F477065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 716 | 249 | 716 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0196111|Ga0373937_0196111_699_1466 |
| Length | 255 |
| Sequence | MIVPCIDLMDGKVVQLVQGREKALEGDSPDEMLRKFAAFPEIQVIDLDAALGRGSNDDLVRLIASKAVCRVGGGVRTADRARELLAQGAHRVIVGTSAFTRTGINKDLLSALRDAVGRERLTIALDSKGGRIVVKGWQEDTNFTAEEVLGSLEPYCAGFLCTYVDKEGMMQGTDLDWFRRLRAATSLEITAAGGITTLEDVKALLAMNIDAAVGMAIYTGRLRLEDLAAVRQASRPVSSDLGGRPEHRNRFDLDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 83 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 139 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 140 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 146 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 147 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 148 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 149 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 152 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 156 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 158 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 168 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 171 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 172 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 173 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 179 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 180 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 215 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 248 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 0.7 |
| Rhizosphere | 92.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10001950 | 3300005327 | Bacteria | 17350 |
| 2 | Ga0070658_10009861 | 3300005327 | Bacteria | 7674 |
| 3 | Ga0070658_10129626 | 3300005327 | Bacteria | 2101 |
| 4 | Ga0070676_10168310 | 3300005328 | Bacteria | 1415 |
| 5 | Ga0070683_100000019 | 3300005329 | Bacteria | 192076 |
| 6 | Ga0070683_100005237 | 3300005329 | Bacteria | 10794 |
| 7 | Ga0070683_100058234 | 3300005329 | Bacteria | 3590 |
| 8 | Ga0070683_100131383 | 3300005329 | Bacteria | 2369 |
| 9 | Ga0070683_100146187 | 3300005329 | Bacteria | 2240 |
| 10 | Ga0070683_100408800 | 3300005329 | Unclassified | 1294 |
| 11 | Ga0070683_100780711 | 3300005329 | Bacteria | 915 |
| 12 | Ga0070690_100309505 | 3300005330 | Bacteria | 1135 |
| 13 | Ga0070670_100685279 | 3300005331 | Bacteria | 921 |
| 14 | Ga0068869_100185178 | 3300005334 | Bacteria | 1634 |
| 15 | Ga0070666_10115154 | 3300005335 | Unclassified | 1862 |
| 16 | Ga0070680_100025498 | 3300005336 | Bacteria | 4726 |
| 17 | Ga0070680_100038958 | 3300005336 | Bacteria | 3845 |
| 18 | Ga0070680_100106992 | 3300005336 | Bacteria | 2326 |
| 19 | Ga0070680_100224222 | 3300005336 | Bacteria | 1587 |
| 20 | Ga0070682_100054565 | 3300005337 | Bacteria | 2508 |
| 21 | Ga0068868_100011009 | 3300005338 | Bacteria | 6572 |
| 22 | Ga0068868_100044941 | 3300005338 | Bacteria | 3454 |
| 23 | Ga0068868_100277237 | 3300005338 | Bacteria | 1418 |
| 24 | Ga0070660_100007244 | 3300005339 | Bacteria | 7720 |
| 25 | Ga0070660_100171655 | 3300005339 | Bacteria | 1752 |
| 26 | Ga0070660_100205510 | 3300005339 | Bacteria | 1598 |
| 27 | Ga0070660_100260748 | 3300005339 | Bacteria | 1415 |
| 28 | Ga0070689_100252999 | 3300005340 | Bacteria | 1454 |
| 29 | Ga0070689_100436456 | 3300005340 | Bacteria | 1112 |
| 30 | Ga0070661_100052822 | 3300005344 | Bacteria | 2974 |
| 31 | Ga0070661_100070988 | 3300005344 | Bacteria | 2562 |
| 32 | Ga0070692_10092230 | 3300005345 | Bacteria | 1648 |
| 33 | Ga0070668_100618225 | 3300005347 | Bacteria | 949 |
| 34 | Ga0070671_100827823 | 3300005355 | Unclassified | 807 |
| 35 | Ga0070674_100281639 | 3300005356 | Bacteria | 1318 |
| 36 | Ga0070674_100627889 | 3300005356 | Bacteria | 911 |
| 37 | Ga0070673_100318278 | 3300005364 | Bacteria | 1374 |
| 38 | Ga0070673_100336184 | 3300005364 | Bacteria | 1337 |
| 39 | Ga0070659_100068616 | 3300005366 | Bacteria | 2813 |
| 40 | Ga0070667_100013784 | 3300005367 | Bacteria | 6683 |
| 41 | Ga0070667_100159141 | 3300005367 | Bacteria | 1988 |
| 42 | Ga0070709_10013766 | 3300005434 | Bacteria | 4557 |
| 43 | Ga0070709_10031530 | 3300005434 | Bacteria | 3189 |
| 44 | Ga0070714_100035658 | 3300005435 | Bacteria | 4169 |
| 45 | Ga0070714_100170607 | 3300005435 | Bacteria | 1974 |
| 46 | Ga0070714_100218646 | 3300005435 | Bacteria | 1750 |
| 47 | Ga0070713_100011179 | 3300005436 | Bacteria | 6527 |
| 48 | Ga0070713_100015164 | 3300005436 | Bacteria | 5747 |
| 49 | Ga0070713_100048723 | 3300005436 | Bacteria | 3491 |
| 50 | Ga0070713_100157774 | 3300005436 | Bacteria | 2023 |
| 51 | Ga0070711_100166546 | 3300005439 | Bacteria | 1676 |
| 52 | Ga0070711_100275967 | 3300005439 | Bacteria | 1328 |
| 53 | Ga0070711_100818460 | 3300005439 | Unclassified | 791 |
| 54 | Ga0070708_100037457 | 3300005445 | Bacteria | 4231 |
| 55 | Ga0070708_100558281 | 3300005445 | Unclassified | 1080 |
| 56 | Ga0070663_100043729 | 3300005455 | Bacteria | 3154 |
| 57 | Ga0070663_100728272 | 3300005455 | Bacteria | 845 |
| 58 | Ga0070678_100029205 | 3300005456 | Bacteria | 3773 |
| 59 | Ga0070681_10022213 | 3300005458 | Bacteria | 6368 |
| 60 | Ga0070681_10039248 | 3300005458 | Bacteria | 4747 |
| 61 | Ga0070681_10278669 | 3300005458 | Bacteria | 1583 |
| 62 | Ga0068867_100157651 | 3300005459 | Bacteria | 1788 |
| 63 | Ga0068867_100208333 | 3300005459 | Bacteria | 1569 |
| 64 | Ga0068867_100480300 | 3300005459 | Bacteria | 1065 |
| 65 | Ga0070707_100434279 | 3300005468 | Bacteria | 1273 |
| 66 | Ga0070699_100069549 | 3300005518 | Bacteria | 3059 |
| 67 | Ga0070699_100170336 | 3300005518 | Unclassified | 1929 |
| 68 | Ga0070699_100709012 | 3300005518 | Bacteria | 919 |
| 69 | Ga0070679_100000635 | 3300005530 | Bacteria | 29869 |
| 70 | Ga0070679_100029497 | 3300005530 | Bacteria | 5413 |
| 71 | Ga0070679_100512726 | 3300005530 | Unclassified | 1143 |
| 72 | Ga0070684_100000003 | 3300005535 | Bacteria | 248527 |
| 73 | Ga0070684_100000654 | 3300005535 | Bacteria | 23885 |
| 74 | Ga0070684_100095009 | 3300005535 | Bacteria | 2656 |
| 75 | Ga0070684_100127399 | 3300005535 | Bacteria | 2294 |
| 76 | Ga0070684_100551658 | 3300005535 | Bacteria | 1069 |
| 77 | Ga0068853_100018364 | 3300005539 | Bacteria | 5788 |
| 78 | Ga0068853_100111936 | 3300005539 | Bacteria | 2426 |
| 79 | Ga0070672_100154173 | 3300005543 | Bacteria | 1902 |
| 80 | Ga0070672_100471496 | 3300005543 | Bacteria | 1083 |
| 81 | Ga0070686_100372070 | 3300005544 | Bacteria | 1079 |
| 82 | Ga0070665_100021507 | 3300005548 | Bacteria | 6485 |
| 83 | Ga0070665_100078224 | 3300005548 | Bacteria | 3314 |
| 84 | Ga0068855_100003676 | 3300005563 | Bacteria | 18764 |
| 85 | Ga0068855_100005921 | 3300005563 | Bacteria | 14906 |
| 86 | Ga0068855_100017587 | 3300005563 | Bacteria | 8598 |
| 87 | Ga0068855_100041567 | 3300005563 | Bacteria | 5448 |
| 88 | Ga0068855_100092641 | 3300005563 | Bacteria | 3485 |
| 89 | Ga0068855_100122286 | 3300005563 | Bacteria | 2979 |
| 90 | Ga0068855_100133575 | 3300005563 | Bacteria | 2832 |
| 91 | Ga0068855_100232828 | 3300005563 | Bacteria | 2061 |
| 92 | Ga0068855_100235759 | 3300005563 | Bacteria | 2046 |
| 93 | Ga0068855_100258952 | 3300005563 | Bacteria | 1939 |
| 94 | Ga0068855_100482082 | 3300005563 | Bacteria | 1350 |
| 95 | Ga0070664_100099430 | 3300005564 | Bacteria | 2528 |
| 96 | Ga0070664_100251199 | 3300005564 | Bacteria | 1590 |
| 97 | Ga0068857_100000367 | 3300005577 | Bacteria | 31519 |
| 98 | Ga0068857_100009431 | 3300005577 | Bacteria | 8471 |
| 99 | Ga0068857_100026136 | 3300005577 | Bacteria | 5142 |
| 100 | Ga0068857_100190026 | 3300005577 | Bacteria | 1870 |
| 101 | Ga0068857_100713242 | 3300005577 | Bacteria | 954 |
| 102 | Ga0068856_100017001 | 3300005614 | Bacteria | 7049 |
| 103 | Ga0068856_100039198 | 3300005614 | Bacteria | 4651 |
| 104 | Ga0068856_100044788 | 3300005614 | Bacteria | 4355 |
| 105 | Ga0068856_100202529 | 3300005614 | Bacteria | 1999 |
| 106 | Ga0068856_100296679 | 3300005614 | Bacteria | 1633 |
| 107 | Ga0068856_100453965 | 3300005614 | Unclassified | 1303 |
| 108 | Ga0068852_100044205 | 3300005616 | Bacteria | 3781 |
| 109 | Ga0068852_100064073 | 3300005616 | Bacteria | 3203 |
| 110 | Ga0068852_100365620 | 3300005616 | Bacteria | 1412 |
| 111 | Ga0068852_100366049 | 3300005616 | Bacteria | 1411 |
| 112 | Ga0068859_100111544 | 3300005617 | Bacteria | 2798 |
| 113 | Ga0068859_100502784 | 3300005617 | Bacteria | 1307 |
| 114 | Ga0068859_100811833 | 3300005617 | Unclassified | 1023 |
| 115 | Ga0068859_100942521 | 3300005617 | Bacteria | 947 |
| 116 | Ga0068864_100185073 | 3300005618 | Bacteria | 1906 |
| 117 | Ga0068864_100215952 | 3300005618 | Bacteria | 1768 |
| 118 | Ga0068864_100238417 | 3300005618 | Bacteria | 1685 |
| 119 | Ga0068861_100573094 | 3300005719 | Unclassified | 1032 |
| 120 | Ga0068870_10125067 | 3300005840 | Bacteria | 1486 |
| 121 | Ga0068863_100032126 | 3300005841 | Bacteria | 5005 |
| 122 | Ga0068863_100208467 | 3300005841 | Bacteria | 1881 |
| 123 | Ga0068858_100200992 | 3300005842 | Unclassified | 1884 |
| 124 | Ga0068858_100233987 | 3300005842 | Bacteria | 1742 |
| 125 | Ga0068860_100008416 | 3300005843 | Bacteria | 10275 |
| 126 | Ga0068860_100142529 | 3300005843 | Bacteria | 2304 |
| 127 | Ga0068860_100260682 | 3300005843 | Bacteria | 1690 |
| 128 | Ga0068860_100563834 | 3300005843 | Bacteria | 1142 |
| 129 | Ga0070717_10013526 | 3300006028 | Bacteria | 6258 |
| 130 | Ga0070717_10080521 | 3300006028 | Bacteria | 2733 |
| 131 | Ga0070717_10132371 | 3300006028 | Bacteria | 2146 |
| 132 | Ga0070712_100151740 | 3300006175 | Bacteria | 1780 |
| 133 | Ga0097621_100014202 | 3300006237 | Bacteria | 5955 |
| 134 | Ga0097621_100018452 | 3300006237 | Bacteria | 5329 |
| 135 | Ga0097621_100090916 | 3300006237 | Bacteria | 2555 |
| 136 | Ga0097621_100110583 | 3300006237 | Bacteria | 2321 |
| 137 | Ga0097621_100122757 | 3300006237 | Unclassified | 2205 |
| 138 | Ga0097621_100307010 | 3300006237 | Unclassified | 1403 |
| 139 | Ga0097621_100508370 | 3300006237 | Bacteria | 1092 |
| 140 | Ga0097621_100884963 | 3300006237 | Bacteria | 831 |
| 141 | Ga0068871_100013047 | 3300006358 | Bacteria | 6159 |
| 142 | Ga0068871_100081163 | 3300006358 | Bacteria | 2686 |
| 143 | Ga0068871_100102752 | 3300006358 | Bacteria | 2396 |
| 144 | Ga0068871_100359031 | 3300006358 | Bacteria | 1290 |
| 145 | Ga0068871_100852967 | 3300006358 | Bacteria | 842 |
| 146 | Ga0075430_100004116 | 3300006846 | Bacteria | 12273 |
| 147 | Ga0075430_100549595 | 3300006846 | Bacteria | 952 |
| 148 | Ga0075433_10265231 | 3300006852 | Unclassified | 1522 |
| 149 | Ga0068865_100144276 | 3300006881 | Bacteria | 1799 |
| 150 | Ga0068865_100222387 | 3300006881 | Bacteria | 1477 |
| 151 | Ga0068865_100274378 | 3300006881 | Bacteria | 1340 |
| 152 | Ga0068865_100691181 | 3300006881 | Bacteria | 871 |
| 153 | Ga0097620_100111550 | 3300006931 | Bacteria | 2798 |
| 154 | Ga0097620_100502784 | 3300006931 | Bacteria | 1307 |
| 155 | Ga0097620_100811800 | 3300006931 | Unclassified | 1023 |
| 156 | Ga0097620_100942620 | 3300006931 | Bacteria | 947 |
| 157 | Ga0105240_10000137 | 3300009093 | Bacteria | 149925 |
| 158 | Ga0105240_10000725 | 3300009093 | Bacteria | 60249 |
| 159 | Ga0105240_10001720 | 3300009093 | Bacteria | 36943 |
| 160 | Ga0105240_10006267 | 3300009093 | Bacteria | 17501 |
| 161 | Ga0105240_10008603 | 3300009093 | Bacteria | 14585 |
| 162 | Ga0105240_10014192 | 3300009093 | Bacteria | 10881 |
| 163 | Ga0105240_10024993 | 3300009093 | Bacteria | 7861 |
| 164 | Ga0105240_10079917 | 3300009093 | Bacteria | 4023 |
| 165 | Ga0105240_10089673 | 3300009093 | Bacteria | 3761 |
| 166 | Ga0105240_10177114 | 3300009093 | Bacteria | 2520 |
| 167 | Ga0105240_10248872 | 3300009093 | Bacteria | 2057 |
| 168 | Ga0105240_10313188 | 3300009093 | Unclassified | 1791 |
| 169 | Ga0105240_10314740 | 3300009093 | Bacteria | 1786 |
| 170 | Ga0105240_10320558 | 3300009093 | Bacteria | 1767 |
| 171 | Ga0105240_10337477 | 3300009093 | Bacteria | 1713 |
| 172 | Ga0105240_10341934 | 3300009093 | Bacteria | 1699 |
| 173 | Ga0105245_10002584 | 3300009098 | Bacteria | 16303 |
| 174 | Ga0105245_10022548 | 3300009098 | Bacteria | 5527 |
| 175 | Ga0105245_10049711 | 3300009098 | Unclassified | 3756 |
| 176 | Ga0105245_10064758 | 3300009098 | Bacteria | 3304 |
