713 3300050513 nmdc:mga0rr50_236733_c1 nmdc:mga0rr50_236733_c1_415_1191 257
714 3300053083 Ga0495655_0036411 Ga0495655_0036411_380_1153 257
715 3300053085 Ga0495619_0020844 Ga0495619_0020844_364_1140 257
716 3300053087 Ga0500643_008988 Ga0500643_008988_1402_2184 257
717 3300053094 Ga0500566_0031929 Ga0500566_0031929_11_793 257
718 3300053119 Ga0500595_000002 Ga0500595_000002_936876_937658 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

42

264

0.92

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

47

256

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8953 31 257
4xxu-assembly1.cif.gz_B moda - chromate bound 0.8901 31 257
7tav-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8796 31 256
7tav-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8787 31 257
3axf-assembly3.cif.gz_C perrhenate binding to a11c/r153c moda mutant 0.8772 31 257
ID Description Score Start End Superfamily
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9067 31 257 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9 33 257 3.40.190.10
4rxlA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8994 33 108 3.40.190.10
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8857 31 257 3.40.190.10
2h5yB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 30 257 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4V1R146-F1-model_v4 deleted 0.9659 81 257
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9639 63 257 GO:0015689
GO:0030973
AF-A0A4V1R146-F1-model_v4 deleted 0.9606 81 257
AF-A0A520GGA9-F1-model_v4 ABC transporter substrate-binding protein 0.9591 63 257 GO:0015689
GO:0030973
AF-A0A127EYM7-F1-model_v4 Molybdate ABC transporter periplasmic-binding protein 0.959 31 257 GO:0015689
GO:0030973

Feature Viewer

pLDDT pTM Quality
89.93 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map