| 177 | Ga0105245_10157956 | 3300009098 | Bacteria | 2149 |
| 178 | Ga0105245_10236049 | 3300009098 | Bacteria | 1770 |
| 179 | Ga0105245_10307276 | 3300009098 | Bacteria | 1558 |
| 180 | Ga0105245_10376353 | 3300009098 | Unclassified | 1413 |
| 181 | Ga0105245_10438363 | 3300009098 | Bacteria | 1312 |
| 182 | Ga0105245_10804944 | 3300009098 | Unclassified | 978 |
| 183 | Ga0105245_11286153 | 3300009098 | Bacteria | 780 |
| 184 | Ga0105243_10025436 | 3300009148 | Bacteria | 4523 |
| 185 | Ga0105243_10053473 | 3300009148 | Bacteria | 3203 |
| 186 | Ga0105241_10009456 | 3300009174 | Bacteria | 7160 |
| 187 | Ga0105241_10030987 | 3300009174 | Bacteria | 4000 |
| 188 | Ga0105241_10047401 | 3300009174 | Bacteria | 3268 |
| 189 | Ga0105241_10088483 | 3300009174 | Bacteria | 2439 |
| 190 | Ga0105241_10323952 | 3300009174 | Unclassified | 1330 |
| 191 | Ga0105242_10008301 | 3300009176 | Bacteria | 7977 |
| 192 | Ga0105242_10014534 | 3300009176 | Bacteria | 6099 |
| 193 | Ga0105242_10042750 | 3300009176 | Bacteria | 3662 |
| 194 | Ga0105242_10079340 | 3300009176 | Bacteria | 2741 |
| 195 | Ga0105242_10085557 | 3300009176 | Bacteria | 2644 |
| 196 | Ga0105242_10104577 | 3300009176 | Bacteria | 2404 |
| 197 | Ga0105242_10184478 | 3300009176 | Bacteria | 1843 |
| 198 | Ga0105242_10292633 | 3300009176 | Bacteria | 1483 |
| 199 | Ga0105242_10358177 | 3300009176 | Unclassified | 1349 |
| 200 | Ga0105242_10542845 | 3300009176 | Bacteria | 1113 |
| 201 | Ga0105248_10021914 | 3300009177 | Bacteria | 7080 |
| 202 | Ga0105248_10084076 | 3300009177 | Bacteria | 3580 |
| 203 | Ga0105248_10096310 | 3300009177 | Unclassified | 3333 |
| 204 | Ga0105248_10098471 | 3300009177 | Bacteria | 3295 |
| 205 | Ga0105248_10124733 | 3300009177 | Bacteria | 2905 |
| 206 | Ga0105248_10186743 | 3300009177 | Bacteria | 2336 |
| 207 | Ga0105248_10621572 | 3300009177 | Bacteria | 1219 |
| 208 | Ga0105248_10667654 | 3300009177 | Unclassified | 1173 |
| 209 | Ga0105248_10712240 | 3300009177 | Bacteria | 1133 |
| 210 | Ga0105248_10881034 | 3300009177 | Bacteria | 1011 |
| 211 | Ga0105248_10955329 | 3300009177 | Bacteria | 968 |
| 212 | Ga0105237_10006074 | 3300009545 | Bacteria | 13509 |
| 213 | Ga0105237_10015643 | 3300009545 | Bacteria | 7886 |
| 214 | Ga0105237_10053430 | 3300009545 | Bacteria | 4052 |
| 215 | Ga0105237_10182553 | 3300009545 | Bacteria | 2098 |
| 216 | Ga0105238_10003531 | 3300009551 | Bacteria | 15586 |
| 217 | Ga0105238_10026286 | 3300009551 | Bacteria | 5933 |
| 218 | Ga0105238_10039789 | 3300009551 | Bacteria | 4767 |
| 219 | Ga0105238_10044437 | 3300009551 | Bacteria | 4490 |
| 220 | Ga0105238_10053529 | 3300009551 | Bacteria | 4055 |
| 221 | Ga0105238_10313056 | 3300009551 | Bacteria | 1555 |
| 222 | Ga0105238_10492204 | 3300009551 | Bacteria | 1226 |
| 223 | Ga0105249_10006424 | 3300009553 | Bacteria | 10220 |
| 224 | Ga0105249_10095589 | 3300009553 | Bacteria | 2786 |
| 225 | Ga0105249_10227002 | 3300009553 | Bacteria | 1840 |
| 226 | Ga0105239_10009505 | 3300010375 | Bacteria | 10949 |
| 227 | Ga0105239_10019116 | 3300010375 | Bacteria | 7571 |
| 228 | Ga0105239_10020840 | 3300010375 | Bacteria | 7232 |
| 229 | Ga0105239_10306404 | 3300010375 | Bacteria | 1789 |
| 230 | Ga0105239_10572834 | 3300010375 | Bacteria | 1287 |
| 231 | Ga0105239_10600955 | 3300010375 | Unclassified | 1255 |
| 232 | Ga0105239_10913614 | 3300010375 | Unclassified | 1008 |
| 233 | Ga0105246_10031037 | 3300011119 | Bacteria | 3534 |
| 234 | Ga0105246_10050745 | 3300011119 | Bacteria | 2846 |
| 235 | Ga0157371_10249358 | 3300013102 | Bacteria | 1278 |
| 236 | Ga0157370_10003949 | 3300013104 | Bacteria | 17262 |
| 237 | Ga0157370_10004065 | 3300013104 | Bacteria | 16962 |
| 238 | Ga0157370_10023653 | 3300013104 | Bacteria | 6097 |
| 239 | Ga0157370_10532066 | 3300013104 | Bacteria | 1078 |
| 240 | Ga0157370_10549591 | 3300013104 | Bacteria | 1059 |
| 241 | Ga0157369_10001658 | 3300013105 | Bacteria | 27137 |
| 242 | Ga0157369_10014214 | 3300013105 | Bacteria | 8993 |
| 243 | Ga0157369_10042841 | 3300013105 | Bacteria | 4937 |
| 244 | Ga0157369_10087330 | 3300013105 | Bacteria | 3330 |
| 245 | Ga0157369_10236663 | 3300013105 | Unclassified | 1908 |
| 246 | Ga0157369_10258418 | 3300013105 | Bacteria | 1817 |
| 247 | Ga0157369_10320995 | 3300013105 | Bacteria | 1610 |
| 248 | Ga0157369_10330484 | 3300013105 | Bacteria | 1584 |
| 249 | Ga0157369_10762999 | 3300013105 | Bacteria | 995 |
| 250 | Ga0157369_11215058 | 3300013105 | Bacteria | 769 |
| 251 | Ga0157374_10013377 | 3300013296 | Bacteria | 7163 |
| 252 | Ga0157374_10023646 | 3300013296 | Bacteria | 5498 |
| 253 | Ga0157374_10038703 | 3300013296 | Bacteria | 4385 |
| 254 | Ga0157374_10096787 | 3300013296 | Bacteria | 2823 |
| 255 | Ga0157374_10190428 | 3300013296 | Bacteria | 2007 |
| 256 | Ga0157374_10698469 | 3300013296 | Bacteria | 1027 |
| 257 | Ga0157374_11296358 | 3300013296 | Bacteria | 750 |
| 258 | Ga0157378_10006769 | 3300013297 | Bacteria | 10014 |
| 259 | Ga0157378_10034764 | 3300013297 | Bacteria | 4457 |
| 260 | Ga0157378_10528588 | 3300013297 | Unclassified | 1182 |
| 261 | Ga0157378_11163470 | 3300013297 | Unclassified | 810 |
| 262 | Ga0163162_10009244 | 3300013306 | Bacteria | 9589 |
| 263 | Ga0163162_10128725 | 3300013306 | Unclassified | 2639 |
| 264 | Ga0163162_10163966 | 3300013306 | Bacteria | 2346 |
| 265 | Ga0163162_10169642 | 3300013306 | Bacteria | 2307 |
| 266 | Ga0163162_10822549 | 3300013306 | Bacteria | 1045 |
| 267 | Ga0163162_10885885 | 3300013306 | Bacteria | 1006 |
| 268 | Ga0163162_10921663 | 3300013306 | Unclassified | 986 |
| 269 | Ga0157372_10014611 | 3300013307 | Bacteria | 8398 |
| 270 | Ga0157372_10023620 | 3300013307 | Bacteria | 6670 |
| 271 | Ga0157372_10045493 | 3300013307 | Bacteria | 4870 |
| 272 | Ga0157372_10119612 | 3300013307 | Bacteria | 3024 |
| 273 | Ga0157372_10169730 | 3300013307 | Bacteria | 2524 |
| 274 | Ga0157372_10177581 | 3300013307 | Bacteria | 2465 |
| 275 | Ga0157372_10411308 | 3300013307 | Bacteria | 1576 |
| 276 | Ga0157372_10760722 | 3300013307 | Unclassified | 1126 |
| 277 | Ga0157375_10172250 | 3300013308 | Bacteria | 2312 |
| 278 | Ga0157375_10399710 | 3300013308 | Bacteria | 1541 |
| 279 | Ga0157375_10534948 | 3300013308 | Bacteria | 1334 |
| 280 | Ga0157375_10669148 | 3300013308 | Bacteria | 1193 |
| 281 | Ga0157375_10720138 | 3300013308 | Bacteria | 1151 |
| 282 | Ga0157375_10818435 | 3300013308 | Bacteria | 1079 |
| 283 | Ga0157375_11006324 | 3300013308 | Bacteria | 973 |
| 284 | Ga0157375_11182723 | 3300013308 | Unclassified | 897 |
| 285 | Ga0163163_10033602 | 3300014325 | Bacteria | 4963 |
| 286 | Ga0163163_10039812 | 3300014325 | Bacteria | 4588 |
| 287 | Ga0163163_10084857 | 3300014325 | Bacteria | 3174 |
| 288 | Ga0163163_10115921 | 3300014325 | Bacteria | 2710 |
| 289 | Ga0163163_10319914 | 3300014325 | Bacteria | 1605 |
| 290 | Ga0163163_10357454 | 3300014325 | Bacteria | 1517 |
| 291 | Ga0157379_10079842 | 3300014968 | Bacteria | 2930 |
| 292 | Ga0157379_10234516 | 3300014968 | Bacteria | 1664 |
| 293 | Ga0157379_10294279 | 3300014968 | Bacteria | 1479 |
| 294 | Ga0157376_10040256 | 3300014969 | Bacteria | 3818 |
| 295 | Ga0157376_10044253 | 3300014969 | Bacteria | 3658 |
| 296 | Ga0157376_10155227 | 3300014969 | Bacteria | 2069 |
| 297 | Ga0157376_10298322 | 3300014969 | Unclassified | 1524 |
| 298 | Ga0157376_10327085 | 3300014969 | Unclassified | 1459 |
| 299 | Ga0157376_10366577 | 3300014969 | Bacteria | 1383 |
| 300 | Ga0157376_10477134 | 3300014969 | Bacteria | 1221 |
| 301 | Ga0157376_10615948 | 3300014969 | Bacteria | 1082 |
| 302 | Ga0213873_10028021 | 3300021358 | Unclassified | 1378 |
| 303 | Ga0213872_10000337 | 3300021361 | Bacteria | 39767 |
| 304 | Ga0213876_10001214 | 3300021384 | Bacteria | 16256 |
| 305 | Ga0213876_10074751 | 3300021384 | Bacteria | 1790 |
| 306 | Ga0213876_10091139 | 3300021384 | Bacteria | 1615 |
| 307 | Ga0213876_10142792 | 3300021384 | Unclassified | 1273 |
| 308 | Ga0213875_10000055 | 3300021388 | Bacteria | 139636 |
| 309 | Ga0213875_10000108 | 3300021388 | Bacteria | 94421 |
| 310 | Ga0213875_10002769 | 3300021388 | Bacteria | 10348 |
| 311 | Ga0213875_10010188 | 3300021388 | Bacteria | 4721 |
| 312 | Ga0213875_10015031 | 3300021388 | Bacteria | 3769 |
| 313 | Ga0213875_10072622 | 3300021388 | Bacteria | 1606 |
| 314 | Ga0213875_10110277 | 3300021388 | Unclassified | 1285 |
| 315 | Ga0213875_10278870 | 3300021388 | Unclassified | 789 |
| 316 | Ga0207692_10207682 | 3300025898 | Bacteria | 1155 |
| 317 | Ga0207680_10089013 | 3300025903 | Unclassified | 1959 |
| 318 | Ga0207699_10183475 | 3300025906 | Bacteria | 1408 |
| 319 | Ga0207699_10185007 | 3300025906 | Bacteria | 1402 |
| 320 | Ga0207645_10173768 | 3300025907 | Bacteria | 1412 |
| 321 | Ga0207643_10080686 | 3300025908 | Bacteria | 1884 |
| 322 | Ga0207705_10009074 | 3300025909 | Bacteria | 7247 |
| 323 | Ga0207705_10057769 | 3300025909 | Bacteria | 2799 |
| 324 | Ga0207705_10253061 | 3300025909 | Bacteria | 1344 |
| 325 | Ga0207705_10537646 | 3300025909 | Bacteria | 908 |
| 326 | Ga0207654_10007778 | 3300025911 | Bacteria | 5409 |
| 327 | Ga0207654_10036180 | 3300025911 | Bacteria | 2757 |
| 328 | Ga0207654_10069651 | 3300025911 | Bacteria | 2085 |
| 329 | Ga0207654_10201876 | 3300025911 | Unclassified | 1309 |
| 330 | Ga0207707_10007135 | 3300025912 | Bacteria | 9730 |
| 331 | Ga0207707_10024481 | 3300025912 | Bacteria | 5282 |
| 332 | Ga0207707_10100588 | 3300025912 | Bacteria | 2526 |
| 333 | Ga0207707_10119632 | 3300025912 | Bacteria | 2302 |
| 334 | Ga0207695_10000770 | 3300025913 | Bacteria | 60994 |
| 335 | Ga0207695_10002883 | 3300025913 | Bacteria | 24934 |
| 336 | Ga0207695_10005525 | 3300025913 | Bacteria | 16734 |
| 337 | Ga0207695_10009314 | 3300025913 | Bacteria | 12156 |
| 338 | Ga0207695_10012024 | 3300025913 | Bacteria | 10411 |
| 339 | Ga0207695_10022417 | 3300025913 | Bacteria | 7168 |
| 340 | Ga0207695_10051958 | 3300025913 | Bacteria | 4298 |
| 341 | Ga0207695_10064422 | 3300025913 | Bacteria | 3774 |
| 342 | Ga0207695_10256765 | 3300025913 | Unclassified | 1646 |
| 343 | Ga0207695_10478877 | 3300025913 | Bacteria | 1127 |
| 344 | Ga0207671_10052811 | 3300025914 | Bacteria | 3012 |
| 345 | Ga0207671_10108868 | 3300025914 | Bacteria | 2106 |
| 346 | Ga0207693_10103616 | 3300025915 | Bacteria | 2231 |
| 347 | Ga0207663_10097969 | 3300025916 | Bacteria | 1962 |
| 348 | Ga0207663_10150776 | 3300025916 | Bacteria | 1631 |
| 349 | Ga0207663_10648455 | 3300025916 | Unclassified | 833 |
| 350 | Ga0207660_10024188 | 3300025917 | Bacteria | 4109 |
| 351 | Ga0207660_10411795 | 3300025917 | Bacteria | 1089 |
| 352 | Ga0207657_10007163 | 3300025919 | Bacteria | 11456 |
| 353 | Ga0207657_10189272 | 3300025919 | Bacteria | 1661 |
| 354 | Ga0207657_10272031 | 3300025919 | Bacteria | 1346 |
| 355 | Ga0207657_10283510 | 3300025919 | Bacteria | 1315 |
| 356 | Ga0207657_10375153 | 3300025919 | Unclassified | 1121 |
| 357 | Ga0207649_10274898 | 3300025920 | Unclassified | 1222 |
| 358 | Ga0207652_10119181 | 3300025921 | Bacteria | 2347 |
| 359 | Ga0207652_10226187 | 3300025921 | Bacteria | 1686 |
| 360 | Ga0207646_10330640 | 3300025922 | Bacteria | 1377 |
| 361 | Ga0207694_10002138 | 3300025924 | Bacteria | 16241 |
| 362 | Ga0207694_10011929 | 3300025924 | Bacteria | 6553 |
| 363 | Ga0207694_10229364 | 3300025924 | Bacteria | 1516 |
| 364 | Ga0207694_10342537 | 3300025924 | Bacteria | 1236 |
| 365 | Ga0207687_10009834 | 3300025927 | Bacteria | 6260 |
| 366 | Ga0207687_10012877 | 3300025927 | Bacteria | 5467 |
| 367 | Ga0207687_10017133 | 3300025927 | Unclassified | 4763 |
| 368 | Ga0207687_10020360 | 3300025927 | Bacteria | 4400 |
| 369 | Ga0207687_10043361 | 3300025927 | Bacteria | 3099 |
| 370 | Ga0207687_10044347 | 3300025927 | Bacteria | 3068 |
| 371 | Ga0207687_10419155 | 3300025927 | Bacteria | 1104 |
| 372 | Ga0207687_10459244 | 3300025927 | Unclassified | 1057 |
| 373 | Ga0207700_10006899 | 3300025928 | Bacteria | 6905 |
| 374 | Ga0207700_10055608 | 3300025928 | Bacteria | 2975 |
| 375 | Ga0207664_10027284 | 3300025929 | Bacteria | 4327 |
| 376 | Ga0207664_10191890 | 3300025929 | Bacteria | 1759 |
| 377 | Ga0207644_10299670 | 3300025931 | Bacteria | 1295 |
| 378 | Ga0207706_10038266 | 3300025933 | Bacteria | 4255 |
| 379 | Ga0207686_10002152 | 3300025934 | Bacteria | 10841 |
| 380 | Ga0207686_10002620 | 3300025934 | Bacteria | 9761 |
| 381 | Ga0207686_10005323 | 3300025934 | Bacteria | 6900 |
| 382 | Ga0207686_10026810 | 3300025934 | Bacteria | 3367 |
| 383 | Ga0207686_10109888 | 3300025934 | Bacteria | 1857 |
| 384 | Ga0207686_10146335 | 3300025934 | Bacteria | 1639 |
| 385 | Ga0207686_10159472 | 3300025934 | Bacteria | 1579 |
| 386 | Ga0207686_10262465 | 3300025934 | Bacteria | 1267 |
| 387 | Ga0207670_10219669 | 3300025936 | Bacteria | 1454 |
| 388 | Ga0207670_10322052 | 3300025936 | Bacteria | 1216 |
| 389 | Ga0207670_10601007 | 3300025936 | Unclassified | 903 |
| 390 | Ga0207704_10004043 | 3300025938 | Bacteria | 6681 |
| 391 | Ga0207704_10037467 | 3300025938 | Bacteria | 2801 |
| 392 | Ga0207704_10675625 | 3300025938 | Unclassified | 853 |
| 393 | Ga0207691_10381312 | 3300025940 | Bacteria | 1204 |
| 394 | Ga0207711_10035068 | 3300025941 | Bacteria | 4251 |
| 395 | Ga0207711_10041626 | 3300025941 | Bacteria | 3912 |
| 396 | Ga0207711_10057465 | 3300025941 | Bacteria | 3345 |
| 397 | Ga0207689_10014043 | 3300025942 | Bacteria | 6816 |
| 398 | Ga0207689_10102033 | 3300025942 | Bacteria | 2356 |
| 399 | Ga0207689_10210099 | 3300025942 | Bacteria | 1608 |
| 400 | Ga0207661_10000019 | 3300025944 | Bacteria | 235900 |
| 401 | Ga0207661_10008190 | 3300025944 | Bacteria | 7461 |
| 402 | Ga0207661_10020313 | 3300025944 | Bacteria | 4963 |
| 403 | Ga0207661_10151759 | 3300025944 | Bacteria | 2003 |
| 404 | Ga0207661_10262626 | 3300025944 | Bacteria | 1538 |
| 405 | Ga0207661_10415840 | 3300025944 | Bacteria | 1221 |
| 406 | Ga0207661_10589075 | 3300025944 | Bacteria | 1020 |
| 407 | Ga0207661_10748452 | 3300025944 | Bacteria | 899 |
| 408 | Ga0207679_10333168 | 3300025945 | Bacteria | 1318 |
| 409 | Ga0207667_10001168 | 3300025949 | Bacteria | 32962 |
| 410 | Ga0207667_10008741 | 3300025949 | Bacteria | 12005 |
| 411 | Ga0207667_10042580 | 3300025949 | Bacteria | 4825 |
| 412 | Ga0207667_10080063 | 3300025949 | Bacteria | 3385 |
| 413 | Ga0207667_10100696 | 3300025949 | Bacteria | 2981 |
| 414 | Ga0207667_10122473 | 3300025949 | Bacteria | 2680 |
| 415 | Ga0207667_10163410 | 3300025949 | Bacteria | 2289 |
| 416 | Ga0207667_10510766 | 3300025949 | Bacteria | 1218 |
| 417 | Ga0207651_10087711 | 3300025960 | Bacteria | 2266 |
| 418 | Ga0207651_10346186 | 3300025960 | Bacteria | 1250 |
| 419 | Ga0207712_10233096 | 3300025961 | Bacteria | 1479 |
| 420 | Ga0207668_10526123 | 3300025972 | Bacteria | 1021 |
| 421 | Ga0207668_10614417 | 3300025972 | Bacteria | 948 |
| 422 | Ga0207658_10099024 | 3300025986 | Bacteria | 2279 |
| 423 | Ga0207658_10322497 | 3300025986 | Bacteria | 1338 |
| 424 | Ga0207677_10020675 | 3300026023 | Bacteria | 4002 |
| 425 | Ga0207677_10024690 | 3300026023 | Bacteria | 3739 |
| 426 | Ga0207677_10045166 | 3300026023 | Bacteria | 2940 |
| 427 | Ga0207677_10224425 | 3300026023 | Bacteria | 1509 |
| 428 | Ga0207677_10390078 | 3300026023 | Bacteria | 1178 |
| 429 | Ga0207703_10009334 | 3300026035 | Bacteria | 7710 |
| 430 | Ga0207703_10039496 | 3300026035 | Bacteria | 3772 |
| 431 | Ga0207703_10179248 | 3300026035 | Bacteria | 1869 |
| 432 | Ga0207703_10188296 | 3300026035 | Bacteria | 1826 |
| 433 | Ga0207703_10806001 | 3300026035 | Bacteria | 897 |
| 434 | Ga0207639_10065998 | 3300026041 | Bacteria | 2811 |
| 435 | Ga0207639_10081396 | 3300026041 | Bacteria | 2564 |
| 436 | Ga0207678_10042953 | 3300026067 | Bacteria | 3913 |
| 437 | Ga0207702_10056240 | 3300026078 | Bacteria | 3340 |
| 438 | Ga0207702_10109563 | 3300026078 | Bacteria | 2452 |
| 439 | Ga0207702_10114177 | 3300026078 | Bacteria | 2407 |
| 440 | Ga0207702_10127641 | 3300026078 | Bacteria | 2285 |
| 441 | Ga0207702_10173930 | 3300026078 | Bacteria | 1977 |
| 442 | Ga0207702_10213109 | 3300026078 | Bacteria | 1797 |
| 443 | Ga0207702_10256141 | 3300026078 | Bacteria | 1646 |
| 444 | Ga0207702_10266649 | 3300026078 | Bacteria | 1614 |
| 445 | Ga0207702_10302100 | 3300026078 | Bacteria | 1519 |
| 446 | Ga0207702_10319081 | 3300026078 | Unclassified | 1479 |
| 447 | Ga0207702_10789114 | 3300026078 | Unclassified | 939 |
| 448 | Ga0207641_10021590 | 3300026088 | Bacteria | 5290 |
| 449 | Ga0207641_10045937 | 3300026088 | Bacteria | 3680 |
| 450 | Ga0207648_10010408 | 3300026089 | Bacteria | 8817 |
| 451 | Ga0207648_10202789 | 3300026089 | Bacteria | 1759 |
| 452 | Ga0207648_10289922 | 3300026089 | Bacteria | 1465 |
| 453 | Ga0207676_10027727 | 3300026095 | Bacteria | 4222 |
| 454 | Ga0207676_10240478 | 3300026095 | Bacteria | 1624 |
| 455 | Ga0207674_10000166 | 3300026116 | Bacteria | 79149 |
| 456 | Ga0207674_10039163 | 3300026116 | Bacteria | 4915 |
| 457 | Ga0207674_10039333 | 3300026116 | Bacteria | 4903 |
| 458 | Ga0207674_10066179 | 3300026116 | Bacteria | 3641 |
| 459 | Ga0207674_10195251 | 3300026116 | Bacteria | 1974 |
| 460 | Ga0207683_10092532 | 3300026121 | Bacteria | 2694 |
| 461 | Ga0207683_10196763 | 3300026121 | Bacteria | 1831 |
| 462 | Ga0207698_10038899 | 3300026142 | Bacteria | 3519 |
| 463 | Ga0207698_10044678 | 3300026142 | Bacteria | 3331 |
| 464 | Ga0207698_10156504 | 3300026142 | Bacteria | 1986 |
| 465 | Ga0207698_10736825 | 3300026142 | Bacteria | 983 |
| 466 | Ga0207698_10868217 | 3300026142 | Bacteria | 908 |
| 467 | Ga0268266_10064329 | 3300028379 | Bacteria | 3168 |
| 468 | Ga0268266_10356035 | 3300028379 | Bacteria | 1376 |
| 469 | Ga0268264_10009037 | 3300028381 | Bacteria | 8267 |
| 470 | Ga0268264_10108185 | 3300028381 | Bacteria | 2430 |
| 471 | Ga0265323_10001994 | 3300028653 | Bacteria | 9627 |
| 472 | Ga0265338_10099579 | 3300028800 | Bacteria | 2373 |
| 473 | Ga0265338_10175597 | 3300028800 | Bacteria | 1638 |
| 474 | Ga0265324_10035251 | 3300029957 | Bacteria | 1742 |
| 475 | Ga0265330_10059710 | 3300031235 | Bacteria | 1660 |
| 476 | Ga0265332_10100977 | 3300031238 | Bacteria | 1217 |
| 477 | Ga0265328_10047867 | 3300031239 | Bacteria | 1571 |
| 478 | Ga0265320_10001179 | 3300031240 | Bacteria | 19255 |
| 479 | Ga0265325_10003125 | 3300031241 | Bacteria | 10924 |
| 480 | Ga0265325_10073697 | 3300031241 | Bacteria | 1709 |
| 481 | Ga0265325_10075160 | 3300031241 | Unclassified | 1688 |
| 482 | Ga0265340_10018603 | 3300031247 | Bacteria | 3583 |
| 483 | Ga0265339_10024191 | 3300031249 | Bacteria | 3503 |
| 484 | Ga0265331_10134913 | 3300031250 | Bacteria | 1124 |
| 485 | Ga0265316_10001368 | 3300031344 | Bacteria | 26263 |
| 486 | Ga0265316_10001444 | 3300031344 | Bacteria | 25507 |
| 487 | Ga0265316_10004197 | 3300031344 | Bacteria | 14404 |
| 488 | Ga0265316_10008612 | 3300031344 | Bacteria | 9449 |
| 489 | Ga0265316_10013572 | 3300031344 | Bacteria | 7230 |
| 490 | Ga0265316_10014352 | 3300031344 | Bacteria | 6976 |
| 491 | Ga0265316_10015592 | 3300031344 | Bacteria | 6636 |
| 492 | Ga0265316_10015903 | 3300031344 | Bacteria | 6550 |
| 493 | Ga0265316_10120136 | 3300031344 | Bacteria | 1985 |
| 494 | Ga0265316_10226197 | 3300031344 | Bacteria | 1379 |
| 495 | Ga0265314_10000282 | 3300031711 | Bacteria | 73865 |
| 496 | Ga0265314_10000961 | 3300031711 | Bacteria | 33842 |
| 497 | Ga0265314_10011367 | 3300031711 | Bacteria | 7357 |
| 498 | Ga0265314_10025644 | 3300031711 | Bacteria | 4442 |
| 499 | Ga0265314_10111058 | 3300031711 | Bacteria | 1742 |
| 500 | Ga0265314_10205104 | 3300031711 | Bacteria | 1162 |
| 501 | Ga0265342_10112099 | 3300031712 | Bacteria | 1543 |
| 502 | Ga0265342_10125986 | 3300031712 | Bacteria | 1438 |
| 503 | Ga0316214_1022941 | 3300033545 | Bacteria | 876 |
| 504 | Ga0373926_0007779 | 3300035083 | Bacteria | 3568 |
| 505 | Ga0373926_0044617 | 3300035083 | Bacteria | 1588 |
| 506 | Ga0373926_0170597 | 3300035083 | Bacteria | 832 |
| 507 | Ga0373934_0042829 | 3300035086 | Bacteria | 1789 |
| 508 | Ga0373934_0106527 | 3300035086 | Bacteria | 1135 |
| 509 | Ga0373934_0130018 | 3300035086 | Bacteria | 1027 |
| 510 | Ga0373923_0059867 | 3300035111 | Bacteria | 1615 |
| 511 | Ga0373923_0059873 | 3300035111 | Bacteria | 1615 |
| 512 | Ga0373936_0030938 | 3300035113 | Bacteria | 2112 |
| 513 | Ga0373953_0025325 | 3300035117 | Bacteria | 2266 |
| 514 | Ga0373953_0076268 | 3300035117 | Bacteria | 1389 |
| 515 | Ga0373954_0001726 | 3300035118 | Bacteria | 8948 |
| 516 | Ga0373954_0004906 | 3300035118 | Bacteria | 5775 |
| 517 | Ga0373954_0143149 | 3300035118 | Bacteria | 1167 |
| 518 | Ga0373956_0091373 | 3300035119 | Bacteria | 1404 |
| 519 | Ga0373957_0057038 | 3300035120 | Bacteria | 1505 |
| 520 | Ga0373943_0044678 | 3300035170 | Bacteria | 2157 |
| 521 | Ga0373946_0077887 | 3300035171 | Bacteria | 1446 |
| 522 | Ga0373955_0082222 | 3300035172 | Bacteria | 1822 |
| 523 | Ga0373955_0134995 | 3300035172 | Bacteria | 1443 |
| 524 | Ga0373931_0310722 | 3300035691 | Unclassified | 976 |
| 525 | Ga0373935_0011987 | 3300035692 | Bacteria | 5210 |
| 526 | Ga0373935_0044795 | 3300035692 | Bacteria | 2790 |
| 527 | Ga0373927_0000498 | 3300035695 | Bacteria | 29897 |
| 528 | Ga0373927_0002081 | 3300035695 | Bacteria | 14775 |
| 529 | Ga0373927_0053850 | 3300035695 | Bacteria | 2603 |
| 530 | Ga0373927_0067251 | 3300035695 | Bacteria | 2318 |
| 531 | Ga0373927_0157975 | 3300035695 | Bacteria | 1485 |
| 532 | Ga0373927_0221709 | 3300035695 | Bacteria | 1242 |
| 533 | Ga0373927_0361506 | 3300035695 | Unclassified | 957 |
| 534 | Ga0373927_0681159 | 3300035695 | Bacteria | 679 |
| 535 | Ga0373933_0024764 | 3300035724 | Bacteria | 3437 |
| 536 | Ga0373933_0191327 | 3300035724 | Bacteria | 1307 |
| 537 | Ga0373947_0001083 | 3300035725 | Bacteria | 16688 |
| 538 | Ga0373947_0021389 | 3300035725 | Bacteria | 3744 |
| 539 | Ga0373937_0005609 | 3300036401 | Bacteria | 10775 |
| 540 | Ga0373937_0013197 | 3300036401 | Bacteria | 7275 |
| 541 | Ga0373937_0017647 | 3300036401 | Bacteria | 6366 |
| 542 | Ga0373937_0029245 | 3300036401 | Bacteria | 4990 |
| 543 | Ga0373937_0084305 | 3300036401 | Bacteria | 2940 |
| 544 | Ga0373937_0089365 | 3300036401 | Bacteria | 2852 |
| 545 | Ga0373937_0196111 | 3300036401 | Unclassified | 1898 |
| 546 | Ga0373937_0206227 | 3300036401 | Bacteria | 1849 |
| 547 | Ga0373937_0227906 | 3300036401 | Bacteria | 1754 |
| 548 | Ga0373937_0256485 | 3300036401 | Bacteria | 1649 |
| 549 | Ga0373937_0513494 | 3300036401 | Unclassified | 1138 |
| 550 | Ga0373925_0000281 | 3300037068 | Bacteria | 53236 |
| 551 | Ga0373925_0018587 | 3300037068 | Bacteria | 5053 |
| 552 | Ga0373925_0197725 | 3300037068 | Unclassified | 1598 |
| 553 | Ga0373925_0383445 | 3300037068 | Bacteria | 1145 |
| 554 | Ga0395905_0496945 | 3300037471 | Bacteria | 1120 |
| 555 | Ga0436364_0115933 | 3300037853 | Bacteria | 94405 |
| 556 | Ga0436364_0134922 | 3300037853 | Bacteria | 2113 |
| 557 | Ga0436364_0148095 | 3300037853 | Bacteria | 6786 |
| 558 | Ga0436364_0205975 | 3300037853 | Bacteria | 4430 |
| 559 | Ga0436364_0319084 | 3300037853 | Bacteria | 5272 |
| 560 | Ga0436364_0334136 | 3300037853 | Bacteria | 2801 |
| 561 | Ga0436364_0563134 | 3300037853 | Bacteria | 2946 |
| 562 | Ga0436364_0633516 | 3300037853 | Bacteria | 25573 |
| 563 | Ga0436364_0699166 | 3300037853 | Bacteria | 1437 |
| 564 | Ga0436364_0755992 | 3300037853 | Bacteria | 4065 |
| 565 | Ga0436364_0835808 | 3300037853 | Bacteria | 4462 |
| 566 | Ga0436364_0836594 | 3300037853 | Bacteria | 1801 |
| 567 | Ga0436364_1104632 | 3300037853 | Unclassified | 1145 |
| 568 | Ga0436364_1175742 | 3300037853 | Unclassified | 773 |
| 569 | Ga0436364_1193035 | 3300037853 | Bacteria | 6898 |
| 570 | Ga0436364_1200519 | 3300037853 | Bacteria | 2818 |
| 571 | Ga0436364_1286186 | 3300037853 | Bacteria | 721 |
| 572 | Ga0436364_1293248 | 3300037853 | Bacteria | 1922 |
| 573 | Ga0436364_1294362 | 3300037853 | Bacteria | 5877 |
| 574 | Ga0436364_1298937 | 3300037853 | Bacteria | 123533 |
| 575 | Ga0436364_1299576 | 3300037853 | Bacteria | 1771 |
| 576 | Ga0436364_1375522 | 3300037853 | Bacteria | 1658 |
| 577 | Ga0395901_0203680 | 3300038443 | Bacteria | 2074 |
| 578 | Ga0436365_0082593 | 3300039437 | Bacteria | 3156 |
| 579 | Ga0436365_0340201 | 3300039437 | Bacteria | 3973 |
| 580 | Ga0436365_0461265 | 3300039437 | Bacteria | 3511 |
| 581 | Ga0436365_0574543 | 3300039437 | Bacteria | 4824 |
| 582 | Ga0436365_0650674 | 3300039437 | Bacteria | 3958 |
| 583 | Ga0436365_0749264 | 3300039437 | Unclassified | 1060 |
| 584 | Ga0436365_0809363 | 3300039437 | Bacteria | 2280 |
| 585 | Ga0436365_0810573 | 3300039437 | Bacteria | 6562 |
| 586 | Ga0436365_1178155 | 3300039437 | Bacteria | 1599 |
| 587 | Ga0436365_1565054 | 3300039437 | Bacteria | 2460 |
| 588 | Ga0436365_1778817 | 3300039437 | Bacteria | 29645 |
| 589 | Ga0436360_0580543 | 3300039438 | Bacteria | 14902 |
| 590 | Ga0436361_0793152 | 3300039447 | Bacteria | 90360 |
| 591 | Ga0436363_0960435 | 3300039450 | Bacteria | 1411 |
| 592 | Ga0436363_1297791 | 3300039450 | Bacteria | 3582 |
| 593 | Ga0436363_1405280 | 3300039450 | Unclassified | 1076 |
| 594 | Ga0436363_1437195 | 3300039450 | Bacteria | 1802 |
| 595 | Ga0436362_0139354 | 3300039453 | Bacteria | 5292 |
| 596 | Ga0436362_0507053 | 3300039453 | Bacteria | 2158 |
| 597 | Ga0436362_0890342 | 3300039453 | Bacteria | 5717 |
| 598 | Ga0436362_0958030 | 3300039453 | Bacteria | 2227 |
| 599 | Ga0436362_1195420 | 3300039453 | Bacteria | 2641 |
| 600 | Ga0451577_0092642 | 3300042876 | Bacteria | 2698 |
| 601 | Ga0466966_0529456 | 3300044684 | Bacteria | 709 |
| 602 | Ga0453684_0246527 | 3300044712 | Unclassified | 2054 |
| 603 | Ga0453684_0616020 | 3300044712 | Bacteria | 1188 |
| 604 | Ga0451576_0065958 | 3300045051 | Bacteria | 3769 |
| 605 | Ga0451576_0311321 | 3300045051 | Bacteria | 1647 |
| 606 | Ga0466958_0202424 | 3300045836 | Bacteria | 1264 |
| 607 | Ga0466967_0265592 | 3300045976 | Bacteria | 1643 |
| 608 | Ga0466967_1032258 | 3300045976 | Unclassified | 819 |
| 609 | Ga0495592_0053384 | 3300046454 | Bacteria | 2998 |
| 610 | Ga0495651_0002965 | 3300046462 | Bacteria | 13114 |
| 611 | Ga0495651_0029667 | 3300046462 | Bacteria | 4265 |
| 612 | Ga0495580_0011536 | 3300046472 | Bacteria | 6836 |
| 613 | Ga0495580_0011669 | 3300046472 | Bacteria | 6792 |
| 614 | Ga0495580_0013676 | 3300046472 | Bacteria | 6184 |
| 615 | Ga0495580_0058744 | 3300046472 | Unclassified | 2704 |
| 616 | Ga0495580_0136585 | 3300046472 | Bacteria | 1700 |
| 617 | Ga0495582_0024457 | 3300046473 | Bacteria | 3305 |
| 618 | Ga0495664_0009577 | 3300046477 | Bacteria | 5421 |
| 619 | Ga0495664_0200917 | 3300046477 | Unclassified | 1208 |
| 620 | Ga0495594_0224652 | 3300046499 | Bacteria | 1071 |
| 621 | Ga0495608_0296060 | 3300046511 | Bacteria | 1002 |
| 622 | Ga0495608_0419503 | 3300046511 | Bacteria | 817 |
| 623 | Ga0495618_0505648 | 3300046514 | Bacteria | 728 |
| 624 | Ga0495628_0003543 | 3300046516 | Bacteria | 13988 |
| 625 | Ga0495628_0133784 | 3300046516 | Bacteria | 1896 |
| 626 | Ga0495630_0120604 | 3300046517 | Bacteria | 1989 |
| 627 | Ga0495666_0127321 | 3300046526 | Bacteria | 1191 |
| 628 | Ga0495666_0166694 | 3300046526 | Bacteria | 1020 |
| 629 | Ga0495666_0243213 | 3300046526 | Unclassified | 821 |
| 630 | Ga0495652_0351008 | 3300046529 | Bacteria | 1057 |
| 631 | Ga0495665_0033307 | 3300046531 | Bacteria | 2756 |
| 632 | Ga0495665_0072053 | 3300046531 | Bacteria | 1820 |
| 633 | Ga0495665_0199065 | 3300046531 | Unclassified | 1038 |
| 634 | Ga0495587_0006862 | 3300046536 | Bacteria | 7406 |
| 635 | Ga0495587_0209528 | 3300046536 | Bacteria | 1101 |
| 636 | Ga0495645_0161581 | 3300046543 | Bacteria | 1548 |
| 637 | Ga0495633_0292861 | 3300046558 | Unclassified | 740 |
| 638 | Ga0495667_0045667 | 3300046559 | Bacteria | 2899 |
| 639 | Ga0495667_0051911 | 3300046559 | Bacteria | 2704 |
| 640 | Ga0495667_0225505 | 3300046559 | Bacteria | 1195 |
| 641 | Ga0495634_0284566 | 3300046642 | Bacteria | 1003 |
| 642 | Ga0495634_0378321 | 3300046642 | Bacteria | 844 |
| 643 | Ga0495635_0110370 | 3300046663 | Bacteria | 1879 |
| 644 | Ga0495599_0004028 | 3300046678 | Bacteria | 8650 |
| 645 | Ga0495599_0050812 | 3300046678 | Bacteria | 2598 |
| 646 | Ga0495623_0009599 | 3300046679 | Bacteria | 6282 |
| 647 | Ga0495623_0018163 | 3300046679 | Bacteria | 4542 |
| 648 | Ga0495623_0098521 | 3300046679 | Unclassified | 1784 |
| 649 | Ga0495647_0220477 | 3300046681 | Unclassified | 837 |
| 650 | Ga0495658_0036949 | 3300046683 | Bacteria | 2698 |
| 651 | Ga0495613_0115355 | 3300046689 | Bacteria | 1933 |
| 652 | Ga0495613_0154529 | 3300046689 | Bacteria | 1635 |
| 653 | Ga0495613_0498708 | 3300046689 | Unclassified | 820 |
| 654 | Ga0495624_0039485 | 3300046690 | Bacteria | 3026 |
| 655 | Ga0495624_0392606 | 3300046690 | Bacteria | 833 |
| 656 | Ga0495600_0405158 | 3300046809 | Bacteria | 848 |
| 657 | Ga0495604_0094000 | 3300047317 | Bacteria | 2217 |
| 658 | Ga0495674_0042721 | 3300047319 | Bacteria | 4041 |
| 659 | Ga0495674_0068423 | 3300047319 | Unclassified | 3073 |
| 660 | Ga0495674_0069537 | 3300047319 | Unclassified | 3044 |
| 661 | Ga0495674_0098064 | 3300047319 | Bacteria | 2496 |
| 662 | Ga0495674_0116622 | 3300047319 | Bacteria | 2259 |
| 663 | Ga0495674_0216657 | 3300047319 | Bacteria | 1584 |
| 664 | Ga0495674_0623856 | 3300047319 | Bacteria | 852 |
| 665 | Ga0495675_0036019 | 3300047444 | Bacteria | 3158 |
| 666 | Ga0495675_0115170 | 3300047444 | Bacteria | 1676 |
| 667 | Ga0495675_0258551 | 3300047444 | Bacteria | 1044 |
| 668 | Ga0495684_0005866 | 3300047471 | Bacteria | 9545 |
| 669 | Ga0495684_0048916 | 3300047471 | Bacteria | 3232 |
| 670 | Ga0495684_0165858 | 3300047471 | Bacteria | 1645 |
| 671 | Ga0495593_0319352 | 3300047673 | Bacteria | 776 |
| 672 | Ga0495602_0317269 | 3300048088 | Bacteria | 1135 |
| 673 | Ga0496104_0791158 | 3300048907 | Unclassified | 855 |
| 674 | Ga0496114_0953557 | 3300048917 | Bacteria | 740 |
| 675 | Ga0496115_0017737 | 3300048918 | Bacteria | 5449 |
| 676 | Ga0496115_0209306 | 3300048918 | Bacteria | 1611 |
| 677 | Ga0496115_0439781 | 3300048918 | Bacteria | 1055 |
| 678 | Ga0501031_0002010 | 3300049568 | Bacteria | 12827 |
| 679 | Ga0501032_0001366 | 3300049569 | Bacteria | 19354 |
| 680 | Ga0501033_0015134 | 3300049570 | Bacteria | 5853 |
| 681 | Ga0501034_0026807 | 3300049571 | Bacteria | 5862 |
| 682 | Ga0501034_0095298 | 3300049571 | Bacteria | 2973 |
| 683 | Ga0501036_0001154 | 3300049572 | Bacteria | 20080 |
| 684 | Ga0501037_0005354 | 3300049573 | Bacteria | 9335 |
| 685 | Ga0501038_0000838 | 3300049574 | Bacteria | 27356 |
| 686 | Ga0501039_0005534 | 3300049575 | Bacteria | 9561 |
| 687 | Ga0501040_0661289 | 3300049576 | Bacteria | 755 |
| 688 | Ga0501043_0042298 | 3300049579 | Bacteria | 3580 |
| 689 | Ga0501046_0002291 | 3300049580 | Bacteria | 18046 |
| 690 | Ga0501047_0098218 | 3300049581 | Bacteria | 2807 |
| 691 | Ga0501047_0402488 | 3300049581 | Unclassified | 1201 |
| 692 | Ga0501048_0026632 | 3300049582 | Bacteria | 4209 |
| 693 | Ga0501067_0034591 | 3300049583 | Bacteria | 2804 |
| 694 | Ga0501068_0001809 | 3300049584 | Bacteria | 11364 |
| 695 | Ga0501069_0000403 | 3300049585 | Bacteria | 19568 |
| 696 | Ga0501070_0091243 | 3300049586 | Bacteria | 2521 |
| 697 | Ga0501072_0003019 | 3300049588 | Bacteria | 12694 |
| 698 | Ga0501073_0001367 | 3300049589 | Bacteria | 18010 |
| 699 | Ga0501074_0103262 | 3300049590 | Bacteria | 2040 |
| 700 | Ga0501076_0131416 | 3300049592 | Bacteria | 2030 |
| 701 | Ga0501077_0018748 | 3300049593 | Bacteria | 4377 |
| 702 | Ga0501239_010678 | 3300049672 | Unclassified | 1016 |
| 703 | Ga0501079_0108992 | 3300049741 | Unclassified | 2150 |
| 704 | Ga0501080_0000243 | 3300049742 | Bacteria | 40903 |
| 705 | Ga0501083_0004506 | 3300049744 | Bacteria | 9839 |
| 706 | Ga0501035_0132437 | 3300049822 | Unclassified | 2172 |
| 707 | Ga0501035_0298501 | 3300049822 | Bacteria | 1358 |
| 708 | Ga0501044_0001257 | 3300049823 | Bacteria | 29993 |
| 709 | Ga0501045_0053881 | 3300049824 | Bacteria | 2940 |
| 710 | nmdc:mga0qj67_510669_c1 | 3300050509 | Bacteria | 966 |
| 711 | nmdc:mga06r32_7934_c1 | 3300050510 | Bacteria | 9542 |
| 712 | Ga0495612_0023813 | 3300053078 | Bacteria | 2458 |
| 713 | Ga0500568_0001054 | 3300053139 | Bacteria | 18805 |
| 714 | Ga0501084_0000227 | 3300054114 | Bacteria | 42697 |
| 715 | Ga0501082_0000199 | 3300060353 | Bacteria | 52195 |
| 716 | Ga0501082_0078605 | 3300060353 | Bacteria | 2845 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0681159 | Ga0373927_0681159_81_647 | 186 |
| 2 | 3300009174 | Ga0105241_10030987 | Ga0105241_100309875 | 198 |
| 3 | 3300035118 | Ga0373954_0143149 | Ga0373954_0143149_245_922 | 198 |
| 4 | 3300013306 | Ga0163162_10921663 | Ga0163162_109216632 | 200 |
| 5 | 3300025906 | Ga0207699_10183475 | Ga0207699_101834752 | 201 |
| 6 | 3300037853 | Ga0436364_1286186 | Ga0436364_1286186_71_691 | 203 |
| 7 | 3300045836 | Ga0466958_0202424 | Ga0466958_0202424_42_674 | 203 |
| 8 | 3300021388 | Ga0213875_10110277 | Ga0213875_101102772 | 204 |
| 9 | 3300005329 | Ga0070683_100146187 | Ga0070683_1001461872 | 206 |
| 10 | 3300005435 | Ga0070714_100218646 | Ga0070714_1002186462 | 206 |
| 11 | 3300005439 | Ga0070711_100818460 | Ga0070711_1008184601 | 206 |
| 12 | 3300009093 | Ga0105240_10079917 | Ga0105240_100799174 | 206 |
| 13 | 3300010375 | Ga0105239_10572834 | Ga0105239_105728342 | 206 |
| 14 | 3300025913 | Ga0207695_10064422 | Ga0207695_100644224 | 206 |
| 15 | 3300025929 | Ga0207664_10191890 | Ga0207664_101918903 | 206 |
| 16 | 3300025944 | Ga0207661_10589075 | Ga0207661_105890752 | 206 |
| 17 | 3300005436 | Ga0070713_100157774 | Ga0070713_1001577742 | 210 |
| 18 | 3300025928 | Ga0207700_10055608 | Ga0207700_100556084 | 210 |
| 19 | 3300013296 | Ga0157374_11296358 | Ga0157374_112963581 | 212 |
| 20 | 3300035113 | Ga0373936_0030938 | Ga0373936_0030938_175_828 | 217 |
| 21 | 3300035695 | Ga0373927_0053850 | Ga0373927_0053850_1679_2332 | 217 |
| 22 | 3300036401 | Ga0373937_0256485 | Ga0373937_0256485_879_1532 | 217 |
| 23 | 3300037068 | Ga0373925_0018587 | Ga0373925_0018587_1033_1686 | 217 |
| 24 | 3300046517 | Ga0495630_0120604 | Ga0495630_0120604_499_1152 | 217 |
| 25 | 3300046531 | Ga0495665_0072053 | Ga0495665_0072053_780_1433 | 217 |
| 26 | 3300046690 | Ga0495624_0392606 | Ga0495624_0392606_139_792 | 217 |
| 27 | 3300048917 | Ga0496114_0953557 | Ga0496114_0953557_76_729 | 217 |
| 28 | 3300049672 | Ga0501239_010678 | Ga0501239_010678_10_663 | 217 |
| 29 | 3300053078 | Ga0495612_0023813 | Ga0495612_0023813_552_1205 | 217 |
| 30 | 3300009093 | Ga0105240_10248872 | Ga0105240_102488723 | 218 |
| 31 | 3300009098 | Ga0105245_10022548 | Ga0105245_100225483 | 218 |
| 32 | 3300009098 | Ga0105245_10064758 | Ga0105245_100647583 | 218 |
| 33 | 3300009098 | Ga0105245_10236049 | Ga0105245_102360492 | 218 |
| 34 | 3300009176 | Ga0105242_10014534 | Ga0105242_100145344 | 218 |
| 35 | 3300009177 | Ga0105248_10712240 | Ga0105248_107122402 | 218 |
| 36 | 3300009551 | Ga0105238_10003531 | Ga0105238_1000353111 | 218 |
| 37 | 3300009551 | Ga0105238_10313056 | Ga0105238_103130562 | 218 |
| 38 | 3300010375 | Ga0105239_10019116 | Ga0105239_100191166 | 218 |
| 39 | 3300013105 | Ga0157369_10236663 | Ga0157369_102366632 | 218 |
| 40 | 3300013296 | Ga0157374_10023646 | Ga0157374_100236466 | 218 |
| 41 | 3300013297 | Ga0157378_10034764 | Ga0157378_100347645 | 218 |
| 42 | 3300013306 | Ga0163162_10128725 | Ga0163162_101287253 | 218 |
| 43 | 3300013307 | Ga0157372_10045493 | Ga0157372_100454935 | 218 |
| 44 | 3300013308 | Ga0157375_10399710 | Ga0157375_103997103 | 218 |
| 45 | 3300013308 | Ga0157375_10720138 | Ga0157375_107201381 | 218 |
| 46 | 3300014325 | Ga0163163_10319914 | Ga0163163_103199142 | 218 |
| 47 | 3300014968 | Ga0157379_10079842 | Ga0157379_100798423 | 218 |
| 48 | 3300035083 | Ga0373926_0170597 | Ga0373926_0170597_24_680 | 218 |
| 49 | 3300045976 | Ga0466967_1032258 | Ga0466967_1032258_12_701 | 218 |
| 50 | 3300025972 | Ga0207668_10526123 | Ga0207668_105261232 | 219 |
| 51 | 3300031711 | Ga0265314_10000282 | Ga0265314_1000028251 | 219 |
| 52 | 3300005356 | Ga0070674_100281639 | Ga0070674_1002816392 | 220 |
| 53 | 3300009093 | Ga0105240_10000725 | Ga0105240_100007251 | 222 |
| 54 | 3300013296 | Ga0157374_10190428 | Ga0157374_101904282 | 222 |
| 55 | 3300035083 | Ga0373926_0044617 | Ga0373926_0044617_588_1256 | 222 |
| 56 | 3300035695 | Ga0373927_0000498 | Ga0373927_0000498_10381_11049 | 222 |
| 57 | 3300036401 | Ga0373937_0513494 | Ga0373937_0513494_54_722 | 222 |
| 58 | 3300046477 | Ga0495664_0200917 | Ga0495664_0200917_132_800 | 222 |
| 59 | 3300048918 | Ga0496115_0017737 | Ga0496115_0017737_3220_3894 | 222 |
| 60 | 3300046681 | Ga0495647_0220477 | Ga0495647_0220477_14_685 | 223 |
| 61 | 3300005336 | Ga0070680_100106992 | Ga0070680_1001069922 | 224 |
| 62 | 3300005434 | Ga0070709_10031530 | Ga0070709_100315303 | 224 |
| 63 | 3300005445 | Ga0070708_100037457 | Ga0070708_1000374573 | 224 |
| 64 | 3300005468 | Ga0070707_100434279 | Ga0070707_1004342791 | 224 |
| 65 | 3300005518 | Ga0070699_100709012 | Ga0070699_1007090122 | 224 |
| 66 | 3300005544 | Ga0070686_100372070 | Ga0070686_1003720701 | 224 |
| 67 | 3300009093 | Ga0105240_10001720 | Ga0105240_1000172024 | 224 |
| 68 | 3300009098 | Ga0105245_10438363 | Ga0105245_104383632 | 224 |
| 69 | 3300009176 | Ga0105242_10008301 | Ga0105242_1000830111 | 224 |
| 70 | 3300009176 | Ga0105242_10184478 | Ga0105242_101844782 | 224 |
| 71 | 3300009177 | Ga0105248_10881034 | Ga0105248_108810342 | 224 |
| 72 | 3300009545 | Ga0105237_10053430 | Ga0105237_100534303 | 224 |
| 73 | 3300013308 | Ga0157375_10669148 | Ga0157375_106691482 | 224 |
| 74 | 3300025906 | Ga0207699_10185007 | Ga0207699_101850072 | 224 |
| 75 | 3300025922 | Ga0207646_10330640 | Ga0207646_103306401 | 224 |
| 76 | 3300025934 | Ga0207686_10002152 | Ga0207686_100021523 | 224 |
| 77 | 3300025945 | Ga0207679_10333168 | Ga0207679_103331682 | 224 |
| 78 | 3300026035 | Ga0207703_10806001 | Ga0207703_108060011 | 224 |
| 79 | 3300026078 | Ga0207702_10319081 | Ga0207702_103190812 | 224 |
| 80 | 3300026142 | Ga0207698_10868217 | Ga0207698_108682172 | 224 |
| 81 | 3300031241 | Ga0265325_10003125 | Ga0265325_100031255 | 224 |
| 82 | 3300033545 | Ga0316214_1022941 | Ga0316214_10229412 | 224 |
| 83 | 3300046642 | Ga0495634_0284566 | Ga0495634_0284566_67_741 | 224 |
| 84 | 3300047319 | Ga0495674_0216657 | Ga0495674_0216657_334_1008 | 224 |
| 85 | 3300005336 | Ga0070680_100025498 | Ga0070680_1000254983 | 225 |
| 86 | 3300005435 | Ga0070714_100170607 | Ga0070714_1001706072 | 225 |
| 87 | 3300005563 | Ga0068855_100005921 | Ga0068855_1000059216 | 225 |
| 88 | 3300005614 | Ga0068856_100044788 | Ga0068856_1000447885 | 225 |
| 89 | 3300006237 | Ga0097621_100090916 | Ga0097621_1000909162 | 225 |
| 90 | 3300006358 | Ga0068871_100102752 | Ga0068871_1001027523 | 225 |
| 91 | 3300009093 | Ga0105240_10014192 | Ga0105240_100141923 | 225 |
| 92 | 3300013104 | Ga0157370_10003949 | Ga0157370_1000394914 | 225 |
| 93 | 3300013104 | Ga0157370_10004065 | Ga0157370_1000406514 | 225 |
| 94 | 3300013105 | Ga0157369_10014214 | Ga0157369_100142147 | 225 |
| 95 | 3300013105 | Ga0157369_10087330 | Ga0157369_100873303 | 225 |
| 96 | 3300025913 | Ga0207695_10002883 | Ga0207695_100028835 | 225 |
| 97 | 3300026078 | Ga0207702_10213109 | Ga0207702_102131092 | 225 |
| 98 | 3300031241 | Ga0265325_10075160 | Ga0265325_100751602 | 225 |
| 99 | 3300036401 | Ga0373937_0227906 | Ga0373937_0227906_343_1020 | 225 |
| 100 | 3300037068 | Ga0373925_0383445 | Ga0373925_0383445_312_989 | 225 |
| 101 | 3300039438 | Ga0436360_0580543 | Ga0436360_0580543_8340_9026 | 225 |
| 102 | 3300039450 | Ga0436363_1297791 | Ga0436363_1297791_535_1212 | 225 |
| 103 | 3300039453 | Ga0436362_0958030 | Ga0436362_0958030_1409_2113 | 225 |
| 104 | 3300044684 | Ga0466966_0529456 | Ga0466966_0529456_13_690 | 225 |
| 105 | 3300046454 | Ga0495592_0053384 | Ga0495592_0053384_1546_2223 | 225 |
| 106 | 3300046536 | Ga0495587_0006862 | Ga0495587_0006862_5751_6428 | 225 |
| 107 | 3300046679 | Ga0495623_0018163 | Ga0495623_0018163_3427_4104 | 225 |
| 108 | 3300053139 | Ga0500568_0001054 | Ga0500568_0001054_4315_4992 | 225 |
| 109 | 3300005327 | Ga0070658_10009861 | Ga0070658_100098616 | 226 |
| 110 | 3300005327 | Ga0070658_10129626 | Ga0070658_101296262 | 226 |
| 111 | 3300005328 | Ga0070676_10168310 | Ga0070676_101683103 | 226 |
| 112 | 3300005329 | Ga0070683_100005237 | Ga0070683_10000523711 | 226 |
| 113 | 3300005329 | Ga0070683_100780711 | Ga0070683_1007807111 | 226 |
| 114 | 3300005330 | Ga0070690_100309505 | Ga0070690_1003095052 | 226 |
| 115 | 3300005335 | Ga0070666_10115154 | Ga0070666_101151542 | 226 |
| 116 | 3300005336 | Ga0070680_100038958 | Ga0070680_1000389583 | 226 |
| 117 | 3300005338 | Ga0068868_100011009 | Ga0068868_1000110098 | 226 |
| 118 | 3300005338 | Ga0068868_100044941 | Ga0068868_1000449413 | 226 |
| 119 | 3300005338 | Ga0068868_100277237 | Ga0068868_1002772372 | 226 |
| 120 | 3300005339 | Ga0070660_100007244 | Ga0070660_1000072444 | 226 |
| 121 | 3300005339 | Ga0070660_100171655 | Ga0070660_1001716552 | 226 |
| 122 | 3300005339 | Ga0070660_100205510 | Ga0070660_1002055102 | 226 |
| 123 | 3300005344 | Ga0070661_100052822 | Ga0070661_1000528224 | 226 |
| 124 | 3300005345 | Ga0070692_10092230 | Ga0070692_100922302 | 226 |
| 125 | 3300005356 | Ga0070674_100627889 | Ga0070674_1006278891 | 226 |
| 126 | 3300005364 | Ga0070673_100318278 | Ga0070673_1003182782 | 226 |
| 127 | 3300005367 | Ga0070667_100013784 | Ga0070667_1000137841 | 226 |
| 128 | 3300005436 | Ga0070713_100048723 | Ga0070713_1000487232 | 226 |
| 129 | 3300005455 | Ga0070663_100728272 | Ga0070663_1007282721 | 226 |
| 130 | 3300005458 | Ga0070681_10022213 | Ga0070681_100222132 | 226 |
| 131 | 3300005459 | Ga0068867_100208333 | Ga0068867_1002083332 | 226 |
| 132 | 3300005459 | Ga0068867_100480300 | Ga0068867_1004803002 | 226 |
| 133 | 3300005530 | Ga0070679_100000635 | Ga0070679_10000063524 | 226 |
| 134 | 3300005535 | Ga0070684_100000654 | Ga0070684_10000065411 | 226 |
| 135 | 3300005535 | Ga0070684_100095009 | Ga0070684_1000950094 | 226 |
| 136 | 3300005535 | Ga0070684_100127399 | Ga0070684_1001273992 | 226 |
| 137 | 3300005535 | Ga0070684_100551658 | Ga0070684_1005516582 | 226 |
| 138 | 3300005539 | Ga0068853_100018364 | Ga0068853_1000183641 | 226 |
| 139 | 3300005539 | Ga0068853_100111936 | Ga0068853_1001119362 | 226 |
| 140 | 3300005548 | Ga0070665_100021507 | Ga0070665_1000215071 | 226 |
| 141 | 3300005563 | Ga0068855_100003676 | Ga0068855_1000036767 | 226 |
| 142 | 3300005563 | Ga0068855_100017587 | Ga0068855_1000175877 | 226 |
| 143 | 3300005563 | Ga0068855_100041567 | Ga0068855_1000415676 | 226 |
| 144 | 3300005563 | Ga0068855_100133575 | Ga0068855_1001335752 | 226 |
| 145 | 3300005563 | Ga0068855_100235759 | Ga0068855_1002357592 | 226 |
| 146 | 3300005563 | Ga0068855_100258952 | Ga0068855_1002589522 | 226 |
| 147 | 3300005564 | Ga0070664_100251199 | Ga0070664_1002511992 | 226 |
| 148 | 3300005577 | Ga0068857_100000367 | Ga0068857_10000036712 | 226 |
| 149 | 3300005577 | Ga0068857_100026136 | Ga0068857_1000261363 | 226 |
| 150 | 3300005577 | Ga0068857_100713242 | Ga0068857_1007132421 | 226 |
| 151 | 3300005614 | Ga0068856_100202529 | Ga0068856_1002025293 | 226 |
| 152 | 3300005614 | Ga0068856_100296679 | Ga0068856_1002966791 | 226 |
| 153 | 3300005614 | Ga0068856_100453965 | Ga0068856_1004539652 | 226 |
| 154 | 3300005616 | Ga0068852_100044205 | Ga0068852_1000442053 | 226 |
| 155 | 3300005616 | Ga0068852_100064073 | Ga0068852_1000640733 | 226 |
| 156 | 3300005616 | Ga0068852_100366049 | Ga0068852_1003660492 | 226 |
| 157 | 3300005618 | Ga0068864_100215952 | Ga0068864_1002159522 | 226 |
| 158 | 3300005841 | Ga0068863_100032126 | Ga0068863_1000321265 | 226 |
| 159 | 3300005842 | Ga0068858_100200992 | Ga0068858_1002009923 | 226 |
| 160 | 3300005842 | Ga0068858_100233987 | Ga0068858_1002339872 | 226 |
| 161 | 3300005843 | Ga0068860_100008416 | Ga0068860_1000084165 | 226 |
| 162 | 3300005843 | Ga0068860_100260682 | Ga0068860_1002606823 | 226 |
| 163 | 3300006237 | Ga0097621_100014202 | Ga0097621_1000142023 | 226 |
| 164 | 3300006237 | Ga0097621_100018452 | Ga0097621_1000184526 | 226 |
| 165 | 3300006237 | Ga0097621_100110583 | Ga0097621_1001105832 | 226 |
| 166 | 3300006237 | Ga0097621_100122757 | Ga0097621_1001227572 | 226 |
| 167 | 3300006237 | Ga0097621_100307010 | Ga0097621_1003070101 | 226 |
| 168 | 3300006237 | Ga0097621_100508370 | Ga0097621_1005083702 | 226 |
| 169 | 3300006237 | Ga0097621_100884963 | Ga0097621_1008849632 | 226 |
| 170 | 3300006358 | Ga0068871_100013047 | Ga0068871_1000130474 | 226 |
| 171 | 3300006358 | Ga0068871_100081163 | Ga0068871_1000811632 | 226 |
| 172 | 3300006881 | Ga0068865_100144276 | Ga0068865_1001442763 | 226 |
| 173 | 3300006881 | Ga0068865_100222387 | Ga0068865_1002223872 | 226 |
| 174 | 3300009093 | Ga0105240_10000137 | Ga0105240_1000013725 | 226 |
| 175 | 3300009093 | Ga0105240_10008603 | Ga0105240_100086036 | 226 |
| 176 | 3300009093 | Ga0105240_10024993 | Ga0105240_100249936 | 226 |
| 177 | 3300009093 | Ga0105240_10177114 | Ga0105240_101771144 | 226 |
| 178 | 3300009093 | Ga0105240_10337477 | Ga0105240_103374772 | 226 |
| 179 | 3300009098 | Ga0105245_10002584 | Ga0105245_1000258417 | 226 |
| 180 | 3300009098 | Ga0105245_10157956 | Ga0105245_101579562 | 226 |
| 181 | 3300009098 | Ga0105245_10307276 | Ga0105245_103072763 | 226 |
| 182 | 3300009098 | Ga0105245_10376353 | Ga0105245_103763532 | 226 |
| 183 | 3300009148 | Ga0105243_10025436 | Ga0105243_100254362 | 226 |
| 184 | 3300009148 | Ga0105243_10053473 | Ga0105243_100534732 | 226 |
| 185 | 3300009174 | Ga0105241_10009456 | Ga0105241_100094566 | 226 |
| 186 | 3300009174 | Ga0105241_10047401 | Ga0105241_100474013 | 226 |
| 187 | 3300009174 | Ga0105241_10088483 | Ga0105241_100884833 | 226 |
| 188 | 3300009174 | Ga0105241_10323952 | Ga0105241_103239522 | 226 |
| 189 | 3300009176 | Ga0105242_10042750 | Ga0105242_100427503 | 226 |
| 190 | 3300009176 | Ga0105242_10085557 | Ga0105242_100855572 | 226 |
| 191 | 3300009176 | Ga0105242_10104577 | Ga0105242_101045773 | 226 |
| 192 | 3300009176 | Ga0105242_10358177 | Ga0105242_103581771 | 226 |
| 193 | 3300009176 | Ga0105242_10542845 | Ga0105242_105428451 | 226 |
| 194 | 3300009177 | Ga0105248_10096310 | Ga0105248_100963105 | 226 |
| 195 | 3300009177 | Ga0105248_10186743 | Ga0105248_101867434 | 226 |
| 196 | 3300009545 | Ga0105237_10006074 | Ga0105237_100060742 | 226 |
| 197 | 3300009545 | Ga0105237_10182553 | Ga0105237_101825532 | 226 |
| 198 | 3300009551 | Ga0105238_10026286 | Ga0105238_100262861 | 226 |
| 199 | 3300009551 | Ga0105238_10039789 | Ga0105238_100397895 | 226 |
| 200 | 3300009551 | Ga0105238_10044437 | Ga0105238_100444373 | 226 |
| 201 | 3300009553 | Ga0105249_10227002 | Ga0105249_102270022 | 226 |
| 202 | 3300010375 | Ga0105239_10009505 | Ga0105239_1000950512 | 226 |
| 203 | 3300010375 | Ga0105239_10020840 | Ga0105239_100208404 | 226 |
| 204 | 3300010375 | Ga0105239_10600955 | Ga0105239_106009551 | 226 |
| 205 | 3300013104 | Ga0157370_10023653 | Ga0157370_100236533 | 226 |
| 206 | 3300013104 | Ga0157370_10532066 | Ga0157370_105320661 | 226 |
| 207 | 3300013105 | Ga0157369_11215058 | Ga0157369_112150581 | 226 |
| 208 | 3300013296 | Ga0157374_10038703 | Ga0157374_100387034 | 226 |
| 209 | 3300013296 | Ga0157374_10096787 | Ga0157374_100967872 | 226 |
| 210 | 3300013297 | Ga0157378_10006769 | Ga0157378_100067696 | 226 |
| 211 | 3300013297 | Ga0157378_11163470 | Ga0157378_111634701 | 226 |
| 212 | 3300013306 | Ga0163162_10009244 | Ga0163162_100092442 | 226 |
| 213 | 3300013306 | Ga0163162_10169642 | Ga0163162_101696422 | 226 |
| 214 | 3300013306 | Ga0163162_10885885 | Ga0163162_108858851 | 226 |
| 215 | 3300013307 | Ga0157372_10023620 | Ga0157372_100236205 | 226 |
| 216 | 3300013307 | Ga0157372_10169730 | Ga0157372_101697302 | 226 |
| 217 | 3300013307 | Ga0157372_10760722 | Ga0157372_107607222 | 226 |
| 218 | 3300013308 | Ga0157375_10172250 | Ga0157375_101722503 | 226 |
| 219 | 3300014325 | Ga0163163_10033602 | Ga0163163_100336026 | 226 |
| 220 | 3300014325 | Ga0163163_10039812 | Ga0163163_100398125 | 226 |
| 221 | 3300014325 | Ga0163163_10357454 | Ga0163163_103574542 | 226 |
| 222 | 3300014968 | Ga0157379_10294279 | Ga0157379_102942792 | 226 |
| 223 | 3300014969 | Ga0157376_10155227 | Ga0157376_101552274 | 226 |
| 224 | 3300025898 | Ga0207692_10207682 | Ga0207692_102076822 | 226 |
| 225 | 3300025903 | Ga0207680_10089013 | Ga0207680_100890133 | 226 |
| 226 | 3300025907 | Ga0207645_10173768 | Ga0207645_101737682 | 226 |
| 227 | 3300025909 | Ga0207705_10009074 | Ga0207705_100090748 | 226 |
| 228 | 3300025909 | Ga0207705_10537646 | Ga0207705_105376462 | 226 |
| 229 | 3300025911 | Ga0207654_10007778 | Ga0207654_100077787 | 226 |
| 230 | 3300025911 | Ga0207654_10036180 | Ga0207654_100361803 | 226 |
| 231 | 3300025911 | Ga0207654_10069651 | Ga0207654_100696513 | 226 |
| 232 | 3300025911 | Ga0207654_10201876 | Ga0207654_102018762 | 226 |
| 233 | 3300025912 | Ga0207707_10007135 | Ga0207707_1000713511 | 226 |
| 234 | 3300025913 | Ga0207695_10000770 | Ga0207695_1000077057 | 226 |
| 235 | 3300025913 | Ga0207695_10009314 | Ga0207695_1000931412 | 226 |
| 236 | 3300025913 | Ga0207695_10022417 | Ga0207695_100224177 | 226 |
| 237 | 3300025914 | Ga0207671_10052811 | Ga0207671_100528115 | 226 |
| 238 | 3300025917 | Ga0207660_10024188 | Ga0207660_100241883 | 226 |
| 239 | 3300025919 | Ga0207657_10007163 | Ga0207657_100071637 | 226 |
| 240 | 3300025919 | Ga0207657_10189272 | Ga0207657_101892722 | 226 |
| 241 | 3300025919 | Ga0207657_10272031 | Ga0207657_102720311 | 226 |
| 242 | 3300025919 | Ga0207657_10375153 | Ga0207657_103751532 | 226 |
| 243 | 3300025920 | Ga0207649_10274898 | Ga0207649_102748981 | 226 |
| 244 | 3300025921 | Ga0207652_10226187 | Ga0207652_102261872 | 226 |
| 245 | 3300025924 | Ga0207694_10002138 | Ga0207694_1000213813 | 226 |
| 246 | 3300025924 | Ga0207694_10229364 | Ga0207694_102293642 | 226 |
| 247 | 3300025924 | Ga0207694_10342537 | Ga0207694_103425372 | 226 |
| 248 | 3300025927 | Ga0207687_10009834 | Ga0207687_100098345 | 226 |
| 249 | 3300025927 | Ga0207687_10012877 | Ga0207687_100128772 | 226 |
| 250 | 3300025927 | Ga0207687_10017133 | Ga0207687_100171332 | 226 |
| 251 | 3300025927 | Ga0207687_10043361 | Ga0207687_100433614 | 226 |
| 252 | 3300025927 | Ga0207687_10044347 | Ga0207687_100443472 | 226 |
| 253 | 3300025931 | Ga0207644_10299670 | Ga0207644_102996702 | 226 |
| 254 | 3300025933 | Ga0207706_10038266 | Ga0207706_100382666 | 226 |
| 255 | 3300025934 | Ga0207686_10002620 | Ga0207686_100026209 | 226 |
| 256 | 3300025934 | Ga0207686_10005323 | Ga0207686_100053233 | 226 |
| 257 | 3300025934 | Ga0207686_10026810 | Ga0207686_100268103 | 226 |
| 258 | 3300025934 | Ga0207686_10159472 | Ga0207686_101594722 | 226 |
| 259 | 3300025938 | Ga0207704_10004043 | Ga0207704_100040434 | 226 |
| 260 | 3300025938 | Ga0207704_10037467 | Ga0207704_100374674 | 226 |
| 261 | 3300025938 | Ga0207704_10675625 | Ga0207704_106756252 | 226 |
| 262 | 3300025941 | Ga0207711_10035068 | Ga0207711_100350685 | 226 |
| 263 | 3300025941 | Ga0207711_10041626 | Ga0207711_100416264 | 226 |
| 264 | 3300025942 | Ga0207689_10014043 | Ga0207689_100140436 | 226 |
| 265 | 3300025942 | Ga0207689_10102033 | Ga0207689_101020333 | 226 |
| 266 | 3300025944 | Ga0207661_10008190 | Ga0207661_100081908 | 226 |
| 267 | 3300025944 | Ga0207661_10020313 | Ga0207661_100203135 | 226 |
| 268 | 3300025944 | Ga0207661_10262626 | Ga0207661_102626262 | 226 |
| 269 | 3300025944 | Ga0207661_10748452 | Ga0207661_107484522 | 226 |
| 270 | 3300025949 | Ga0207667_10001168 | Ga0207667_1000116825 | 226 |
| 271 | 3300025949 | Ga0207667_10008741 | Ga0207667_100087415 | 226 |
| 272 | 3300025949 | Ga0207667_10042580 | Ga0207667_100425807 | 226 |
| 273 | 3300025949 | Ga0207667_10510766 | Ga0207667_105107662 | 226 |
| 274 | 3300025960 | Ga0207651_10346186 | Ga0207651_103461862 | 226 |
| 275 | 3300025986 | Ga0207658_10099024 | Ga0207658_100990242 | 226 |
| 276 | 3300025986 | Ga0207658_10322497 | Ga0207658_103224972 | 226 |
| 277 | 3300026023 | Ga0207677_10020675 | Ga0207677_100206754 | 226 |
| 278 | 3300026023 | Ga0207677_10024690 | Ga0207677_100246902 | 226 |
| 279 | 3300026023 | Ga0207677_10045166 | Ga0207677_100451664 | 226 |
| 280 | 3300026023 | Ga0207677_10224425 | Ga0207677_102244253 | 226 |
| 281 | 3300026023 | Ga0207677_10390078 | Ga0207677_103900782 | 226 |
| 282 | 3300026035 | Ga0207703_10009334 | Ga0207703_100093346 | 226 |
| 283 | 3300026035 | Ga0207703_10188296 | Ga0207703_101882962 | 226 |
| 284 | 3300026041 | Ga0207639_10065998 | Ga0207639_100659983 | 226 |
| 285 | 3300026041 | Ga0207639_10081396 | Ga0207639_100813962 | 226 |
| 286 | 3300026078 | Ga0207702_10109563 | Ga0207702_101095633 | 226 |
| 287 | 3300026078 | Ga0207702_10127641 | Ga0207702_101276413 | 226 |
| 288 | 3300026078 | Ga0207702_10173930 | Ga0207702_101739303 | 226 |
| 289 | 3300026078 | Ga0207702_10302100 | Ga0207702_103021003 | 226 |
| 290 | 3300026078 | Ga0207702_10789114 | Ga0207702_107891141 | 226 |
| 291 | 3300026088 | Ga0207641_10045937 | Ga0207641_100459375 | 226 |
| 292 | 3300026089 | Ga0207648_10010408 | Ga0207648_1001040810 | 226 |
| 293 | 3300026089 | Ga0207648_10202789 | Ga0207648_102027892 | 226 |
| 294 | 3300026089 | Ga0207648_10289922 | Ga0207648_102899222 | 226 |
| 295 | 3300026095 | Ga0207676_10027727 | Ga0207676_100277272 | 226 |
| 296 | 3300026116 | Ga0207674_10000166 | Ga0207674_1000016665 | 226 |
| 297 | 3300026116 | Ga0207674_10039163 | Ga0207674_100391633 | 226 |
| 298 | 3300026116 | Ga0207674_10066179 | Ga0207674_100661792 | 226 |
| 299 | 3300026121 | Ga0207683_10196763 | Ga0207683_101967632 | 226 |
| 300 | 3300026142 | Ga0207698_10038899 | Ga0207698_100388993 | 226 |
| 301 | 3300026142 | Ga0207698_10044678 | Ga0207698_100446782 | 226 |
| 302 | 3300026142 | Ga0207698_10736825 | Ga0207698_107368251 | 226 |
| 303 | 3300028379 | Ga0268266_10064329 | Ga0268266_100643294 | 226 |
| 304 | 3300028381 | Ga0268264_10009037 | Ga0268264_100090378 | 226 |
| 305 | 3300035083 | Ga0373926_0007779 | Ga0373926_0007779_2058_2738 | 226 |
| 306 | 3300035111 | Ga0373923_0059873 | Ga0373923_0059873_808_1488 | 226 |
| 307 | 3300035118 | Ga0373954_0001726 | Ga0373954_0001726_2417_3097 | 226 |
| 308 | 3300035118 | Ga0373954_0004906 | Ga0373954_0004906_2378_3058 | 226 |
| 309 | 3300035171 | Ga0373946_0077887 | Ga0373946_0077887_498_1178 | 226 |
| 310 | 3300035692 | Ga0373935_0044795 | Ga0373935_0044795_2058_2738 | 226 |
| 311 | 3300035695 | Ga0373927_0002081 | Ga0373927_0002081_4689_5369 | 226 |
| 312 | 3300035695 | Ga0373927_0221709 | Ga0373927_0221709_234_914 | 226 |
| 313 | 3300035724 | Ga0373933_0191327 | Ga0373933_0191327_206_886 | 226 |
| 314 | 3300035725 | Ga0373947_0001083 | Ga0373947_0001083_5558_6238 | 226 |
| 315 | 3300036401 | Ga0373937_0005609 | Ga0373937_0005609_9841_10521 | 226 |
| 316 | 3300036401 | Ga0373937_0089365 | Ga0373937_0089365_123_803 | 226 |
| 317 | 3300037068 | Ga0373925_0000281 | Ga0373925_0000281_34326_35006 | 226 |
| 318 | 3300037471 | Ga0395905_0496945 | Ga0395905_0496945_199_891 | 226 |
| 319 | 3300037853 | Ga0436364_0563134 | Ga0436364_0563134_478_1179 | 226 |
| 320 | 3300037853 | Ga0436364_1175742 | Ga0436364_1175742_62_763 | 226 |
| 321 | 3300039437 | Ga0436365_0082593 | Ga0436365_0082593_2437_3138 | 226 |
| 322 | 3300039437 | Ga0436365_0574543 | Ga0436365_0574543_494_1183 | 226 |
| 323 | 3300039437 | Ga0436365_0650674 | Ga0436365_0650674_1262_1951 | 226 |
| 324 | 3300039437 | Ga0436365_0749264 | Ga0436365_0749264_145_846 | 226 |
| 325 | 3300039453 | Ga0436362_0890342 | Ga0436362_0890342_3534_4235 | 226 |
| 326 | 3300046514 | Ga0495618_0505648 | Ga0495618_0505648_34_714 | 226 |
| 327 | 3300046536 | Ga0495587_0209528 | Ga0495587_0209528_119_799 | 226 |
| 328 | 3300046558 | Ga0495633_0292861 | Ga0495633_0292861_44_724 | 226 |
| 329 | 3300046690 | Ga0495624_0039485 | Ga0495624_0039485_889_1569 | 226 |
| 330 | 3300047444 | Ga0495675_0258551 | Ga0495675_0258551_291_971 | 226 |
| 331 | 3300047673 | Ga0495593_0319352 | Ga0495593_0319352_52_732 | 226 |
| 332 | 3300048918 | Ga0496115_0439781 | Ga0496115_0439781_77_757 | 226 |
| 333 | 3300049568 | Ga0501031_0002010 | Ga0501031_0002010_256_936 | 226 |
| 334 | 3300049569 | Ga0501032_0001366 | Ga0501032_0001366_7555_8235 | 226 |
| 335 | 3300049570 | Ga0501033_0015134 | Ga0501033_0015134_3918_4598 | 226 |
| 336 | 3300049571 | Ga0501034_0026807 | Ga0501034_0026807_2549_3229 | 226 |
| 337 | 3300049571 | Ga0501034_0095298 | Ga0501034_0095298_1085_1771 | 226 |
| 338 | 3300049572 | Ga0501036_0001154 | Ga0501036_0001154_8499_9179 | 226 |
| 339 | 3300049573 | Ga0501037_0005354 | Ga0501037_0005354_1256_1936 | 226 |
| 340 | 3300049574 | Ga0501038_0000838 | Ga0501038_0000838_18740_19420 | 226 |
| 341 | 3300049575 | Ga0501039_0005534 | Ga0501039_0005534_8732_9412 | 226 |
| 342 | 3300049579 | Ga0501043_0042298 | Ga0501043_0042298_352_1032 | 226 |
| 343 | 3300049580 | Ga0501046_0002291 | Ga0501046_0002291_1192_1872 | 226 |
| 344 | 3300049581 | Ga0501047_0402488 | Ga0501047_0402488_224_904 | 226 |
| 345 | 3300049582 | Ga0501048_0026632 | Ga0501048_0026632_3177_3857 | 226 |
| 346 | 3300049583 | Ga0501067_0034591 | Ga0501067_0034591_1193_1873 | 226 |
| 347 | 3300049584 | Ga0501068_0001809 | Ga0501068_0001809_2731_3411 | 226 |
| 348 | 3300049585 | Ga0501069_0000403 | Ga0501069_0000403_18772_19452 | 226 |
| 349 | 3300049586 | Ga0501070_0091243 | Ga0501070_0091243_1038_1718 | 226 |
| 350 | 3300049588 | Ga0501072_0003019 | Ga0501072_0003019_2549_3229 | 226 |
| 351 | 3300049589 | Ga0501073_0001367 | Ga0501073_0001367_3434_4114 | 226 |
| 352 | 3300049590 | Ga0501074_0103262 | Ga0501074_0103262_1193_1873 | 226 |
| 353 | 3300049592 | Ga0501076_0131416 | Ga0501076_0131416_1096_1776 | 226 |
| 354 | 3300049593 | Ga0501077_0018748 | Ga0501077_0018748_3088_3768 | 226 |
| 355 | 3300049741 | Ga0501079_0108992 | Ga0501079_0108992_343_1023 | 226 |
| 356 | 3300049742 | Ga0501080_0000243 | Ga0501080_0000243_17355_18035 | 226 |
| 357 | 3300049744 | Ga0501083_0004506 | Ga0501083_0004506_3790_4470 | 226 |
| 358 | 3300049822 | Ga0501035_0132437 | Ga0501035_0132437_1256_1936 | 226 |
| 359 | 3300049824 | Ga0501045_0053881 | Ga0501045_0053881_2125_2805 | 226 |
| 360 | 3300054114 | Ga0501084_0000227 | Ga0501084_0000227_35593_36273 | 226 |
| 361 | 3300060353 | Ga0501082_0078605 | Ga0501082_0078605_1038_1718 | 226 |
| 362 | 3300005577 | Ga0068857_100009431 | Ga0068857_1000094315 | 227 |
| 363 | 3300005617 | Ga0068859_100942521 | Ga0068859_1009425211 | 227 |
| 364 | 3300006931 | Ga0097620_100942620 | Ga0097620_1009426201 | 227 |
| 365 | 3300013296 | Ga0157374_10698469 | Ga0157374_106984692 | 227 |
| 366 | 3300013306 | Ga0163162_10163966 | Ga0163162_101639663 | 227 |
| 367 | 3300014969 | Ga0157376_10366577 | Ga0157376_103665773 | 227 |
| 368 | 3300021388 | Ga0213875_10002769 | Ga0213875_100027699 | 227 |
| 369 | 3300025912 | Ga0207707_10024481 | Ga0207707_100244815 | 227 |
| 370 | 3300026116 | Ga0207674_10039333 | Ga0207674_100393332 | 227 |
| 371 | 3300031238 | Ga0265332_10100977 | Ga0265332_101009772 | 227 |
| 372 | 3300031344 | Ga0265316_10014352 | Ga0265316_100143525 | 227 |
| 373 | 3300031711 | Ga0265314_10000961 | Ga0265314_100009612 | 227 |
| 374 | 3300031711 | Ga0265314_10025644 | Ga0265314_100256442 | 227 |
| 375 | 3300031712 | Ga0265342_10112099 | Ga0265342_101120992 | 227 |
| 376 | 3300035086 | Ga0373934_0042829 | Ga0373934_0042829_1005_1688 | 227 |
| 377 | 3300035111 | Ga0373923_0059867 | Ga0373923_0059867_593_1276 | 227 |
| 378 | 3300035117 | Ga0373953_0076268 | Ga0373953_0076268_434_1117 | 227 |
| 379 | 3300035695 | Ga0373927_0067251 | Ga0373927_0067251_490_1173 | 227 |
| 380 | 3300036401 | Ga0373937_0029245 | Ga0373937_0029245_56_739 | 227 |
| 381 | 3300037853 | Ga0436364_1200519 | Ga0436364_1200519_509_1192 | 227 |
| 382 | 3300037853 | Ga0436364_1294362 | Ga0436364_1294362_509_1192 | 227 |
| 383 | 3300042876 | Ga0451577_0092642 | Ga0451577_0092642_252_947 | 227 |
| 384 | 3300046462 | Ga0495651_0029667 | Ga0495651_0029667_1873_2556 | 227 |
| 385 | 3300046472 | Ga0495580_0011669 | Ga0495580_0011669_4940_5623 | 227 |
| 386 | 3300046477 | Ga0495664_0009577 | Ga0495664_0009577_655_1338 | 227 |
| 387 | 3300046511 | Ga0495608_0296060 | Ga0495608_0296060_49_732 | 227 |
| 388 | 3300046516 | Ga0495628_0003543 | Ga0495628_0003543_9709_10392 | 227 |
| 389 | 3300046526 | Ga0495666_0166694 | Ga0495666_0166694_97_780 | 227 |
| 390 | 3300046543 | Ga0495645_0161581 | Ga0495645_0161581_145_828 | 227 |
| 391 | 3300046678 | Ga0495599_0004028 | Ga0495599_0004028_1536_2219 | 227 |
| 392 | 3300046689 | Ga0495613_0154529 | Ga0495613_0154529_460_1143 | 227 |
| 393 | 3300046689 | Ga0495613_0498708 | Ga0495613_0498708_51_734 | 227 |
| 394 | 3300046809 | Ga0495600_0405158 | Ga0495600_0405158_55_738 | 227 |
| 395 | 3300047319 | Ga0495674_0042721 | Ga0495674_0042721_1735_2418 | 227 |
| 396 | 3300047319 | Ga0495674_0068423 | Ga0495674_0068423_2183_2866 | 227 |
| 397 | 3300047319 | Ga0495674_0098064 | Ga0495674_0098064_241_924 | 227 |
| 398 | 3300047471 | Ga0495684_0048916 | Ga0495684_0048916_798_1481 | 227 |
| 399 | 3300005331 | Ga0070670_100685279 | Ga0070670_1006852791 | 228 |
| 400 | 3300005334 | Ga0068869_100185178 | Ga0068869_1001851783 | 228 |
| 401 | 3300005340 | Ga0070689_100436456 | Ga0070689_1004364562 | 228 |
| 402 | 3300005347 | Ga0070668_100618225 | Ga0070668_1006182252 | 228 |
| 403 | 3300005434 | Ga0070709_10013766 | Ga0070709_100137663 | 228 |
| 404 | 3300005439 | Ga0070711_100275967 | Ga0070711_1002759672 | 228 |
| 405 | 3300005459 | Ga0068867_100157651 | Ga0068867_1001576512 | 228 |
| 406 | 3300005543 | Ga0070672_100471496 | Ga0070672_1004714962 | 228 |
| 407 | 3300005617 | Ga0068859_100111544 | Ga0068859_1001115443 | 228 |
| 408 | 3300005719 | Ga0068861_100573094 | Ga0068861_1005730942 | 228 |
| 409 | 3300005840 | Ga0068870_10125067 | Ga0068870_101250672 | 228 |
| 410 | 3300005843 | Ga0068860_100142529 | Ga0068860_1001425293 | 228 |
| 411 | 3300006881 | Ga0068865_100691181 | Ga0068865_1006911811 | 228 |
| 412 | 3300006931 | Ga0097620_100111550 | Ga0097620_1001115503 | 228 |
| 413 | 3300009098 | Ga0105245_11286153 | Ga0105245_112861531 | 228 |
| 414 | 3300009176 | Ga0105242_10079340 | Ga0105242_100793402 | 228 |
| 415 | 3300009176 | Ga0105242_10292633 | Ga0105242_102926332 | 228 |
| 416 | 3300009177 | Ga0105248_10021914 | Ga0105248_100219145 | 228 |
| 417 | 3300009551 | Ga0105238_10053529 | Ga0105238_100535294 | 228 |
| 418 | 3300009553 | Ga0105249_10095589 | Ga0105249_100955892 | 228 |
| 419 | 3300011119 | Ga0105246_10031037 | Ga0105246_100310372 | 228 |
| 420 | 3300011119 | Ga0105246_10050745 | Ga0105246_100507454 | 228 |
| 421 | 3300013308 | Ga0157375_10818435 | Ga0157375_108184352 | 228 |
| 422 | 3300013308 | Ga0157375_11006324 | Ga0157375_110063241 | 228 |
| 423 | 3300014968 | Ga0157379_10234516 | Ga0157379_102345161 | 228 |
| 424 | 3300014969 | Ga0157376_10040256 | Ga0157376_100402564 | 228 |
| 425 | 3300014969 | Ga0157376_10477134 | Ga0157376_104771341 | 228 |
| 426 | 3300025908 | Ga0207643_10080686 | Ga0207643_100806863 | 228 |
| 427 | 3300025916 | Ga0207663_10097969 | Ga0207663_100979693 | 228 |
| 428 | 3300025924 | Ga0207694_10011929 | Ga0207694_100119297 | 228 |
| 429 | 3300025927 | Ga0207687_10020360 | Ga0207687_100203602 | 228 |
| 430 | 3300025928 | Ga0207700_10006899 | Ga0207700_100068991 | 228 |
| 431 | 3300025934 | Ga0207686_10109888 | Ga0207686_101098881 | 228 |
| 432 | 3300025934 | Ga0207686_10146335 | Ga0207686_101463352 | 228 |
| 433 | 3300025936 | Ga0207670_10322052 | Ga0207670_103220522 | 228 |
| 434 | 3300025940 | Ga0207691_10381312 | Ga0207691_103813122 | 228 |
| 435 | 3300025942 | Ga0207689_10210099 | Ga0207689_102100992 | 228 |
| 436 | 3300025960 | Ga0207651_10087711 | Ga0207651_100877112 | 228 |
| 437 | 3300025961 | Ga0207712_10233096 | Ga0207712_102330962 | 228 |
| 438 | 3300025972 | Ga0207668_10614417 | Ga0207668_106144172 | 228 |
| 439 | 3300026035 | Ga0207703_10039496 | Ga0207703_100394962 | 228 |
| 440 | 3300026035 | Ga0207703_10179248 | Ga0207703_101792482 | 228 |
| 441 | 3300028381 | Ga0268264_10108185 | Ga0268264_101081852 | 228 |
| 442 | 3300031711 | Ga0265314_10205104 | Ga0265314_102051042 | 228 |
| 443 | 3300035086 | Ga0373934_0106527 | Ga0373934_0106527_11_703 | 228 |
| 444 | 3300035086 | Ga0373934_0130018 | Ga0373934_0130018_282_980 | 228 |
| 445 | 3300035172 | Ga0373955_0134995 | Ga0373955_0134995_661_1359 | 228 |
| 446 | 3300036401 | Ga0373937_0013197 | Ga0373937_0013197_484_1176 | 228 |
| 447 | 3300036401 | Ga0373937_0206227 | Ga0373937_0206227_612_1310 | 228 |
| 448 | 3300039437 | Ga0436365_1565054 | Ga0436365_1565054_1230_1925 | 228 |
| 449 | 3300039450 | Ga0436363_0960435 | Ga0436363_0960435_55_744 | 228 |
| 450 | 3300039453 | Ga0436362_1195420 | Ga0436362_1195420_51_746 | 228 |
| 451 | 3300046473 | Ga0495582_0024457 | Ga0495582_0024457_16_708 | 228 |
| 452 | 3300046526 | Ga0495666_0127321 | Ga0495666_0127321_74_766 | 228 |
| 453 | 3300046642 | Ga0495634_0378321 | Ga0495634_0378321_60_758 | 228 |
| 454 | 3300046663 | Ga0495635_0110370 | Ga0495635_0110370_1003_1701 | 228 |
| 455 | 3300046683 | Ga0495658_0036949 | Ga0495658_0036949_1759_2451 | 228 |
| 456 | 3300046689 | Ga0495613_0115355 | Ga0495613_0115355_687_1385 | 228 |
| 457 | 3300047319 | Ga0495674_0069537 | Ga0495674_0069537_499_1197 | 228 |
| 458 | 3300047471 | Ga0495684_0165858 | Ga0495684_0165858_289_987 | 228 |
| 459 | 3300049576 | Ga0501040_0661289 | Ga0501040_0661289_32_718 | 228 |
| 460 | 3300005435 | Ga0070714_100035658 | Ga0070714_1000356586 | 229 |
| 461 | 3300005436 | Ga0070713_100015164 | Ga0070713_1000151646 | 229 |
| 462 | 3300005439 | Ga0070711_100166546 | Ga0070711_1001665463 | 229 |
| 463 | 3300006028 | Ga0070717_10080521 | Ga0070717_100805213 | 229 |
| 464 | 3300006175 | Ga0070712_100151740 | Ga0070712_1001517402 | 229 |
| 465 | 3300009177 | Ga0105248_10621572 | Ga0105248_106215722 | 229 |
| 466 | 3300025915 | Ga0207693_10103616 | Ga0207693_101036163 | 229 |
| 467 | 3300025916 | Ga0207663_10648455 | Ga0207663_106484551 | 229 |
| 468 | 3300025929 | Ga0207664_10027284 | Ga0207664_100272846 | 229 |
| 469 | 3300026078 | Ga0207702_10256141 | Ga0207702_102561412 | 229 |
| 470 | 3300035695 | Ga0373927_0157975 | Ga0373927_0157975_84_779 | 229 |
| 471 | 3300035724 | Ga0373933_0024764 | Ga0373933_0024764_2114_2809 | 229 |
| 472 | 3300036401 | Ga0373937_0017647 | Ga0373937_0017647_3566_4261 | 229 |
| 473 | 3300044712 | Ga0453684_0616020 | Ga0453684_0616020_84_803 | 229 |
| 474 | 3300005340 | Ga0070689_100252999 | Ga0070689_1002529992 | 230 |
| 475 | 3300005344 | Ga0070661_100070988 | Ga0070661_1000709882 | 230 |
| 476 | 3300005366 | Ga0070659_100068616 | Ga0070659_1000686162 | 230 |
| 477 | 3300005436 | Ga0070713_100011179 | Ga0070713_1000111794 | 230 |
| 478 | 3300005456 | Ga0070678_100029205 | Ga0070678_1000292053 | 230 |
| 479 | 3300005458 | Ga0070681_10278669 | Ga0070681_102786692 | 230 |
| 480 | 3300005563 | Ga0068855_100232828 | Ga0068855_1002328281 | 230 |
| 481 | 3300005564 | Ga0070664_100099430 | Ga0070664_1000994302 | 230 |
| 482 | 3300005614 | Ga0068856_100039198 | Ga0068856_1000391982 | 230 |
| 483 | 3300006028 | Ga0070717_10132371 | Ga0070717_101323713 | 230 |
| 484 | 3300010375 | Ga0105239_10913614 | Ga0105239_109136142 | 230 |
| 485 | 3300013105 | Ga0157369_10001658 | Ga0157369_1000165818 | 230 |
| 486 | 3300013105 | Ga0157369_10258418 | Ga0157369_102584182 | 230 |
| 487 | 3300013105 | Ga0157369_10762999 | Ga0157369_107629991 | 230 |
| 488 | 3300013296 | Ga0157374_10013377 | Ga0157374_100133774 | 230 |
| 489 | 3300013297 | Ga0157378_10528588 | Ga0157378_105285881 | 230 |
| 490 | 3300013307 | Ga0157372_10119612 | Ga0157372_101196123 | 230 |
| 491 | 3300013307 | Ga0157372_10177581 | Ga0157372_101775812 | 230 |
| 492 | 3300014969 | Ga0157376_10298322 | Ga0157376_102983222 | 230 |
| 493 | 3300025934 | Ga0207686_10262465 | Ga0207686_102624652 | 230 |
| 494 | 3300025936 | Ga0207670_10219669 | Ga0207670_102196692 | 230 |
| 495 | 3300025949 | Ga0207667_10122473 | Ga0207667_101224732 | 230 |
| 496 | 3300025949 | Ga0207667_10163410 | Ga0207667_101634103 | 230 |
| 497 | 3300026078 | Ga0207702_10114177 | Ga0207702_101141772 | 230 |
| 498 | 3300026121 | Ga0207683_10092532 | Ga0207683_100925322 | 230 |
| 499 | 3300049581 | Ga0501047_0098218 | Ga0501047_0098218_321_1013 | 230 |
| 500 | 3300049822 | Ga0501035_0298501 | Ga0501035_0298501_119_811 | 230 |
| 501 | 3300049823 | Ga0501044_0001257 | Ga0501044_0001257_5508_6200 | 230 |
| 502 | 3300005329 | Ga0070683_100058234 | Ga0070683_1000582342 | 231 |
| 503 | 3300005355 | Ga0070671_100827823 | Ga0070671_1008278231 | 231 |
| 504 | 3300005364 | Ga0070673_100336184 | Ga0070673_1003361842 | 231 |
| 505 | 3300005445 | Ga0070708_100558281 | Ga0070708_1005582811 | 231 |
| 506 | 3300005530 | Ga0070679_100512726 | Ga0070679_1005127261 | 231 |
| 507 | 3300005548 | Ga0070665_100078224 | Ga0070665_1000782245 | 231 |
| 508 | 3300005618 | Ga0068864_100185073 | Ga0068864_1001850732 | 231 |
| 509 | 3300005843 | Ga0068860_100563834 | Ga0068860_1005638342 | 231 |
| 510 | 3300006358 | Ga0068871_100359031 | Ga0068871_1003590312 | 231 |
| 511 | 3300006358 | Ga0068871_100852967 | Ga0068871_1008529671 | 231 |
| 512 | 3300006881 | Ga0068865_100274378 | Ga0068865_1002743782 | 231 |
| 513 | 3300009093 | Ga0105240_10006267 | Ga0105240_1000626711 | 231 |
| 514 | 3300009093 | Ga0105240_10089673 | Ga0105240_100896733 | 231 |
| 515 | 3300009093 | Ga0105240_10313188 | Ga0105240_103131882 | 231 |
| 516 | 3300009093 | Ga0105240_10314740 | Ga0105240_103147403 | 231 |
| 517 | 3300009098 | Ga0105245_10049711 | Ga0105245_100497114 | 231 |
| 518 | 3300009098 | Ga0105245_10804944 | Ga0105245_108049441 | 231 |
| 519 | 3300009177 | Ga0105248_10098471 | Ga0105248_100984712 | 231 |
| 520 | 3300009177 | Ga0105248_10124733 | Ga0105248_101247332 | 231 |
| 521 | 3300009177 | Ga0105248_10955329 | Ga0105248_109553291 | 231 |
| 522 | 3300009545 | Ga0105237_10015643 | Ga0105237_100156432 | 231 |
| 523 | 3300010375 | Ga0105239_10306404 | Ga0105239_103064043 | 231 |
| 524 | 3300013306 | Ga0163162_10822549 | Ga0163162_108225492 | 231 |
| 525 | 3300013308 | Ga0157375_10534948 | Ga0157375_105349482 | 231 |
| 526 | 3300014969 | Ga0157376_10615948 | Ga0157376_106159482 | 231 |
| 527 | 3300025913 | Ga0207695_10012024 | Ga0207695_100120245 | 231 |
| 528 | 3300025913 | Ga0207695_10051958 | Ga0207695_100519585 | 231 |
| 529 | 3300025913 | Ga0207695_10256765 | Ga0207695_102567652 | 231 |
| 530 | 3300025914 | Ga0207671_10108868 | Ga0207671_101088682 | 231 |
| 531 | 3300025916 | Ga0207663_10150776 | Ga0207663_101507762 | 231 |
| 532 | 3300025927 | Ga0207687_10419155 | Ga0207687_104191551 | 231 |
| 533 | 3300025941 | Ga0207711_10057465 | Ga0207711_100574653 | 231 |
| 534 | 3300025944 | Ga0207661_10151759 | Ga0207661_101517592 | 231 |
| 535 | 3300028379 | Ga0268266_10356035 | Ga0268266_103560352 | 231 |
| 536 | 3300028653 | Ga0265323_10001994 | Ga0265323_100019948 | 231 |
| 537 | 3300031235 | Ga0265330_10059710 | Ga0265330_100597101 | 231 |
| 538 | 3300035117 | Ga0373953_0025325 | Ga0373953_0025325_1223_1918 | 231 |
| 539 | 3300035119 | Ga0373956_0091373 | Ga0373956_0091373_61_756 | 231 |
| 540 | 3300035120 | Ga0373957_0057038 | Ga0373957_0057038_288_983 | 231 |
| 541 | 3300035172 | Ga0373955_0082222 | Ga0373955_0082222_543_1238 | 231 |
| 542 | 3300036401 | Ga0373937_0084305 | Ga0373937_0084305_231_926 | 231 |
| 543 | 3300046472 | Ga0495580_0136585 | Ga0495580_0136585_506_1201 | 231 |
| 544 | 3300046526 | Ga0495666_0243213 | Ga0495666_0243213_60_755 | 231 |
| 545 | 3300046559 | Ga0495667_0225505 | Ga0495667_0225505_129_824 | 231 |
| 546 | 3300048907 | Ga0496104_0791158 | Ga0496104_0791158_116_811 | 231 |
| 547 | 3300005617 | Ga0068859_100502784 | Ga0068859_1005027842 | 232 |
| 548 | 3300006028 | Ga0070717_10013526 | Ga0070717_100135267 | 232 |
| 549 | 3300006846 | Ga0075430_100004116 | Ga0075430_10000411613 | 232 |
| 550 | 3300006846 | Ga0075430_100549595 | Ga0075430_1005495952 | 232 |
| 551 | 3300006931 | Ga0097620_100502784 | Ga0097620_1005027843 | 232 |
| 552 | 3300013308 | Ga0157375_11182723 | Ga0157375_111827232 | 232 |
| 553 | 3300014325 | Ga0163163_10084857 | Ga0163163_100848573 | 232 |
| 554 | 3300025927 | Ga0207687_10459244 | Ga0207687_104592442 | 232 |
| 555 | 3300028800 | Ga0265338_10099579 | Ga0265338_100995793 | 232 |
| 556 | 3300029957 | Ga0265324_10035251 | Ga0265324_100352513 | 232 |
| 557 | 3300031239 | Ga0265328_10047867 | Ga0265328_100478672 | 232 |
| 558 | 3300031240 | Ga0265320_10001179 | Ga0265320_100011794 | 232 |
| 559 | 3300031241 | Ga0265325_10073697 | Ga0265325_100736972 | 232 |
| 560 | 3300031247 | Ga0265340_10018603 | Ga0265340_100186032 | 232 |
| 561 | 3300031249 | Ga0265339_10024191 | Ga0265339_100241913 | 232 |
| 562 | 3300031250 | Ga0265331_10134913 | Ga0265331_101349131 | 232 |
| 563 | 3300031344 | Ga0265316_10001368 | Ga0265316_1000136822 | 232 |
| 564 | 3300031344 | Ga0265316_10004197 | Ga0265316_1000419712 | 232 |
| 565 | 3300031344 | Ga0265316_10008612 | Ga0265316_100086124 | 232 |
| 566 | 3300031344 | Ga0265316_10013572 | Ga0265316_100135722 | 232 |
| 567 | 3300031344 | Ga0265316_10015903 | Ga0265316_100159034 | 232 |
| 568 | 3300031344 | Ga0265316_10226197 | Ga0265316_102261971 | 232 |
| 569 | 3300031711 | Ga0265314_10011367 | Ga0265314_100113674 | 232 |
| 570 | 3300031711 | Ga0265314_10111058 | Ga0265314_101110582 | 232 |
| 571 | 3300031712 | Ga0265342_10125986 | Ga0265342_101259862 | 232 |
| 572 | 3300035691 | Ga0373931_0310722 | Ga0373931_0310722_179_877 | 232 |
| 573 | 3300050509 | nmdc:mga0qj67_510669_c1 | nmdc:mga0qj67_510669_c1_198_896 | 232 |
| 574 | 3300060353 | Ga0501082_0000199 | Ga0501082_0000199_29387_30085 | 232 |
| 575 | 3300005518 | Ga0070699_100069549 | Ga0070699_1000695492 | 233 |
| 576 | 3300005543 | Ga0070672_100154173 | Ga0070672_1001541732 | 233 |
| 577 | 3300005563 | Ga0068855_100092641 | Ga0068855_1000926415 | 233 |
| 578 | 3300005616 | Ga0068852_100365620 | Ga0068852_1003656202 | 233 |
| 579 | 3300009551 | Ga0105238_10492204 | Ga0105238_104922042 | 233 |
| 580 | 3300014325 | Ga0163163_10115921 | Ga0163163_101159212 | 233 |
| 581 | 3300014969 | Ga0157376_10327085 | Ga0157376_103270852 | 233 |
| 582 | 3300021358 | Ga0213873_10028021 | Ga0213873_100280212 | 233 |
| 583 | 3300021361 | Ga0213872_10000337 | Ga0213872_1000033721 | 233 |
| 584 | 3300021384 | Ga0213876_10142792 | Ga0213876_101427922 | 233 |
| 585 | 3300025909 | Ga0207705_10253061 | Ga0207705_102530612 | 233 |
| 586 | 3300025949 | Ga0207667_10080063 | Ga0207667_100800635 | 233 |
| 587 | 3300026078 | Ga0207702_10266649 | Ga0207702_102666492 | 233 |
| 588 | 3300026142 | Ga0207698_10156504 | Ga0207698_101565042 | 233 |
| 589 | 3300035170 | Ga0373943_0044678 | Ga0373943_0044678_568_1272 | 233 |
| 590 | 3300035692 | Ga0373935_0011987 | Ga0373935_0011987_1609_2313 | 233 |
| 591 | 3300035725 | Ga0373947_0021389 | Ga0373947_0021389_1980_2684 | 233 |
| 592 | 3300037068 | Ga0373925_0197725 | Ga0373925_0197725_404_1108 | 233 |
| 593 | 3300037853 | Ga0436364_0319084 | Ga0436364_0319084_3292_3993 | 233 |
| 594 | 3300037853 | Ga0436364_0699166 | Ga0436364_0699166_137_844 | 233 |
| 595 | 3300039437 | Ga0436365_0810573 | Ga0436365_0810573_4105_4815 | 233 |
| 596 | 3300039447 | Ga0436361_0793152 | Ga0436361_0793152_8472_9185 | 233 |
| 597 | 3300039453 | Ga0436362_0139354 | Ga0436362_0139354_4277_4987 | 233 |
| 598 | 3300044712 | Ga0453684_0246527 | Ga0453684_0246527_20_721 | 233 |
| 599 | 3300045976 | Ga0466967_0265592 | Ga0466967_0265592_594_1295 | 233 |
| 600 | 3300046472 | Ga0495580_0011536 | Ga0495580_0011536_1014_1715 | 233 |
| 601 | 3300046472 | Ga0495580_0013676 | Ga0495580_0013676_3579_4280 | 233 |
| 602 | 3300046511 | Ga0495608_0419503 | Ga0495608_0419503_50_751 | 233 |
| 603 | 3300046529 | Ga0495652_0351008 | Ga0495652_0351008_209_910 | 233 |
| 604 | 3300046531 | Ga0495665_0033307 | Ga0495665_0033307_595_1296 | 233 |
| 605 | 3300046531 | Ga0495665_0199065 | Ga0495665_0199065_203_904 | 233 |
| 606 | 3300046559 | Ga0495667_0051911 | Ga0495667_0051911_1309_2010 | 233 |
| 607 | 3300047317 | Ga0495604_0094000 | Ga0495604_0094000_779_1480 | 233 |
| 608 | 3300047444 | Ga0495675_0115170 | Ga0495675_0115170_587_1288 | 233 |
| 609 | 3300048088 | Ga0495602_0317269 | Ga0495602_0317269_384_1085 | 233 |
| 610 | 3300050510 | nmdc:mga06r32_7934_c1 | nmdc:mga06r32_7934_c1_8380_9081 | 233 |
| 611 | 3300005327 | Ga0070658_10001950 | Ga0070658_1000195013 | 234 |
| 612 | 3300005329 | Ga0070683_100000019 | Ga0070683_10000001953 | 234 |
| 613 | 3300005329 | Ga0070683_100131383 | Ga0070683_1001313832 | 234 |
| 614 | 3300005329 | Ga0070683_100408800 | Ga0070683_1004088002 | 234 |
| 615 | 3300005336 | Ga0070680_100224222 | Ga0070680_1002242222 | 234 |
| 616 | 3300005337 | Ga0070682_100054565 | Ga0070682_1000545653 | 234 |
| 617 | 3300005339 | Ga0070660_100260748 | Ga0070660_1002607482 | 234 |
| 618 | 3300005367 | Ga0070667_100159141 | Ga0070667_1001591412 | 234 |
| 619 | 3300005455 | Ga0070663_100043729 | Ga0070663_1000437293 | 234 |
| 620 | 3300005458 | Ga0070681_10039248 | Ga0070681_100392482 | 234 |
| 621 | 3300005518 | Ga0070699_100170336 | Ga0070699_1001703362 | 234 |
| 622 | 3300005530 | Ga0070679_100029497 | Ga0070679_1000294972 | 234 |
| 623 | 3300005535 | Ga0070684_100000003 | Ga0070684_100000003111 | 234 |
| 624 | 3300005563 | Ga0068855_100122286 | Ga0068855_1001222862 | 234 |
| 625 | 3300005563 | Ga0068855_100482082 | Ga0068855_1004820822 | 234 |
| 626 | 3300005577 | Ga0068857_100190026 | Ga0068857_1001900262 | 234 |
| 627 | 3300005614 | Ga0068856_100017001 | Ga0068856_1000170012 | 234 |
| 628 | 3300005617 | Ga0068859_100811833 | Ga0068859_1008118332 | 234 |
| 629 | 3300005618 | Ga0068864_100238417 | Ga0068864_1002384172 | 234 |
| 630 | 3300005841 | Ga0068863_100208467 | Ga0068863_1002084672 | 234 |
| 631 | 3300006852 | Ga0075433_10265231 | Ga0075433_102652312 | 234 |
| 632 | 3300006931 | Ga0097620_100811800 | Ga0097620_1008118002 | 234 |
| 633 | 3300009093 | Ga0105240_10320558 | Ga0105240_103205582 | 234 |
| 634 | 3300009093 | Ga0105240_10341934 | Ga0105240_103419343 | 234 |
| 635 | 3300009177 | Ga0105248_10084076 | Ga0105248_100840762 | 234 |
| 636 | 3300009177 | Ga0105248_10667654 | Ga0105248_106676542 | 234 |
| 637 | 3300009553 | Ga0105249_10006424 | Ga0105249_100064245 | 234 |
| 638 | 3300013102 | Ga0157371_10249358 | Ga0157371_102493582 | 234 |
| 639 | 3300013104 | Ga0157370_10549591 | Ga0157370_105495912 | 234 |
| 640 | 3300013105 | Ga0157369_10042841 | Ga0157369_100428415 | 234 |
| 641 | 3300013105 | Ga0157369_10320995 | Ga0157369_103209952 | 234 |
| 642 | 3300013105 | Ga0157369_10330484 | Ga0157369_103304842 | 234 |
| 643 | 3300013307 | Ga0157372_10014611 | Ga0157372_100146117 | 234 |
| 644 | 3300013307 | Ga0157372_10411308 | Ga0157372_104113082 | 234 |
| 645 | 3300014969 | Ga0157376_10044253 | Ga0157376_100442532 | 234 |
| 646 | 3300021384 | Ga0213876_10001214 | Ga0213876_1000121415 | 234 |
| 647 | 3300021384 | Ga0213876_10074751 | Ga0213876_100747512 | 234 |
| 648 | 3300021384 | Ga0213876_10091139 | Ga0213876_100911392 | 234 |
| 649 | 3300021388 | Ga0213875_10000055 | Ga0213875_1000005575 | 234 |
| 650 | 3300021388 | Ga0213875_10000108 | Ga0213875_1000010872 | 234 |
| 651 | 3300021388 | Ga0213875_10010188 | Ga0213875_100101885 | 234 |
| 652 | 3300021388 | Ga0213875_10015031 | Ga0213875_100150312 | 234 |
| 653 | 3300021388 | Ga0213875_10072622 | Ga0213875_100726222 | 234 |
| 654 | 3300021388 | Ga0213875_10278870 | Ga0213875_102788701 | 234 |
| 655 | 3300025909 | Ga0207705_10057769 | Ga0207705_100577694 | 234 |
| 656 | 3300025912 | Ga0207707_10100588 | Ga0207707_101005882 | 234 |
| 657 | 3300025912 | Ga0207707_10119632 | Ga0207707_101196322 | 234 |
| 658 | 3300025913 | Ga0207695_10005525 | Ga0207695_1000552512 | 234 |
| 659 | 3300025913 | Ga0207695_10478877 | Ga0207695_104788772 | 234 |
| 660 | 3300025917 | Ga0207660_10411795 | Ga0207660_104117952 | 234 |
| 661 | 3300025919 | Ga0207657_10283510 | Ga0207657_102835102 | 234 |
| 662 | 3300025921 | Ga0207652_10119181 | Ga0207652_101191813 | 234 |
| 663 | 3300025936 | Ga0207670_10601007 | Ga0207670_106010072 | 234 |
| 664 | 3300025944 | Ga0207661_10000019 | Ga0207661_10000019107 | 234 |
| 665 | 3300025944 | Ga0207661_10415840 | Ga0207661_104158402 | 234 |
| 666 | 3300025949 | Ga0207667_10100696 | Ga0207667_101006962 | 234 |
| 667 | 3300026067 | Ga0207678_10042953 | Ga0207678_100429533 | 234 |
| 668 | 3300026078 | Ga0207702_10056240 | Ga0207702_100562405 | 234 |
| 669 | 3300026088 | Ga0207641_10021590 | Ga0207641_100215907 | 234 |
| 670 | 3300026095 | Ga0207676_10240478 | Ga0207676_102404782 | 234 |
| 671 | 3300026116 | Ga0207674_10195251 | Ga0207674_101952512 | 234 |
| 672 | 3300028800 | Ga0265338_10175597 | Ga0265338_101755972 | 234 |
| 673 | 3300031344 | Ga0265316_10001444 | Ga0265316_1000144410 | 234 |
| 674 | 3300031344 | Ga0265316_10015592 | Ga0265316_100155927 | 234 |
| 675 | 3300031344 | Ga0265316_10120136 | Ga0265316_101201361 | 234 |
| 676 | 3300035695 | Ga0373927_0361506 | Ga0373927_0361506_241_945 | 234 |
| 677 | 3300036401 | Ga0373937_0196111 | Ga0373937_0196111_699_1466 | 234 |
| 678 | 3300037853 | Ga0436364_0115933 | Ga0436364_0115933_12029_12736 | 234 |
| 679 | 3300037853 | Ga0436364_0134922 | Ga0436364_0134922_65_775 | 234 |
| 680 | 3300037853 | Ga0436364_0148095 | Ga0436364_0148095_2553_3263 | 234 |
| 681 | 3300037853 | Ga0436364_0205975 | Ga0436364_0205975_3430_4143 | 234 |
| 682 | 3300037853 | Ga0436364_0334136 | Ga0436364_0334136_187_909 | 234 |
| 683 | 3300037853 | Ga0436364_0633516 | Ga0436364_0633516_18899_19615 | 234 |
| 684 | 3300037853 | Ga0436364_0755992 | Ga0436364_0755992_2463_3170 | 234 |
| 685 | 3300037853 | Ga0436364_0835808 | Ga0436364_0835808_2175_2888 | 234 |
| 686 | 3300037853 | Ga0436364_0836594 | Ga0436364_0836594_693_1403 | 234 |
| 687 | 3300037853 | Ga0436364_1104632 | Ga0436364_1104632_236_946 | 234 |
| 688 | 3300037853 | Ga0436364_1193035 | Ga0436364_1193035_3445_4152 | 234 |
| 689 | 3300037853 | Ga0436364_1293248 | Ga0436364_1293248_842_1549 | 234 |
| 690 | 3300037853 | Ga0436364_1298937 | Ga0436364_1298937_8081_8785 | 234 |
| 691 | 3300037853 | Ga0436364_1299576 | Ga0436364_1299576_748_1455 | 234 |
| 692 | 3300037853 | Ga0436364_1375522 | Ga0436364_1375522_858_1565 | 234 |
| 693 | 3300038443 | Ga0395901_0203680 | Ga0395901_0203680_475_1179 | 234 |
| 694 | 3300039437 | Ga0436365_0340201 | Ga0436365_0340201_2570_3277 | 234 |
| 695 | 3300039437 | Ga0436365_0461265 | Ga0436365_0461265_906_1613 | 234 |
| 696 | 3300039437 | Ga0436365_0809363 | Ga0436365_0809363_1539_2252 | 234 |
| 697 | 3300039437 | Ga0436365_1178155 | Ga0436365_1178155_530_1240 | 234 |
| 698 | 3300039437 | Ga0436365_1778817 | Ga0436365_1778817_6256_6963 | 234 |
| 699 | 3300039450 | Ga0436363_1405280 | Ga0436363_1405280_139_861 | 234 |
| 700 | 3300039450 | Ga0436363_1437195 | Ga0436363_1437195_672_1388 | 234 |
| 701 | 3300039453 | Ga0436362_0507053 | Ga0436362_0507053_1129_1842 | 234 |
| 702 | 3300045051 | Ga0451576_0065958 | Ga0451576_0065958_1683_2396 | 234 |
| 703 | 3300045051 | Ga0451576_0311321 | Ga0451576_0311321_345_1073 | 234 |
| 704 | 3300046462 | Ga0495651_0002965 | Ga0495651_0002965_1054_1821 | 234 |
| 705 | 3300046472 | Ga0495580_0058744 | Ga0495580_0058744_1787_2491 | 234 |
| 706 | 3300046499 | Ga0495594_0224652 | Ga0495594_0224652_106_810 | 234 |
| 707 | 3300046516 | Ga0495628_0133784 | Ga0495628_0133784_979_1746 | 234 |
| 708 | 3300046559 | Ga0495667_0045667 | Ga0495667_0045667_909_1676 | 234 |
| 709 | 3300046678 | Ga0495599_0050812 | Ga0495599_0050812_660_1427 | 234 |
| 710 | 3300046679 | Ga0495623_0009599 | Ga0495623_0009599_2260_3027 | 234 |
| 711 | 3300046679 | Ga0495623_0098521 | Ga0495623_0098521_797_1564 | 234 |
| 712 | 3300047319 | Ga0495674_0116622 | Ga0495674_0116622_969_1736 | 234 |
| 713 | 3300047319 | Ga0495674_0623856 | Ga0495674_0623856_42_809 | 234 |
| 714 | 3300047444 | Ga0495675_0036019 | Ga0495675_0036019_1160_1927 | 234 |
| 715 | 3300047471 | Ga0495684_0005866 | Ga0495684_0005866_5261_6028 | 234 |
| 716 | 3300048918 | Ga0496115_0209306 | Ga0496115_0209306_366_1070 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5abt-assembly1.cif.gz_A | s.enterica hisa mutant d7n, g102a, v106m, d176a | 0.8965 | 1 | 229 |
| 5a5w-assembly1.cif.gz_A | crystal structure of salmonella enterica hisa d7n d176a with profar | 0.8943 | 1 | 229 |
| 3tdm-assembly2.cif.gz_C | computationally designed tim-barrel protein, halfflr | 0.8907 | 122 | 219 |
| 5ac6-assembly1.cif.gz_A | s.enterica hisa mutant d10g, dup13-15, q24l, g102a | 0.8896 | 1 | 229 |
| 4x9s-assembly1.cif.gz_A | crystal structure of hisap from streptomyces sp. mg1 | 0.8884 | 2 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9349 | 1 | 229 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9144 | 1 | 226 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9118 | 1 | 229 | 3.20.20.70 |
| af_Q2FUU2_4_232_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9089 | 2 | 216 | 3.20.20.70 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.881 | 1 | 226 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S7SMJ8-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | 0.9921 | 1 | 230 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A838N3U2-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | 0.9914 | 85 | 230 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V8X4V7-F1-model_v4 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | 0.9904 | 108 | 223 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V9U255-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9821 | 124 | 226 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
| AF-A0A2V8GIP3-F1-model_v4 | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 0.9803 | 70 | 226 |
GO:0000105
GO:0000162 GO:0003949 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar