F477065

General Info

Members Datasets Scaffolds Average Seq Length
716 249 716 228

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0196111|Ga0373937_0196111_699_1466
Length 255
Sequence MIVPCIDLMDGKVVQLVQGREKALEGDSPDEMLRKFAAFPEIQVIDLDAALGRGSNDDLVRLIASKAVCRVGGGVRTADRARELLAQGAHRVIVGTSAFTRTGINKDLLSALRDAVGRERLTIALDSKGGRIVVKGWQEDTNFTAEEVLGSLEPYCAGFLCTYVDKEGMMQGTDLDWFRRLRAATSLEITAAGGITTLEDVKALLAMNIDAAVGMAIYTGRLRLEDLAAVRQASRPVSSDLGGRPEHRNRFDLDQ

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
187 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
208 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 0.7
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 6.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10001950 3300005327 Bacteria 17350
2 Ga0070658_10009861 3300005327 Bacteria 7674
3 Ga0070658_10129626 3300005327 Bacteria 2101
4 Ga0070676_10168310 3300005328 Bacteria 1415
5 Ga0070683_100000019 3300005329 Bacteria 192076
6 Ga0070683_100005237 3300005329 Bacteria 10794
7 Ga0070683_100058234 3300005329 Bacteria 3590
8 Ga0070683_100131383 3300005329 Bacteria 2369
9 Ga0070683_100146187 3300005329 Bacteria 2240
10 Ga0070683_100408800 3300005329 Unclassified 1294
11 Ga0070683_100780711 3300005329 Bacteria 915
12 Ga0070690_100309505 3300005330 Bacteria 1135
13 Ga0070670_100685279 3300005331 Bacteria 921
14 Ga0068869_100185178 3300005334 Bacteria 1634
15 Ga0070666_10115154 3300005335 Unclassified 1862
16 Ga0070680_100025498 3300005336 Bacteria 4726
17 Ga0070680_100038958 3300005336 Bacteria 3845
18 Ga0070680_100106992 3300005336 Bacteria 2326
19 Ga0070680_100224222 3300005336 Bacteria 1587
20 Ga0070682_100054565 3300005337 Bacteria 2508
21 Ga0068868_100011009 3300005338 Bacteria 6572
22 Ga0068868_100044941 3300005338 Bacteria 3454
23 Ga0068868_100277237 3300005338 Bacteria 1418
24 Ga0070660_100007244 3300005339 Bacteria 7720
25 Ga0070660_100171655 3300005339 Bacteria 1752
26 Ga0070660_100205510 3300005339 Bacteria 1598
27 Ga0070660_100260748 3300005339 Bacteria 1415
28 Ga0070689_100252999 3300005340 Bacteria 1454
29 Ga0070689_100436456 3300005340 Bacteria 1112
30 Ga0070661_100052822 3300005344 Bacteria 2974
31 Ga0070661_100070988 3300005344 Bacteria 2562
32 Ga0070692_10092230 3300005345 Bacteria 1648
33 Ga0070668_100618225 3300005347 Bacteria 949
34 Ga0070671_100827823 3300005355 Unclassified 807
35 Ga0070674_100281639 3300005356 Bacteria 1318
36 Ga0070674_100627889 3300005356 Bacteria 911
37 Ga0070673_100318278 3300005364 Bacteria 1374
38 Ga0070673_100336184 3300005364 Bacteria 1337
39 Ga0070659_100068616 3300005366 Bacteria 2813
40 Ga0070667_100013784 3300005367 Bacteria 6683
41 Ga0070667_100159141 3300005367 Bacteria 1988
42 Ga0070709_10013766 3300005434 Bacteria 4557
43 Ga0070709_10031530 3300005434 Bacteria 3189
44 Ga0070714_100035658 3300005435 Bacteria 4169
45 Ga0070714_100170607 3300005435 Bacteria 1974
46 Ga0070714_100218646 3300005435 Bacteria 1750
47 Ga0070713_100011179 3300005436 Bacteria 6527
48 Ga0070713_100015164 3300005436 Bacteria 5747
49 Ga0070713_100048723 3300005436 Bacteria 3491
50 Ga0070713_100157774 3300005436 Bacteria 2023
51 Ga0070711_100166546 3300005439 Bacteria 1676
52 Ga0070711_100275967 3300005439 Bacteria 1328
53 Ga0070711_100818460 3300005439 Unclassified 791
54 Ga0070708_100037457 3300005445 Bacteria 4231
55 Ga0070708_100558281 3300005445 Unclassified 1080
56 Ga0070663_100043729 3300005455 Bacteria 3154
57 Ga0070663_100728272 3300005455 Bacteria 845
58 Ga0070678_100029205 3300005456 Bacteria 3773
59 Ga0070681_10022213 3300005458 Bacteria 6368
60 Ga0070681_10039248 3300005458 Bacteria 4747
61 Ga0070681_10278669 3300005458 Bacteria 1583
62 Ga0068867_100157651 3300005459 Bacteria 1788
63 Ga0068867_100208333 3300005459 Bacteria 1569
64 Ga0068867_100480300 3300005459 Bacteria 1065
65 Ga0070707_100434279 3300005468 Bacteria 1273
66 Ga0070699_100069549 3300005518 Bacteria 3059
67 Ga0070699_100170336 3300005518 Unclassified 1929
68 Ga0070699_100709012 3300005518 Bacteria 919
69 Ga0070679_100000635 3300005530 Bacteria 29869
70 Ga0070679_100029497 3300005530 Bacteria 5413
71 Ga0070679_100512726 3300005530 Unclassified 1143
72 Ga0070684_100000003 3300005535 Bacteria 248527
73 Ga0070684_100000654 3300005535 Bacteria 23885
74 Ga0070684_100095009 3300005535 Bacteria 2656
75 Ga0070684_100127399 3300005535 Bacteria 2294
76 Ga0070684_100551658 3300005535 Bacteria 1069
77 Ga0068853_100018364 3300005539 Bacteria 5788
78 Ga0068853_100111936 3300005539 Bacteria 2426
79 Ga0070672_100154173 3300005543 Bacteria 1902
80 Ga0070672_100471496 3300005543 Bacteria 1083
81 Ga0070686_100372070 3300005544 Bacteria 1079
82 Ga0070665_100021507 3300005548 Bacteria 6485
83 Ga0070665_100078224 3300005548 Bacteria 3314
84 Ga0068855_100003676 3300005563 Bacteria 18764
85 Ga0068855_100005921 3300005563 Bacteria 14906
86 Ga0068855_100017587 3300005563 Bacteria 8598
87 Ga0068855_100041567 3300005563 Bacteria 5448
88 Ga0068855_100092641 3300005563 Bacteria 3485
89 Ga0068855_100122286 3300005563 Bacteria 2979
90 Ga0068855_100133575 3300005563 Bacteria 2832
91 Ga0068855_100232828 3300005563 Bacteria 2061
92 Ga0068855_100235759 3300005563 Bacteria 2046
93 Ga0068855_100258952 3300005563 Bacteria 1939
94 Ga0068855_100482082 3300005563 Bacteria 1350
95 Ga0070664_100099430 3300005564 Bacteria 2528
96 Ga0070664_100251199 3300005564 Bacteria 1590
97 Ga0068857_100000367 3300005577 Bacteria 31519
98 Ga0068857_100009431 3300005577 Bacteria 8471
99 Ga0068857_100026136 3300005577 Bacteria 5142
100 Ga0068857_100190026 3300005577 Bacteria 1870
101 Ga0068857_100713242 3300005577 Bacteria 954
102 Ga0068856_100017001 3300005614 Bacteria 7049
103 Ga0068856_100039198 3300005614 Bacteria 4651
104 Ga0068856_100044788 3300005614 Bacteria 4355
105 Ga0068856_100202529 3300005614 Bacteria 1999
106 Ga0068856_100296679 3300005614 Bacteria 1633
107 Ga0068856_100453965 3300005614 Unclassified 1303
108 Ga0068852_100044205 3300005616 Bacteria 3781
109 Ga0068852_100064073 3300005616 Bacteria 3203
110 Ga0068852_100365620 3300005616 Bacteria 1412
111 Ga0068852_100366049 3300005616 Bacteria 1411
112 Ga0068859_100111544 3300005617 Bacteria 2798
113 Ga0068859_100502784 3300005617 Bacteria 1307
114 Ga0068859_100811833 3300005617 Unclassified 1023
115 Ga0068859_100942521 3300005617 Bacteria 947
116 Ga0068864_100185073 3300005618 Bacteria 1906
117 Ga0068864_100215952 3300005618 Bacteria 1768
118 Ga0068864_100238417 3300005618 Bacteria 1685
119 Ga0068861_100573094 3300005719 Unclassified 1032
120 Ga0068870_10125067 3300005840 Bacteria 1486
121 Ga0068863_100032126 3300005841 Bacteria 5005
122 Ga0068863_100208467 3300005841 Bacteria 1881
123 Ga0068858_100200992 3300005842 Unclassified 1884
124 Ga0068858_100233987 3300005842 Bacteria 1742
125 Ga0068860_100008416 3300005843 Bacteria 10275
126 Ga0068860_100142529 3300005843 Bacteria 2304
127 Ga0068860_100260682 3300005843 Bacteria 1690
128 Ga0068860_100563834 3300005843 Bacteria 1142
129 Ga0070717_10013526 3300006028 Bacteria 6258
130 Ga0070717_10080521 3300006028 Bacteria 2733
131 Ga0070717_10132371 3300006028 Bacteria 2146
132 Ga0070712_100151740 3300006175 Bacteria 1780
133 Ga0097621_100014202 3300006237 Bacteria 5955
134 Ga0097621_100018452 3300006237 Bacteria 5329
135 Ga0097621_100090916 3300006237 Bacteria 2555
136 Ga0097621_100110583 3300006237 Bacteria 2321
137 Ga0097621_100122757 3300006237 Unclassified 2205
138 Ga0097621_100307010 3300006237 Unclassified 1403
139 Ga0097621_100508370 3300006237 Bacteria 1092
140 Ga0097621_100884963 3300006237 Bacteria 831
141 Ga0068871_100013047 3300006358 Bacteria 6159
142 Ga0068871_100081163 3300006358 Bacteria 2686
143 Ga0068871_100102752 3300006358 Bacteria 2396
144 Ga0068871_100359031 3300006358 Bacteria 1290
145 Ga0068871_100852967 3300006358 Bacteria 842
146 Ga0075430_100004116 3300006846 Bacteria 12273
147 Ga0075430_100549595 3300006846 Bacteria 952
148 Ga0075433_10265231 3300006852 Unclassified 1522
149 Ga0068865_100144276 3300006881 Bacteria 1799
150 Ga0068865_100222387 3300006881 Bacteria 1477
151 Ga0068865_100274378 3300006881 Bacteria 1340
152 Ga0068865_100691181 3300006881 Bacteria 871
153 Ga0097620_100111550 3300006931 Bacteria 2798
154 Ga0097620_100502784 3300006931 Bacteria 1307
155 Ga0097620_100811800 3300006931 Unclassified 1023
156 Ga0097620_100942620 3300006931 Bacteria 947
157 Ga0105240_10000137 3300009093 Bacteria 149925
158 Ga0105240_10000725 3300009093 Bacteria 60249
159 Ga0105240_10001720 3300009093 Bacteria 36943
160 Ga0105240_10006267 3300009093 Bacteria 17501
161 Ga0105240_10008603 3300009093 Bacteria 14585
162 Ga0105240_10014192 3300009093 Bacteria 10881
163 Ga0105240_10024993 3300009093 Bacteria 7861
164 Ga0105240_10079917 3300009093 Bacteria 4023
165 Ga0105240_10089673 3300009093 Bacteria 3761
166 Ga0105240_10177114 3300009093 Bacteria 2520
167 Ga0105240_10248872 3300009093 Bacteria 2057
168 Ga0105240_10313188 3300009093 Unclassified 1791
169 Ga0105240_10314740 3300009093 Bacteria 1786
170 Ga0105240_10320558 3300009093 Bacteria 1767
171 Ga0105240_10337477 3300009093 Bacteria 1713
172 Ga0105240_10341934 3300009093 Bacteria 1699
173 Ga0105245_10002584 3300009098 Bacteria 16303
174 Ga0105245_10022548 3300009098 Bacteria 5527
175 Ga0105245_10049711 3300009098 Unclassified 3756
176 Ga0105245_10064758 3300009098 Bacteria 3304
177 Ga0105245_10157956 3300009098 Bacteria 2149
178 Ga0105245_10236049 3300009098 Bacteria 1770
179 Ga0105245_10307276 3300009098 Bacteria 1558
180 Ga0105245_10376353 3300009098 Unclassified 1413
181 Ga0105245_10438363 3300009098 Bacteria 1312
182 Ga0105245_10804944 3300009098 Unclassified 978
183 Ga0105245_11286153 3300009098 Bacteria 780
184 Ga0105243_10025436 3300009148 Bacteria 4523
185 Ga0105243_10053473 3300009148 Bacteria 3203
186 Ga0105241_10009456 3300009174 Bacteria 7160
187 Ga0105241_10030987 3300009174 Bacteria 4000
188 Ga0105241_10047401 3300009174 Bacteria 3268
189 Ga0105241_10088483 3300009174 Bacteria 2439
190 Ga0105241_10323952 3300009174 Unclassified 1330
191 Ga0105242_10008301 3300009176 Bacteria 7977
192 Ga0105242_10014534 3300009176 Bacteria 6099
193 Ga0105242_10042750 3300009176 Bacteria 3662
194 Ga0105242_10079340 3300009176 Bacteria 2741
195 Ga0105242_10085557 3300009176 Bacteria 2644
196 Ga0105242_10104577 3300009176 Bacteria 2404
197 Ga0105242_10184478 3300009176 Bacteria 1843
198 Ga0105242_10292633 3300009176 Bacteria 1483
199 Ga0105242_10358177 3300009176 Unclassified 1349
200 Ga0105242_10542845 3300009176 Bacteria 1113
201 Ga0105248_10021914 3300009177 Bacteria 7080
202 Ga0105248_10084076 3300009177 Bacteria 3580
203 Ga0105248_10096310 3300009177 Unclassified 3333
204 Ga0105248_10098471 3300009177 Bacteria 3295
205 Ga0105248_10124733 3300009177 Bacteria 2905
206 Ga0105248_10186743 3300009177 Bacteria 2336
207 Ga0105248_10621572 3300009177 Bacteria 1219
208 Ga0105248_10667654 3300009177 Unclassified 1173
209 Ga0105248_10712240 3300009177 Bacteria 1133
210 Ga0105248_10881034 3300009177 Bacteria 1011
211 Ga0105248_10955329 3300009177 Bacteria 968
212 Ga0105237_10006074 3300009545 Bacteria 13509
213 Ga0105237_10015643 3300009545 Bacteria 7886
214 Ga0105237_10053430 3300009545 Bacteria 4052
215 Ga0105237_10182553 3300009545 Bacteria 2098
216 Ga0105238_10003531 3300009551 Bacteria 15586
217 Ga0105238_10026286 3300009551 Bacteria 5933
218 Ga0105238_10039789 3300009551 Bacteria 4767
219 Ga0105238_10044437 3300009551 Bacteria 4490
220 Ga0105238_10053529 3300009551 Bacteria 4055
221 Ga0105238_10313056 3300009551 Bacteria 1555
222 Ga0105238_10492204 3300009551 Bacteria 1226
223 Ga0105249_10006424 3300009553 Bacteria 10220
224 Ga0105249_10095589 3300009553 Bacteria 2786
225 Ga0105249_10227002 3300009553 Bacteria 1840
226 Ga0105239_10009505 3300010375 Bacteria 10949
227 Ga0105239_10019116 3300010375 Bacteria 7571
228 Ga0105239_10020840 3300010375 Bacteria 7232
229 Ga0105239_10306404 3300010375 Bacteria 1789
230 Ga0105239_10572834 3300010375 Bacteria 1287
231 Ga0105239_10600955 3300010375 Unclassified 1255
232 Ga0105239_10913614 3300010375 Unclassified 1008
233 Ga0105246_10031037 3300011119 Bacteria 3534
234 Ga0105246_10050745 3300011119 Bacteria 2846
235 Ga0157371_10249358 3300013102 Bacteria 1278
236 Ga0157370_10003949 3300013104 Bacteria 17262
237 Ga0157370_10004065 3300013104 Bacteria 16962
238 Ga0157370_10023653 3300013104 Bacteria 6097
239 Ga0157370_10532066 3300013104 Bacteria 1078
240 Ga0157370_10549591 3300013104 Bacteria 1059
241 Ga0157369_10001658 3300013105 Bacteria 27137
242 Ga0157369_10014214 3300013105 Bacteria 8993
243 Ga0157369_10042841 3300013105 Bacteria 4937
244 Ga0157369_10087330 3300013105 Bacteria 3330
245 Ga0157369_10236663 3300013105 Unclassified 1908
246 Ga0157369_10258418 3300013105 Bacteria 1817
247 Ga0157369_10320995 3300013105 Bacteria 1610
248 Ga0157369_10330484 3300013105 Bacteria 1584
249 Ga0157369_10762999 3300013105 Bacteria 995
250 Ga0157369_11215058 3300013105 Bacteria 769
251 Ga0157374_10013377 3300013296 Bacteria 7163
252 Ga0157374_10023646 3300013296 Bacteria 5498
253 Ga0157374_10038703 3300013296 Bacteria 4385
254 Ga0157374_10096787 3300013296 Bacteria 2823
255 Ga0157374_10190428 3300013296 Bacteria 2007
256 Ga0157374_10698469 3300013296 Bacteria 1027
257 Ga0157374_11296358 3300013296 Bacteria 750
258 Ga0157378_10006769 3300013297 Bacteria 10014
259 Ga0157378_10034764 3300013297 Bacteria 4457
260 Ga0157378_10528588 3300013297 Unclassified 1182
261 Ga0157378_11163470 3300013297 Unclassified 810
262 Ga0163162_10009244 3300013306 Bacteria 9589
263 Ga0163162_10128725 3300013306 Unclassified 2639
264 Ga0163162_10163966 3300013306 Bacteria 2346
265 Ga0163162_10169642 3300013306 Bacteria 2307
266 Ga0163162_10822549 3300013306 Bacteria 1045
267 Ga0163162_10885885 3300013306 Bacteria 1006
268 Ga0163162_10921663 3300013306 Unclassified 986
269 Ga0157372_10014611 3300013307 Bacteria 8398
270 Ga0157372_10023620 3300013307 Bacteria 6670
271 Ga0157372_10045493 3300013307 Bacteria 4870
272 Ga0157372_10119612 3300013307 Bacteria 3024
273 Ga0157372_10169730 3300013307 Bacteria 2524
274 Ga0157372_10177581 3300013307 Bacteria 2465
275 Ga0157372_10411308 3300013307 Bacteria 1576
276 Ga0157372_10760722 3300013307 Unclassified 1126
277 Ga0157375_10172250 3300013308 Bacteria 2312
278 Ga0157375_10399710 3300013308 Bacteria 1541
279 Ga0157375_10534948 3300013308 Bacteria 1334
280 Ga0157375_10669148 3300013308 Bacteria 1193
281 Ga0157375_10720138 3300013308 Bacteria 1151
282 Ga0157375_10818435 3300013308 Bacteria 1079
283 Ga0157375_11006324 3300013308 Bacteria 973
284 Ga0157375_11182723 3300013308 Unclassified 897
285 Ga0163163_10033602 3300014325 Bacteria 4963
286 Ga0163163_10039812 3300014325 Bacteria 4588
287 Ga0163163_10084857 3300014325 Bacteria 3174
288 Ga0163163_10115921 3300014325 Bacteria 2710
289 Ga0163163_10319914 3300014325 Bacteria 1605
290 Ga0163163_10357454 3300014325 Bacteria 1517
291 Ga0157379_10079842 3300014968 Bacteria 2930
292 Ga0157379_10234516 3300014968 Bacteria 1664
293 Ga0157379_10294279 3300014968 Bacteria 1479
294 Ga0157376_10040256 3300014969 Bacteria 3818
295 Ga0157376_10044253 3300014969 Bacteria 3658
296 Ga0157376_10155227 3300014969 Bacteria 2069
297 Ga0157376_10298322 3300014969 Unclassified 1524
298 Ga0157376_10327085 3300014969 Unclassified 1459
299 Ga0157376_10366577 3300014969 Bacteria 1383
300 Ga0157376_10477134 3300014969 Bacteria 1221
301 Ga0157376_10615948 3300014969 Bacteria 1082
302 Ga0213873_10028021 3300021358 Unclassified 1378
303 Ga0213872_10000337 3300021361 Bacteria 39767
304 Ga0213876_10001214 3300021384 Bacteria 16256
305 Ga0213876_10074751 3300021384 Bacteria 1790
306 Ga0213876_10091139 3300021384 Bacteria 1615
307 Ga0213876_10142792 3300021384 Unclassified 1273
308 Ga0213875_10000055 3300021388 Bacteria 139636
309 Ga0213875_10000108 3300021388 Bacteria 94421
310 Ga0213875_10002769 3300021388 Bacteria 10348
311 Ga0213875_10010188 3300021388 Bacteria 4721
312 Ga0213875_10015031 3300021388 Bacteria 3769
313 Ga0213875_10072622 3300021388 Bacteria 1606
314 Ga0213875_10110277 3300021388 Unclassified 1285
315 Ga0213875_10278870 3300021388 Unclassified 789
316 Ga0207692_10207682 3300025898 Bacteria 1155
317 Ga0207680_10089013 3300025903 Unclassified 1959
318 Ga0207699_10183475 3300025906 Bacteria 1408
319 Ga0207699_10185007 3300025906 Bacteria 1402
320 Ga0207645_10173768 3300025907 Bacteria 1412
321 Ga0207643_10080686 3300025908 Bacteria 1884
322 Ga0207705_10009074 3300025909 Bacteria 7247
323 Ga0207705_10057769 3300025909 Bacteria 2799
324 Ga0207705_10253061 3300025909 Bacteria 1344
325 Ga0207705_10537646 3300025909 Bacteria 908
326 Ga0207654_10007778 3300025911 Bacteria 5409
327 Ga0207654_10036180 3300025911 Bacteria 2757
328 Ga0207654_10069651 3300025911 Bacteria 2085
329 Ga0207654_10201876 3300025911 Unclassified 1309
330 Ga0207707_10007135 3300025912 Bacteria 9730
331 Ga0207707_10024481 3300025912 Bacteria 5282
332 Ga0207707_10100588 3300025912 Bacteria 2526
333 Ga0207707_10119632 3300025912 Bacteria 2302
334 Ga0207695_10000770 3300025913 Bacteria 60994
335 Ga0207695_10002883 3300025913 Bacteria 24934
336 Ga0207695_10005525 3300025913 Bacteria 16734
337 Ga0207695_10009314 3300025913 Bacteria 12156
338 Ga0207695_10012024 3300025913 Bacteria 10411
339 Ga0207695_10022417 3300025913 Bacteria 7168
340 Ga0207695_10051958 3300025913 Bacteria 4298
341 Ga0207695_10064422 3300025913 Bacteria 3774
342 Ga0207695_10256765 3300025913 Unclassified 1646
343 Ga0207695_10478877 3300025913 Bacteria 1127
344 Ga0207671_10052811 3300025914 Bacteria 3012
345 Ga0207671_10108868 3300025914 Bacteria 2106
346 Ga0207693_10103616 3300025915 Bacteria 2231
347 Ga0207663_10097969 3300025916 Bacteria 1962
348 Ga0207663_10150776 3300025916 Bacteria 1631
349 Ga0207663_10648455 3300025916 Unclassified 833
350 Ga0207660_10024188 3300025917 Bacteria 4109
351 Ga0207660_10411795 3300025917 Bacteria 1089
352 Ga0207657_10007163 3300025919 Bacteria 11456
353 Ga0207657_10189272 3300025919 Bacteria 1661
354 Ga0207657_10272031 3300025919 Bacteria 1346
355 Ga0207657_10283510 3300025919 Bacteria 1315
356 Ga0207657_10375153 3300025919 Unclassified 1121
357 Ga0207649_10274898 3300025920 Unclassified 1222
358 Ga0207652_10119181 3300025921 Bacteria 2347
359 Ga0207652_10226187 3300025921 Bacteria 1686
360 Ga0207646_10330640 3300025922 Bacteria 1377
361 Ga0207694_10002138 3300025924 Bacteria 16241
362 Ga0207694_10011929 3300025924 Bacteria 6553
363 Ga0207694_10229364 3300025924 Bacteria 1516
364 Ga0207694_10342537 3300025924 Bacteria 1236
365 Ga0207687_10009834 3300025927 Bacteria 6260
366 Ga0207687_10012877 3300025927 Bacteria 5467
367 Ga0207687_10017133 3300025927 Unclassified 4763
368 Ga0207687_10020360 3300025927 Bacteria 4400
369 Ga0207687_10043361 3300025927 Bacteria 3099
370 Ga0207687_10044347 3300025927 Bacteria 3068
371 Ga0207687_10419155 3300025927 Bacteria 1104
372 Ga0207687_10459244 3300025927 Unclassified 1057
373 Ga0207700_10006899 3300025928 Bacteria 6905
374 Ga0207700_10055608 3300025928 Bacteria 2975
375 Ga0207664_10027284 3300025929 Bacteria 4327
376 Ga0207664_10191890 3300025929 Bacteria 1759
377 Ga0207644_10299670 3300025931 Bacteria 1295
378 Ga0207706_10038266 3300025933 Bacteria 4255
379 Ga0207686_10002152 3300025934 Bacteria 10841
380 Ga0207686_10002620 3300025934 Bacteria 9761
381 Ga0207686_10005323 3300025934 Bacteria 6900
382 Ga0207686_10026810 3300025934 Bacteria 3367
383 Ga0207686_10109888 3300025934 Bacteria 1857
384 Ga0207686_10146335 3300025934 Bacteria 1639
385 Ga0207686_10159472 3300025934 Bacteria 1579
386 Ga0207686_10262465 3300025934 Bacteria 1267
387 Ga0207670_10219669 3300025936 Bacteria 1454
388 Ga0207670_10322052 3300025936 Bacteria 1216
389 Ga0207670_10601007 3300025936 Unclassified 903
390 Ga0207704_10004043 3300025938 Bacteria 6681
391 Ga0207704_10037467 3300025938 Bacteria 2801
392 Ga0207704_10675625 3300025938 Unclassified 853
393 Ga0207691_10381312 3300025940 Bacteria 1204
394 Ga0207711_10035068 3300025941 Bacteria 4251
395 Ga0207711_10041626 3300025941 Bacteria 3912
396 Ga0207711_10057465 3300025941 Bacteria 3345
397 Ga0207689_10014043 3300025942 Bacteria 6816
398 Ga0207689_10102033 3300025942 Bacteria 2356
399 Ga0207689_10210099 3300025942 Bacteria 1608
400 Ga0207661_10000019 3300025944 Bacteria 235900
401 Ga0207661_10008190 3300025944 Bacteria 7461
402 Ga0207661_10020313 3300025944 Bacteria 4963
403 Ga0207661_10151759 3300025944 Bacteria 2003
404 Ga0207661_10262626 3300025944 Bacteria 1538
405 Ga0207661_10415840 3300025944 Bacteria 1221
406 Ga0207661_10589075 3300025944 Bacteria 1020
407 Ga0207661_10748452 3300025944 Bacteria 899
408 Ga0207679_10333168 3300025945 Bacteria 1318
409 Ga0207667_10001168 3300025949 Bacteria 32962
410 Ga0207667_10008741 3300025949 Bacteria 12005
411 Ga0207667_10042580 3300025949 Bacteria 4825
412 Ga0207667_10080063 3300025949 Bacteria 3385
413 Ga0207667_10100696 3300025949 Bacteria 2981
414 Ga0207667_10122473 3300025949 Bacteria 2680
415 Ga0207667_10163410 3300025949 Bacteria 2289
416 Ga0207667_10510766 3300025949 Bacteria 1218
417 Ga0207651_10087711 3300025960 Bacteria 2266
418 Ga0207651_10346186 3300025960 Bacteria 1250
419 Ga0207712_10233096 3300025961 Bacteria 1479
420 Ga0207668_10526123 3300025972 Bacteria 1021
421 Ga0207668_10614417 3300025972 Bacteria 948
422 Ga0207658_10099024 3300025986 Bacteria 2279
423 Ga0207658_10322497 3300025986 Bacteria 1338
424 Ga0207677_10020675 3300026023 Bacteria 4002
425 Ga0207677_10024690 3300026023 Bacteria 3739
426 Ga0207677_10045166 3300026023 Bacteria 2940
427 Ga0207677_10224425 3300026023 Bacteria 1509
428 Ga0207677_10390078 3300026023 Bacteria 1178
429 Ga0207703_10009334 3300026035 Bacteria 7710
430 Ga0207703_10039496 3300026035 Bacteria 3772
431 Ga0207703_10179248 3300026035 Bacteria 1869
432 Ga0207703_10188296 3300026035 Bacteria 1826
433 Ga0207703_10806001 3300026035 Bacteria 897
434 Ga0207639_10065998 3300026041 Bacteria 2811
435 Ga0207639_10081396 3300026041 Bacteria 2564
436 Ga0207678_10042953 3300026067 Bacteria 3913
437 Ga0207702_10056240 3300026078 Bacteria 3340
438 Ga0207702_10109563 3300026078 Bacteria 2452
439 Ga0207702_10114177 3300026078 Bacteria 2407
440 Ga0207702_10127641 3300026078 Bacteria 2285
441 Ga0207702_10173930 3300026078 Bacteria 1977
442 Ga0207702_10213109 3300026078 Bacteria 1797
443 Ga0207702_10256141 3300026078 Bacteria 1646
444 Ga0207702_10266649 3300026078 Bacteria 1614
445 Ga0207702_10302100 3300026078 Bacteria 1519
446 Ga0207702_10319081 3300026078 Unclassified 1479
447 Ga0207702_10789114 3300026078 Unclassified 939
448 Ga0207641_10021590 3300026088 Bacteria 5290
449 Ga0207641_10045937 3300026088 Bacteria 3680
450 Ga0207648_10010408 3300026089 Bacteria 8817
451 Ga0207648_10202789 3300026089 Bacteria 1759
452 Ga0207648_10289922 3300026089 Bacteria 1465
453 Ga0207676_10027727 3300026095 Bacteria 4222
454 Ga0207676_10240478 3300026095 Bacteria 1624
455 Ga0207674_10000166 3300026116 Bacteria 79149
456 Ga0207674_10039163 3300026116 Bacteria 4915
457 Ga0207674_10039333 3300026116 Bacteria 4903
458 Ga0207674_10066179 3300026116 Bacteria 3641
459 Ga0207674_10195251 3300026116 Bacteria 1974
460 Ga0207683_10092532 3300026121 Bacteria 2694
461 Ga0207683_10196763 3300026121 Bacteria 1831
462 Ga0207698_10038899 3300026142 Bacteria 3519
463 Ga0207698_10044678 3300026142 Bacteria 3331
464 Ga0207698_10156504 3300026142 Bacteria 1986
465 Ga0207698_10736825 3300026142 Bacteria 983
466 Ga0207698_10868217 3300026142 Bacteria 908
467 Ga0268266_10064329 3300028379 Bacteria 3168
468 Ga0268266_10356035 3300028379 Bacteria 1376
469 Ga0268264_10009037 3300028381 Bacteria 8267
470 Ga0268264_10108185 3300028381 Bacteria 2430
471 Ga0265323_10001994 3300028653 Bacteria 9627
472 Ga0265338_10099579 3300028800 Bacteria 2373
473 Ga0265338_10175597 3300028800 Bacteria 1638
474 Ga0265324_10035251 3300029957 Bacteria 1742
475 Ga0265330_10059710 3300031235 Bacteria 1660
476 Ga0265332_10100977 3300031238 Bacteria 1217
477 Ga0265328_10047867 3300031239 Bacteria 1571
478 Ga0265320_10001179 3300031240 Bacteria 19255
479 Ga0265325_10003125 3300031241 Bacteria 10924
480 Ga0265325_10073697 3300031241 Bacteria 1709
481 Ga0265325_10075160 3300031241 Unclassified 1688
482 Ga0265340_10018603 3300031247 Bacteria 3583
483 Ga0265339_10024191 3300031249 Bacteria 3503
484 Ga0265331_10134913 3300031250 Bacteria 1124
485 Ga0265316_10001368 3300031344 Bacteria 26263
486 Ga0265316_10001444 3300031344 Bacteria 25507
487 Ga0265316_10004197 3300031344 Bacteria 14404
488 Ga0265316_10008612 3300031344 Bacteria 9449
489 Ga0265316_10013572 3300031344 Bacteria 7230
490 Ga0265316_10014352 3300031344 Bacteria 6976
491 Ga0265316_10015592 3300031344 Bacteria 6636
492 Ga0265316_10015903 3300031344 Bacteria 6550
493 Ga0265316_10120136 3300031344 Bacteria 1985
494 Ga0265316_10226197 3300031344 Bacteria 1379
495 Ga0265314_10000282 3300031711 Bacteria 73865
496 Ga0265314_10000961 3300031711 Bacteria 33842
497 Ga0265314_10011367 3300031711 Bacteria 7357
498 Ga0265314_10025644 3300031711 Bacteria 4442
499 Ga0265314_10111058 3300031711 Bacteria 1742
500 Ga0265314_10205104 3300031711 Bacteria 1162
501 Ga0265342_10112099 3300031712 Bacteria 1543
502 Ga0265342_10125986 3300031712 Bacteria 1438
503 Ga0316214_1022941 3300033545 Bacteria 876
504 Ga0373926_0007779 3300035083 Bacteria 3568
505 Ga0373926_0044617 3300035083 Bacteria 1588
506 Ga0373926_0170597 3300035083 Bacteria 832
507 Ga0373934_0042829 3300035086 Bacteria 1789
508 Ga0373934_0106527 3300035086 Bacteria 1135
509 Ga0373934_0130018 3300035086 Bacteria 1027
510 Ga0373923_0059867 3300035111 Bacteria 1615
511 Ga0373923_0059873 3300035111 Bacteria 1615
512 Ga0373936_0030938 3300035113 Bacteria 2112
513 Ga0373953_0025325 3300035117 Bacteria 2266
514 Ga0373953_0076268 3300035117 Bacteria 1389
515 Ga0373954_0001726 3300035118 Bacteria 8948
516 Ga0373954_0004906 3300035118 Bacteria 5775
517 Ga0373954_0143149 3300035118 Bacteria 1167
518 Ga0373956_0091373 3300035119 Bacteria 1404
519 Ga0373957_0057038 3300035120 Bacteria 1505
520 Ga0373943_0044678 3300035170 Bacteria 2157
521 Ga0373946_0077887 3300035171 Bacteria 1446
522 Ga0373955_0082222 3300035172 Bacteria 1822
523 Ga0373955_0134995 3300035172 Bacteria 1443
524 Ga0373931_0310722 3300035691 Unclassified 976
525 Ga0373935_0011987 3300035692 Bacteria 5210
526 Ga0373935_0044795 3300035692 Bacteria 2790
527 Ga0373927_0000498 3300035695 Bacteria 29897
528 Ga0373927_0002081 3300035695 Bacteria 14775
529 Ga0373927_0053850 3300035695 Bacteria 2603
530 Ga0373927_0067251 3300035695 Bacteria 2318
531 Ga0373927_0157975 3300035695 Bacteria 1485
532 Ga0373927_0221709 3300035695 Bacteria 1242
533 Ga0373927_0361506 3300035695 Unclassified 957
534 Ga0373927_0681159 3300035695 Bacteria 679
535 Ga0373933_0024764 3300035724 Bacteria 3437
536 Ga0373933_0191327 3300035724 Bacteria 1307
537 Ga0373947_0001083 3300035725 Bacteria 16688
538 Ga0373947_0021389 3300035725 Bacteria 3744
539 Ga0373937_0005609 3300036401 Bacteria 10775
540 Ga0373937_0013197 3300036401 Bacteria 7275
541 Ga0373937_0017647 3300036401 Bacteria 6366
542 Ga0373937_0029245 3300036401 Bacteria 4990
543 Ga0373937_0084305 3300036401 Bacteria 2940
544 Ga0373937_0089365 3300036401 Bacteria 2852
545 Ga0373937_0196111 3300036401 Unclassified 1898
546 Ga0373937_0206227 3300036401 Bacteria 1849
547 Ga0373937_0227906 3300036401 Bacteria 1754
548 Ga0373937_0256485 3300036401 Bacteria 1649
549 Ga0373937_0513494 3300036401 Unclassified 1138
550 Ga0373925_0000281 3300037068 Bacteria 53236
551 Ga0373925_0018587 3300037068 Bacteria 5053
552 Ga0373925_0197725 3300037068 Unclassified 1598
553 Ga0373925_0383445 3300037068 Bacteria 1145
554 Ga0395905_0496945 3300037471 Bacteria 1120
555 Ga0436364_0115933 3300037853 Bacteria 94405
556 Ga0436364_0134922 3300037853 Bacteria 2113
557 Ga0436364_0148095 3300037853 Bacteria 6786
558 Ga0436364_0205975 3300037853 Bacteria 4430
559 Ga0436364_0319084 3300037853 Bacteria 5272
560 Ga0436364_0334136 3300037853 Bacteria 2801
561 Ga0436364_0563134 3300037853 Bacteria 2946
562 Ga0436364_0633516 3300037853 Bacteria 25573
563 Ga0436364_0699166 3300037853 Bacteria 1437
564 Ga0436364_0755992 3300037853 Bacteria 4065
565 Ga0436364_0835808 3300037853 Bacteria 4462
566 Ga0436364_0836594 3300037853 Bacteria 1801
567 Ga0436364_1104632 3300037853 Unclassified 1145
568 Ga0436364_1175742 3300037853 Unclassified 773
569 Ga0436364_1193035 3300037853 Bacteria 6898
570 Ga0436364_1200519 3300037853 Bacteria 2818
571 Ga0436364_1286186 3300037853 Bacteria 721
572 Ga0436364_1293248 3300037853 Bacteria 1922
573 Ga0436364_1294362 3300037853 Bacteria 5877
574 Ga0436364_1298937 3300037853 Bacteria 123533
575 Ga0436364_1299576 3300037853 Bacteria 1771
576 Ga0436364_1375522 3300037853 Bacteria 1658
577 Ga0395901_0203680 3300038443 Bacteria 2074
578 Ga0436365_0082593 3300039437 Bacteria 3156
579 Ga0436365_0340201 3300039437 Bacteria 3973
580 Ga0436365_0461265 3300039437 Bacteria 3511
581 Ga0436365_0574543 3300039437 Bacteria 4824
582 Ga0436365_0650674 3300039437 Bacteria 3958
583 Ga0436365_0749264 3300039437 Unclassified 1060
584 Ga0436365_0809363 3300039437 Bacteria 2280
585 Ga0436365_0810573 3300039437 Bacteria 6562
586 Ga0436365_1178155 3300039437 Bacteria 1599
587 Ga0436365_1565054 3300039437 Bacteria 2460
588 Ga0436365_1778817 3300039437 Bacteria 29645
589 Ga0436360_0580543 3300039438 Bacteria 14902
590 Ga0436361_0793152 3300039447 Bacteria 90360
591 Ga0436363_0960435 3300039450 Bacteria 1411
592 Ga0436363_1297791 3300039450 Bacteria 3582
593 Ga0436363_1405280 3300039450 Unclassified 1076
594 Ga0436363_1437195 3300039450 Bacteria 1802
595 Ga0436362_0139354 3300039453 Bacteria 5292
596 Ga0436362_0507053 3300039453 Bacteria 2158
597 Ga0436362_0890342 3300039453 Bacteria 5717
598 Ga0436362_0958030 3300039453 Bacteria 2227
599 Ga0436362_1195420 3300039453 Bacteria 2641
600 Ga0451577_0092642 3300042876 Bacteria 2698
601 Ga0466966_0529456 3300044684 Bacteria 709
602 Ga0453684_0246527 3300044712 Unclassified 2054
603 Ga0453684_0616020 3300044712 Bacteria 1188
604 Ga0451576_0065958 3300045051 Bacteria 3769
605 Ga0451576_0311321 3300045051 Bacteria 1647
606 Ga0466958_0202424 3300045836 Bacteria 1264
607 Ga0466967_0265592 3300045976 Bacteria 1643
608 Ga0466967_1032258 3300045976 Unclassified 819
609 Ga0495592_0053384 3300046454 Bacteria 2998
610 Ga0495651_0002965 3300046462 Bacteria 13114
611 Ga0495651_0029667 3300046462 Bacteria 4265
612 Ga0495580_0011536 3300046472 Bacteria 6836
613 Ga0495580_0011669 3300046472 Bacteria 6792
614 Ga0495580_0013676 3300046472 Bacteria 6184
615 Ga0495580_0058744 3300046472 Unclassified 2704
616 Ga0495580_0136585 3300046472 Bacteria 1700
617 Ga0495582_0024457 3300046473 Bacteria 3305
618 Ga0495664_0009577 3300046477 Bacteria 5421
619 Ga0495664_0200917 3300046477 Unclassified 1208
620 Ga0495594_0224652 3300046499 Bacteria 1071
621 Ga0495608_0296060 3300046511 Bacteria 1002
622 Ga0495608_0419503 3300046511 Bacteria 817
623 Ga0495618_0505648 3300046514 Bacteria 728
624 Ga0495628_0003543 3300046516 Bacteria 13988
625 Ga0495628_0133784 3300046516 Bacteria 1896
626 Ga0495630_0120604 3300046517 Bacteria 1989
627 Ga0495666_0127321 3300046526 Bacteria 1191
628 Ga0495666_0166694 3300046526 Bacteria 1020
629 Ga0495666_0243213 3300046526 Unclassified 821
630 Ga0495652_0351008 3300046529 Bacteria 1057
631 Ga0495665_0033307 3300046531 Bacteria 2756
632 Ga0495665_0072053 3300046531 Bacteria 1820
633 Ga0495665_0199065 3300046531 Unclassified 1038
634 Ga0495587_0006862 3300046536 Bacteria 7406
635 Ga0495587_0209528 3300046536 Bacteria 1101
636 Ga0495645_0161581 3300046543 Bacteria 1548
637 Ga0495633_0292861 3300046558 Unclassified 740
638 Ga0495667_0045667 3300046559 Bacteria 2899
639 Ga0495667_0051911 3300046559 Bacteria 2704
640 Ga0495667_0225505 3300046559 Bacteria 1195
641 Ga0495634_0284566 3300046642 Bacteria 1003
642 Ga0495634_0378321 3300046642 Bacteria 844
643 Ga0495635_0110370 3300046663 Bacteria 1879
644 Ga0495599_0004028 3300046678 Bacteria 8650
645 Ga0495599_0050812 3300046678 Bacteria 2598
646 Ga0495623_0009599 3300046679 Bacteria 6282
647 Ga0495623_0018163 3300046679 Bacteria 4542
648 Ga0495623_0098521 3300046679 Unclassified 1784
649 Ga0495647_0220477 3300046681 Unclassified 837
650 Ga0495658_0036949 3300046683 Bacteria 2698
651 Ga0495613_0115355 3300046689 Bacteria 1933
652 Ga0495613_0154529 3300046689 Bacteria 1635
653 Ga0495613_0498708 3300046689 Unclassified 820
654 Ga0495624_0039485 3300046690 Bacteria 3026
655 Ga0495624_0392606 3300046690 Bacteria 833
656 Ga0495600_0405158 3300046809 Bacteria 848
657 Ga0495604_0094000 3300047317 Bacteria 2217
658 Ga0495674_0042721 3300047319 Bacteria 4041
659 Ga0495674_0068423 3300047319 Unclassified 3073
660 Ga0495674_0069537 3300047319 Unclassified 3044
661 Ga0495674_0098064 3300047319 Bacteria 2496
662 Ga0495674_0116622 3300047319 Bacteria 2259
663 Ga0495674_0216657 3300047319 Bacteria 1584
664 Ga0495674_0623856 3300047319 Bacteria 852
665 Ga0495675_0036019 3300047444 Bacteria 3158
666 Ga0495675_0115170 3300047444 Bacteria 1676
667 Ga0495675_0258551 3300047444 Bacteria 1044
668 Ga0495684_0005866 3300047471 Bacteria 9545
669 Ga0495684_0048916 3300047471 Bacteria 3232
670 Ga0495684_0165858 3300047471 Bacteria 1645
671 Ga0495593_0319352 3300047673 Bacteria 776
672 Ga0495602_0317269 3300048088 Bacteria 1135
673 Ga0496104_0791158 3300048907 Unclassified 855
674 Ga0496114_0953557 3300048917 Bacteria 740
675 Ga0496115_0017737 3300048918 Bacteria 5449
676 Ga0496115_0209306 3300048918 Bacteria 1611
677 Ga0496115_0439781 3300048918 Bacteria 1055
678 Ga0501031_0002010 3300049568 Bacteria 12827
679 Ga0501032_0001366 3300049569 Bacteria 19354
680 Ga0501033_0015134 3300049570 Bacteria 5853
681 Ga0501034_0026807 3300049571 Bacteria 5862
682 Ga0501034_0095298 3300049571 Bacteria 2973
683 Ga0501036_0001154 3300049572 Bacteria 20080
684 Ga0501037_0005354 3300049573 Bacteria 9335
685 Ga0501038_0000838 3300049574 Bacteria 27356
686 Ga0501039_0005534 3300049575 Bacteria 9561
687 Ga0501040_0661289 3300049576 Bacteria 755
688 Ga0501043_0042298 3300049579 Bacteria 3580
689 Ga0501046_0002291 3300049580 Bacteria 18046
690 Ga0501047_0098218 3300049581 Bacteria 2807
691 Ga0501047_0402488 3300049581 Unclassified 1201
692 Ga0501048_0026632 3300049582 Bacteria 4209
693 Ga0501067_0034591 3300049583 Bacteria 2804
694 Ga0501068_0001809 3300049584 Bacteria 11364
695 Ga0501069_0000403 3300049585 Bacteria 19568
696 Ga0501070_0091243 3300049586 Bacteria 2521
697 Ga0501072_0003019 3300049588 Bacteria 12694
698 Ga0501073_0001367 3300049589 Bacteria 18010
699 Ga0501074_0103262 3300049590 Bacteria 2040
700 Ga0501076_0131416 3300049592 Bacteria 2030
701 Ga0501077_0018748 3300049593 Bacteria 4377
702 Ga0501239_010678 3300049672 Unclassified 1016
703 Ga0501079_0108992 3300049741 Unclassified 2150
704 Ga0501080_0000243 3300049742 Bacteria 40903
705 Ga0501083_0004506 3300049744 Bacteria 9839
706 Ga0501035_0132437 3300049822 Unclassified 2172
707 Ga0501035_0298501 3300049822 Bacteria 1358
708 Ga0501044_0001257 3300049823 Bacteria 29993
709 Ga0501045_0053881 3300049824 Bacteria 2940
710 nmdc:mga0qj67_510669_c1 3300050509 Bacteria 966
711 nmdc:mga06r32_7934_c1 3300050510 Bacteria 9542
712 Ga0495612_0023813 3300053078 Bacteria 2458
713 Ga0500568_0001054 3300053139 Bacteria 18805
714 Ga0501084_0000227 3300054114 Bacteria 42697
715 Ga0501082_0000199 3300060353 Bacteria 52195
716 Ga0501082_0078605 3300060353 Bacteria 2845

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0681159 Ga0373927_0681159_81_647 186
2 3300009174 Ga0105241_10030987 Ga0105241_100309875 198
3 3300035118 Ga0373954_0143149 Ga0373954_0143149_245_922 198
4 3300013306 Ga0163162_10921663 Ga0163162_109216632 200
5 3300025906 Ga0207699_10183475 Ga0207699_101834752 201
6 3300037853 Ga0436364_1286186 Ga0436364_1286186_71_691 203
7 3300045836 Ga0466958_0202424 Ga0466958_0202424_42_674 203
8 3300021388 Ga0213875_10110277 Ga0213875_101102772 204
9 3300005329 Ga0070683_100146187 Ga0070683_1001461872 206
10 3300005435 Ga0070714_100218646 Ga0070714_1002186462 206
11 3300005439 Ga0070711_100818460 Ga0070711_1008184601 206
12 3300009093 Ga0105240_10079917 Ga0105240_100799174 206
13 3300010375 Ga0105239_10572834 Ga0105239_105728342 206
14 3300025913 Ga0207695_10064422 Ga0207695_100644224 206
15 3300025929 Ga0207664_10191890 Ga0207664_101918903 206
16 3300025944 Ga0207661_10589075 Ga0207661_105890752 206
17 3300005436 Ga0070713_100157774 Ga0070713_1001577742 210
18 3300025928 Ga0207700_10055608 Ga0207700_100556084 210
19 3300013296 Ga0157374_11296358 Ga0157374_112963581 212
20 3300035113 Ga0373936_0030938 Ga0373936_0030938_175_828 217
21 3300035695 Ga0373927_0053850 Ga0373927_0053850_1679_2332 217
22 3300036401 Ga0373937_0256485 Ga0373937_0256485_879_1532 217
23 3300037068 Ga0373925_0018587 Ga0373925_0018587_1033_1686 217
24 3300046517 Ga0495630_0120604 Ga0495630_0120604_499_1152 217
25 3300046531 Ga0495665_0072053 Ga0495665_0072053_780_1433 217
26 3300046690 Ga0495624_0392606 Ga0495624_0392606_139_792 217
27 3300048917 Ga0496114_0953557 Ga0496114_0953557_76_729 217
28 3300049672 Ga0501239_010678 Ga0501239_010678_10_663 217
29 3300053078 Ga0495612_0023813 Ga0495612_0023813_552_1205 217
30 3300009093 Ga0105240_10248872 Ga0105240_102488723 218
31 3300009098 Ga0105245_10022548 Ga0105245_100225483 218
32 3300009098 Ga0105245_10064758 Ga0105245_100647583 218
33 3300009098 Ga0105245_10236049 Ga0105245_102360492 218
34 3300009176 Ga0105242_10014534 Ga0105242_100145344 218
35 3300009177 Ga0105248_10712240 Ga0105248_107122402 218
36 3300009551 Ga0105238_10003531 Ga0105238_1000353111 218
37 3300009551 Ga0105238_10313056 Ga0105238_103130562 218
38 3300010375 Ga0105239_10019116 Ga0105239_100191166 218
39 3300013105 Ga0157369_10236663 Ga0157369_102366632 218
40 3300013296 Ga0157374_10023646 Ga0157374_100236466 218
41 3300013297 Ga0157378_10034764 Ga0157378_100347645 218
42 3300013306 Ga0163162_10128725 Ga0163162_101287253 218
43 3300013307 Ga0157372_10045493 Ga0157372_100454935 218
44 3300013308 Ga0157375_10399710 Ga0157375_103997103 218
45 3300013308 Ga0157375_10720138 Ga0157375_107201381 218
46 3300014325 Ga0163163_10319914 Ga0163163_103199142 218
47 3300014968 Ga0157379_10079842 Ga0157379_100798423 218
48 3300035083 Ga0373926_0170597 Ga0373926_0170597_24_680 218
49 3300045976 Ga0466967_1032258 Ga0466967_1032258_12_701 218
50 3300025972 Ga0207668_10526123 Ga0207668_105261232 219
51 3300031711 Ga0265314_10000282 Ga0265314_1000028251 219
52 3300005356 Ga0070674_100281639 Ga0070674_1002816392 220
53 3300009093 Ga0105240_10000725 Ga0105240_100007251 222
54 3300013296 Ga0157374_10190428 Ga0157374_101904282 222
55 3300035083 Ga0373926_0044617 Ga0373926_0044617_588_1256 222
56 3300035695 Ga0373927_0000498 Ga0373927_0000498_10381_11049 222
57 3300036401 Ga0373937_0513494 Ga0373937_0513494_54_722 222
58 3300046477 Ga0495664_0200917 Ga0495664_0200917_132_800 222
59 3300048918 Ga0496115_0017737 Ga0496115_0017737_3220_3894 222
60 3300046681 Ga0495647_0220477 Ga0495647_0220477_14_685 223
61 3300005336 Ga0070680_100106992 Ga0070680_1001069922 224
62 3300005434 Ga0070709_10031530 Ga0070709_100315303 224
63 3300005445 Ga0070708_100037457 Ga0070708_1000374573 224
64 3300005468 Ga0070707_100434279 Ga0070707_1004342791 224
65 3300005518 Ga0070699_100709012 Ga0070699_1007090122 224
66 3300005544 Ga0070686_100372070 Ga0070686_1003720701 224
67 3300009093 Ga0105240_10001720 Ga0105240_1000172024 224
68 3300009098 Ga0105245_10438363 Ga0105245_104383632 224
69 3300009176 Ga0105242_10008301 Ga0105242_1000830111 224
70 3300009176 Ga0105242_10184478 Ga0105242_101844782 224
71 3300009177 Ga0105248_10881034 Ga0105248_108810342 224
72 3300009545 Ga0105237_10053430 Ga0105237_100534303 224
73 3300013308 Ga0157375_10669148 Ga0157375_106691482 224
74 3300025906 Ga0207699_10185007 Ga0207699_101850072 224
75 3300025922 Ga0207646_10330640 Ga0207646_103306401 224
76 3300025934 Ga0207686_10002152 Ga0207686_100021523 224
77 3300025945 Ga0207679_10333168 Ga0207679_103331682 224
78 3300026035 Ga0207703_10806001 Ga0207703_108060011 224
79 3300026078 Ga0207702_10319081 Ga0207702_103190812 224
80 3300026142 Ga0207698_10868217 Ga0207698_108682172 224
81 3300031241 Ga0265325_10003125 Ga0265325_100031255 224
82 3300033545 Ga0316214_1022941 Ga0316214_10229412 224
83 3300046642 Ga0495634_0284566 Ga0495634_0284566_67_741 224
84 3300047319 Ga0495674_0216657 Ga0495674_0216657_334_1008 224
85 3300005336 Ga0070680_100025498 Ga0070680_1000254983 225
86 3300005435 Ga0070714_100170607 Ga0070714_1001706072 225
87 3300005563 Ga0068855_100005921 Ga0068855_1000059216 225
88 3300005614 Ga0068856_100044788 Ga0068856_1000447885 225
89 3300006237 Ga0097621_100090916 Ga0097621_1000909162 225
90 3300006358 Ga0068871_100102752 Ga0068871_1001027523 225
91 3300009093 Ga0105240_10014192 Ga0105240_100141923 225
92 3300013104 Ga0157370_10003949 Ga0157370_1000394914 225
93 3300013104 Ga0157370_10004065 Ga0157370_1000406514 225
94 3300013105 Ga0157369_10014214 Ga0157369_100142147 225
95 3300013105 Ga0157369_10087330 Ga0157369_100873303 225
96 3300025913 Ga0207695_10002883 Ga0207695_100028835 225
97 3300026078 Ga0207702_10213109 Ga0207702_102131092 225
98 3300031241 Ga0265325_10075160 Ga0265325_100751602 225
99 3300036401 Ga0373937_0227906 Ga0373937_0227906_343_1020 225
100 3300037068 Ga0373925_0383445 Ga0373925_0383445_312_989 225
101 3300039438 Ga0436360_0580543 Ga0436360_0580543_8340_9026 225
102 3300039450 Ga0436363_1297791 Ga0436363_1297791_535_1212 225
103 3300039453 Ga0436362_0958030 Ga0436362_0958030_1409_2113 225
104 3300044684 Ga0466966_0529456 Ga0466966_0529456_13_690 225
105 3300046454 Ga0495592_0053384 Ga0495592_0053384_1546_2223 225
106 3300046536 Ga0495587_0006862 Ga0495587_0006862_5751_6428 225
107 3300046679 Ga0495623_0018163 Ga0495623_0018163_3427_4104 225
108 3300053139 Ga0500568_0001054 Ga0500568_0001054_4315_4992 225
109 3300005327 Ga0070658_10009861 Ga0070658_100098616 226
110 3300005327 Ga0070658_10129626 Ga0070658_101296262 226
111 3300005328 Ga0070676_10168310 Ga0070676_101683103 226
112 3300005329 Ga0070683_100005237 Ga0070683_10000523711 226
113 3300005329 Ga0070683_100780711 Ga0070683_1007807111 226
114 3300005330 Ga0070690_100309505 Ga0070690_1003095052 226
115 3300005335 Ga0070666_10115154 Ga0070666_101151542 226
116 3300005336 Ga0070680_100038958 Ga0070680_1000389583 226
117 3300005338 Ga0068868_100011009 Ga0068868_1000110098 226
118 3300005338 Ga0068868_100044941 Ga0068868_1000449413 226
119 3300005338 Ga0068868_100277237 Ga0068868_1002772372 226
120 3300005339 Ga0070660_100007244 Ga0070660_1000072444 226
121 3300005339 Ga0070660_100171655 Ga0070660_1001716552 226
122 3300005339 Ga0070660_100205510 Ga0070660_1002055102 226
123 3300005344 Ga0070661_100052822 Ga0070661_1000528224 226
124 3300005345 Ga0070692_10092230 Ga0070692_100922302 226
125 3300005356 Ga0070674_100627889 Ga0070674_1006278891 226
126 3300005364 Ga0070673_100318278 Ga0070673_1003182782 226
127 3300005367 Ga0070667_100013784 Ga0070667_1000137841 226
128 3300005436 Ga0070713_100048723 Ga0070713_1000487232 226
129 3300005455 Ga0070663_100728272 Ga0070663_1007282721 226
130 3300005458 Ga0070681_10022213 Ga0070681_100222132 226
131 3300005459 Ga0068867_100208333 Ga0068867_1002083332 226
132 3300005459 Ga0068867_100480300 Ga0068867_1004803002 226
133 3300005530 Ga0070679_100000635 Ga0070679_10000063524 226
134 3300005535 Ga0070684_100000654 Ga0070684_10000065411 226
135 3300005535 Ga0070684_100095009 Ga0070684_1000950094 226
136 3300005535 Ga0070684_100127399 Ga0070684_1001273992 226
137 3300005535 Ga0070684_100551658 Ga0070684_1005516582 226
138 3300005539 Ga0068853_100018364 Ga0068853_1000183641 226
139 3300005539 Ga0068853_100111936 Ga0068853_1001119362 226
140 3300005548 Ga0070665_100021507 Ga0070665_1000215071 226
141 3300005563 Ga0068855_100003676 Ga0068855_1000036767 226
142 3300005563 Ga0068855_100017587 Ga0068855_1000175877 226
143 3300005563 Ga0068855_100041567 Ga0068855_1000415676 226
144 3300005563 Ga0068855_100133575 Ga0068855_1001335752 226
145 3300005563 Ga0068855_100235759 Ga0068855_1002357592 226
146 3300005563 Ga0068855_100258952 Ga0068855_1002589522 226
147 3300005564 Ga0070664_100251199 Ga0070664_1002511992 226
148 3300005577 Ga0068857_100000367 Ga0068857_10000036712 226
149 3300005577 Ga0068857_100026136 Ga0068857_1000261363 226
150 3300005577 Ga0068857_100713242 Ga0068857_1007132421 226
151 3300005614 Ga0068856_100202529 Ga0068856_1002025293 226
152 3300005614 Ga0068856_100296679 Ga0068856_1002966791 226
153 3300005614 Ga0068856_100453965 Ga0068856_1004539652 226
154 3300005616 Ga0068852_100044205 Ga0068852_1000442053 226
155 3300005616 Ga0068852_100064073 Ga0068852_1000640733 226
156 3300005616 Ga0068852_100366049 Ga0068852_1003660492 226
157 3300005618 Ga0068864_100215952 Ga0068864_1002159522 226
158 3300005841 Ga0068863_100032126 Ga0068863_1000321265 226
159 3300005842 Ga0068858_100200992 Ga0068858_1002009923 226
160 3300005842 Ga0068858_100233987 Ga0068858_1002339872 226
161 3300005843 Ga0068860_100008416 Ga0068860_1000084165 226
162 3300005843 Ga0068860_100260682 Ga0068860_1002606823 226
163 3300006237 Ga0097621_100014202 Ga0097621_1000142023 226
164 3300006237 Ga0097621_100018452 Ga0097621_1000184526 226
165 3300006237 Ga0097621_100110583 Ga0097621_1001105832 226
166 3300006237 Ga0097621_100122757 Ga0097621_1001227572 226
167 3300006237 Ga0097621_100307010 Ga0097621_1003070101 226
168 3300006237 Ga0097621_100508370 Ga0097621_1005083702 226
169 3300006237 Ga0097621_100884963 Ga0097621_1008849632 226
170 3300006358 Ga0068871_100013047 Ga0068871_1000130474 226
171 3300006358 Ga0068871_100081163 Ga0068871_1000811632 226
172 3300006881 Ga0068865_100144276 Ga0068865_1001442763 226
173 3300006881 Ga0068865_100222387 Ga0068865_1002223872 226
174 3300009093 Ga0105240_10000137 Ga0105240_1000013725 226
175 3300009093 Ga0105240_10008603 Ga0105240_100086036 226
176 3300009093 Ga0105240_10024993 Ga0105240_100249936 226
177 3300009093 Ga0105240_10177114 Ga0105240_101771144 226
178 3300009093 Ga0105240_10337477 Ga0105240_103374772 226
179 3300009098 Ga0105245_10002584 Ga0105245_1000258417 226
180 3300009098 Ga0105245_10157956 Ga0105245_101579562 226
181 3300009098 Ga0105245_10307276 Ga0105245_103072763 226
182 3300009098 Ga0105245_10376353 Ga0105245_103763532 226
183 3300009148 Ga0105243_10025436 Ga0105243_100254362 226
184 3300009148 Ga0105243_10053473 Ga0105243_100534732 226
185 3300009174 Ga0105241_10009456 Ga0105241_100094566 226
186 3300009174 Ga0105241_10047401 Ga0105241_100474013 226
187 3300009174 Ga0105241_10088483 Ga0105241_100884833 226
188 3300009174 Ga0105241_10323952 Ga0105241_103239522 226
189 3300009176 Ga0105242_10042750 Ga0105242_100427503 226
190 3300009176 Ga0105242_10085557 Ga0105242_100855572 226
191 3300009176 Ga0105242_10104577 Ga0105242_101045773 226
192 3300009176 Ga0105242_10358177 Ga0105242_103581771 226
193 3300009176 Ga0105242_10542845 Ga0105242_105428451 226
194 3300009177 Ga0105248_10096310 Ga0105248_100963105 226
195 3300009177 Ga0105248_10186743 Ga0105248_101867434 226
196 3300009545 Ga0105237_10006074 Ga0105237_100060742 226
197 3300009545 Ga0105237_10182553 Ga0105237_101825532 226
198 3300009551 Ga0105238_10026286 Ga0105238_100262861 226
199 3300009551 Ga0105238_10039789 Ga0105238_100397895 226
200 3300009551 Ga0105238_10044437 Ga0105238_100444373 226
201 3300009553 Ga0105249_10227002 Ga0105249_102270022 226
202 3300010375 Ga0105239_10009505 Ga0105239_1000950512 226
203 3300010375 Ga0105239_10020840 Ga0105239_100208404 226
204 3300010375 Ga0105239_10600955 Ga0105239_106009551 226
205 3300013104 Ga0157370_10023653 Ga0157370_100236533 226
206 3300013104 Ga0157370_10532066 Ga0157370_105320661 226
207 3300013105 Ga0157369_11215058 Ga0157369_112150581 226
208 3300013296 Ga0157374_10038703 Ga0157374_100387034 226
209 3300013296 Ga0157374_10096787 Ga0157374_100967872 226
210 3300013297 Ga0157378_10006769 Ga0157378_100067696 226
211 3300013297 Ga0157378_11163470 Ga0157378_111634701 226
212 3300013306 Ga0163162_10009244 Ga0163162_100092442 226
213 3300013306 Ga0163162_10169642 Ga0163162_101696422 226
214 3300013306 Ga0163162_10885885 Ga0163162_108858851 226
215 3300013307 Ga0157372_10023620 Ga0157372_100236205 226
216 3300013307 Ga0157372_10169730 Ga0157372_101697302 226
217 3300013307 Ga0157372_10760722 Ga0157372_107607222 226
218 3300013308 Ga0157375_10172250 Ga0157375_101722503 226
219 3300014325 Ga0163163_10033602 Ga0163163_100336026 226
220 3300014325 Ga0163163_10039812 Ga0163163_100398125 226
221 3300014325 Ga0163163_10357454 Ga0163163_103574542 226
222 3300014968 Ga0157379_10294279 Ga0157379_102942792 226
223 3300014969 Ga0157376_10155227 Ga0157376_101552274 226
224 3300025898 Ga0207692_10207682 Ga0207692_102076822 226
225 3300025903 Ga0207680_10089013 Ga0207680_100890133 226
226 3300025907 Ga0207645_10173768 Ga0207645_101737682 226
227 3300025909 Ga0207705_10009074 Ga0207705_100090748 226
228 3300025909 Ga0207705_10537646 Ga0207705_105376462 226
229 3300025911 Ga0207654_10007778 Ga0207654_100077787 226
230 3300025911 Ga0207654_10036180 Ga0207654_100361803 226
231 3300025911 Ga0207654_10069651 Ga0207654_100696513 226
232 3300025911 Ga0207654_10201876 Ga0207654_102018762 226
233 3300025912 Ga0207707_10007135 Ga0207707_1000713511 226
234 3300025913 Ga0207695_10000770 Ga0207695_1000077057 226
235 3300025913 Ga0207695_10009314 Ga0207695_1000931412 226
236 3300025913 Ga0207695_10022417 Ga0207695_100224177 226
237 3300025914 Ga0207671_10052811 Ga0207671_100528115 226
238 3300025917 Ga0207660_10024188 Ga0207660_100241883 226
239 3300025919 Ga0207657_10007163 Ga0207657_100071637 226
240 3300025919 Ga0207657_10189272 Ga0207657_101892722 226
241 3300025919 Ga0207657_10272031 Ga0207657_102720311 226
242 3300025919 Ga0207657_10375153 Ga0207657_103751532 226
243 3300025920 Ga0207649_10274898 Ga0207649_102748981 226
244 3300025921 Ga0207652_10226187 Ga0207652_102261872 226
245 3300025924 Ga0207694_10002138 Ga0207694_1000213813 226
246 3300025924 Ga0207694_10229364 Ga0207694_102293642 226
247 3300025924 Ga0207694_10342537 Ga0207694_103425372 226
248 3300025927 Ga0207687_10009834 Ga0207687_100098345 226
249 3300025927 Ga0207687_10012877 Ga0207687_100128772 226
250 3300025927 Ga0207687_10017133 Ga0207687_100171332 226
251 3300025927 Ga0207687_10043361 Ga0207687_100433614 226
252 3300025927 Ga0207687_10044347 Ga0207687_100443472 226
253 3300025931 Ga0207644_10299670 Ga0207644_102996702 226
254 3300025933 Ga0207706_10038266 Ga0207706_100382666 226
255 3300025934 Ga0207686_10002620 Ga0207686_100026209 226
256 3300025934 Ga0207686_10005323 Ga0207686_100053233 226
257 3300025934 Ga0207686_10026810 Ga0207686_100268103 226
258 3300025934 Ga0207686_10159472 Ga0207686_101594722 226
259 3300025938 Ga0207704_10004043 Ga0207704_100040434 226
260 3300025938 Ga0207704_10037467 Ga0207704_100374674 226
261 3300025938 Ga0207704_10675625 Ga0207704_106756252 226
262 3300025941 Ga0207711_10035068 Ga0207711_100350685 226
263 3300025941 Ga0207711_10041626 Ga0207711_100416264 226
264 3300025942 Ga0207689_10014043 Ga0207689_100140436 226
265 3300025942 Ga0207689_10102033 Ga0207689_101020333 226
266 3300025944 Ga0207661_10008190 Ga0207661_100081908 226
267 3300025944 Ga0207661_10020313 Ga0207661_100203135 226
268 3300025944 Ga0207661_10262626 Ga0207661_102626262 226
269 3300025944 Ga0207661_10748452 Ga0207661_107484522 226
270 3300025949 Ga0207667_10001168 Ga0207667_1000116825 226
271 3300025949 Ga0207667_10008741 Ga0207667_100087415 226
272 3300025949 Ga0207667_10042580 Ga0207667_100425807 226
273 3300025949 Ga0207667_10510766 Ga0207667_105107662 226
274 3300025960 Ga0207651_10346186 Ga0207651_103461862 226
275 3300025986 Ga0207658_10099024 Ga0207658_100990242 226
276 3300025986 Ga0207658_10322497 Ga0207658_103224972 226
277 3300026023 Ga0207677_10020675 Ga0207677_100206754 226
278 3300026023 Ga0207677_10024690 Ga0207677_100246902 226
279 3300026023 Ga0207677_10045166 Ga0207677_100451664 226
280 3300026023 Ga0207677_10224425 Ga0207677_102244253 226
281 3300026023 Ga0207677_10390078 Ga0207677_103900782 226
282 3300026035 Ga0207703_10009334 Ga0207703_100093346 226
283 3300026035 Ga0207703_10188296 Ga0207703_101882962 226
284 3300026041 Ga0207639_10065998 Ga0207639_100659983 226
285 3300026041 Ga0207639_10081396 Ga0207639_100813962 226
286 3300026078 Ga0207702_10109563 Ga0207702_101095633 226
287 3300026078 Ga0207702_10127641 Ga0207702_101276413 226
288 3300026078 Ga0207702_10173930 Ga0207702_101739303 226
289 3300026078 Ga0207702_10302100 Ga0207702_103021003 226
290 3300026078 Ga0207702_10789114 Ga0207702_107891141 226
291 3300026088 Ga0207641_10045937 Ga0207641_100459375 226
292 3300026089 Ga0207648_10010408 Ga0207648_1001040810 226
293 3300026089 Ga0207648_10202789 Ga0207648_102027892 226
294 3300026089 Ga0207648_10289922 Ga0207648_102899222 226
295 3300026095 Ga0207676_10027727 Ga0207676_100277272 226
296 3300026116 Ga0207674_10000166 Ga0207674_1000016665 226
297 3300026116 Ga0207674_10039163 Ga0207674_100391633 226
298 3300026116 Ga0207674_10066179 Ga0207674_100661792 226
299 3300026121 Ga0207683_10196763 Ga0207683_101967632 226
300 3300026142 Ga0207698_10038899 Ga0207698_100388993 226
301 3300026142 Ga0207698_10044678 Ga0207698_100446782 226
302 3300026142 Ga0207698_10736825 Ga0207698_107368251 226
303 3300028379 Ga0268266_10064329 Ga0268266_100643294 226
304 3300028381 Ga0268264_10009037 Ga0268264_100090378 226
305 3300035083 Ga0373926_0007779 Ga0373926_0007779_2058_2738 226
306 3300035111 Ga0373923_0059873 Ga0373923_0059873_808_1488 226
307 3300035118 Ga0373954_0001726 Ga0373954_0001726_2417_3097 226
308 3300035118 Ga0373954_0004906 Ga0373954_0004906_2378_3058 226
309 3300035171 Ga0373946_0077887 Ga0373946_0077887_498_1178 226
310 3300035692 Ga0373935_0044795 Ga0373935_0044795_2058_2738 226
311 3300035695 Ga0373927_0002081 Ga0373927_0002081_4689_5369 226
312 3300035695 Ga0373927_0221709 Ga0373927_0221709_234_914 226
313 3300035724 Ga0373933_0191327 Ga0373933_0191327_206_886 226
314 3300035725 Ga0373947_0001083 Ga0373947_0001083_5558_6238 226
315 3300036401 Ga0373937_0005609 Ga0373937_0005609_9841_10521 226
316 3300036401 Ga0373937_0089365 Ga0373937_0089365_123_803 226
317 3300037068 Ga0373925_0000281 Ga0373925_0000281_34326_35006 226
318 3300037471 Ga0395905_0496945 Ga0395905_0496945_199_891 226
319 3300037853 Ga0436364_0563134 Ga0436364_0563134_478_1179 226
320 3300037853 Ga0436364_1175742 Ga0436364_1175742_62_763 226
321 3300039437 Ga0436365_0082593 Ga0436365_0082593_2437_3138 226
322 3300039437 Ga0436365_0574543 Ga0436365_0574543_494_1183 226
323 3300039437 Ga0436365_0650674 Ga0436365_0650674_1262_1951 226
324 3300039437 Ga0436365_0749264 Ga0436365_0749264_145_846 226
325 3300039453 Ga0436362_0890342 Ga0436362_0890342_3534_4235 226
326 3300046514 Ga0495618_0505648 Ga0495618_0505648_34_714 226
327 3300046536 Ga0495587_0209528 Ga0495587_0209528_119_799 226
328 3300046558 Ga0495633_0292861 Ga0495633_0292861_44_724 226
329 3300046690 Ga0495624_0039485 Ga0495624_0039485_889_1569 226
330 3300047444 Ga0495675_0258551 Ga0495675_0258551_291_971 226
331 3300047673 Ga0495593_0319352 Ga0495593_0319352_52_732 226
332 3300048918 Ga0496115_0439781 Ga0496115_0439781_77_757 226
333 3300049568 Ga0501031_0002010 Ga0501031_0002010_256_936 226
334 3300049569 Ga0501032_0001366 Ga0501032_0001366_7555_8235 226
335 3300049570 Ga0501033_0015134 Ga0501033_0015134_3918_4598 226
336 3300049571 Ga0501034_0026807 Ga0501034_0026807_2549_3229 226
337 3300049571 Ga0501034_0095298 Ga0501034_0095298_1085_1771 226
338 3300049572 Ga0501036_0001154 Ga0501036_0001154_8499_9179 226
339 3300049573 Ga0501037_0005354 Ga0501037_0005354_1256_1936 226
340 3300049574 Ga0501038_0000838 Ga0501038_0000838_18740_19420 226
341 3300049575 Ga0501039_0005534 Ga0501039_0005534_8732_9412 226
342 3300049579 Ga0501043_0042298 Ga0501043_0042298_352_1032 226
343 3300049580 Ga0501046_0002291 Ga0501046_0002291_1192_1872 226
344 3300049581 Ga0501047_0402488 Ga0501047_0402488_224_904 226
345 3300049582 Ga0501048_0026632 Ga0501048_0026632_3177_3857 226
346 3300049583 Ga0501067_0034591 Ga0501067_0034591_1193_1873 226
347 3300049584 Ga0501068_0001809 Ga0501068_0001809_2731_3411 226
348 3300049585 Ga0501069_0000403 Ga0501069_0000403_18772_19452 226
349 3300049586 Ga0501070_0091243 Ga0501070_0091243_1038_1718 226
350 3300049588 Ga0501072_0003019 Ga0501072_0003019_2549_3229 226
351 3300049589 Ga0501073_0001367 Ga0501073_0001367_3434_4114 226
352 3300049590 Ga0501074_0103262 Ga0501074_0103262_1193_1873 226
353 3300049592 Ga0501076_0131416 Ga0501076_0131416_1096_1776 226
354 3300049593 Ga0501077_0018748 Ga0501077_0018748_3088_3768 226
355 3300049741 Ga0501079_0108992 Ga0501079_0108992_343_1023 226
356 3300049742 Ga0501080_0000243 Ga0501080_0000243_17355_18035 226
357 3300049744 Ga0501083_0004506 Ga0501083_0004506_3790_4470 226
358 3300049822 Ga0501035_0132437 Ga0501035_0132437_1256_1936 226
359 3300049824 Ga0501045_0053881 Ga0501045_0053881_2125_2805 226
360 3300054114 Ga0501084_0000227 Ga0501084_0000227_35593_36273 226
361 3300060353 Ga0501082_0078605 Ga0501082_0078605_1038_1718 226
362 3300005577 Ga0068857_100009431 Ga0068857_1000094315 227
363 3300005617 Ga0068859_100942521 Ga0068859_1009425211 227
364 3300006931 Ga0097620_100942620 Ga0097620_1009426201 227
365 3300013296 Ga0157374_10698469 Ga0157374_106984692 227
366 3300013306 Ga0163162_10163966 Ga0163162_101639663 227
367 3300014969 Ga0157376_10366577 Ga0157376_103665773 227
368 3300021388 Ga0213875_10002769 Ga0213875_100027699 227
369 3300025912 Ga0207707_10024481 Ga0207707_100244815 227
370 3300026116 Ga0207674_10039333 Ga0207674_100393332 227
371 3300031238 Ga0265332_10100977 Ga0265332_101009772 227
372 3300031344 Ga0265316_10014352 Ga0265316_100143525 227
373 3300031711 Ga0265314_10000961 Ga0265314_100009612 227
374 3300031711 Ga0265314_10025644 Ga0265314_100256442 227
375 3300031712 Ga0265342_10112099 Ga0265342_101120992 227
376 3300035086 Ga0373934_0042829 Ga0373934_0042829_1005_1688 227
377 3300035111 Ga0373923_0059867 Ga0373923_0059867_593_1276 227
378 3300035117 Ga0373953_0076268 Ga0373953_0076268_434_1117 227
379 3300035695 Ga0373927_0067251 Ga0373927_0067251_490_1173 227
380 3300036401 Ga0373937_0029245 Ga0373937_0029245_56_739 227
381 3300037853 Ga0436364_1200519 Ga0436364_1200519_509_1192 227
382 3300037853 Ga0436364_1294362 Ga0436364_1294362_509_1192 227
383 3300042876 Ga0451577_0092642 Ga0451577_0092642_252_947 227
384 3300046462 Ga0495651_0029667 Ga0495651_0029667_1873_2556 227
385 3300046472 Ga0495580_0011669 Ga0495580_0011669_4940_5623 227
386 3300046477 Ga0495664_0009577 Ga0495664_0009577_655_1338 227
387 3300046511 Ga0495608_0296060 Ga0495608_0296060_49_732 227
388 3300046516 Ga0495628_0003543 Ga0495628_0003543_9709_10392 227
389 3300046526 Ga0495666_0166694 Ga0495666_0166694_97_780 227
390 3300046543 Ga0495645_0161581 Ga0495645_0161581_145_828 227
391 3300046678 Ga0495599_0004028 Ga0495599_0004028_1536_2219 227
392 3300046689 Ga0495613_0154529 Ga0495613_0154529_460_1143 227
393 3300046689 Ga0495613_0498708 Ga0495613_0498708_51_734 227
394 3300046809 Ga0495600_0405158 Ga0495600_0405158_55_738 227
395 3300047319 Ga0495674_0042721 Ga0495674_0042721_1735_2418 227
396 3300047319 Ga0495674_0068423 Ga0495674_0068423_2183_2866 227
397 3300047319 Ga0495674_0098064 Ga0495674_0098064_241_924 227
398 3300047471 Ga0495684_0048916 Ga0495684_0048916_798_1481 227
399 3300005331 Ga0070670_100685279 Ga0070670_1006852791 228
400 3300005334 Ga0068869_100185178 Ga0068869_1001851783 228
401 3300005340 Ga0070689_100436456 Ga0070689_1004364562 228
402 3300005347 Ga0070668_100618225 Ga0070668_1006182252 228
403 3300005434 Ga0070709_10013766 Ga0070709_100137663 228
404 3300005439 Ga0070711_100275967 Ga0070711_1002759672 228
405 3300005459 Ga0068867_100157651 Ga0068867_1001576512 228
406 3300005543 Ga0070672_100471496 Ga0070672_1004714962 228
407 3300005617 Ga0068859_100111544 Ga0068859_1001115443 228
408 3300005719 Ga0068861_100573094 Ga0068861_1005730942 228
409 3300005840 Ga0068870_10125067 Ga0068870_101250672 228
410 3300005843 Ga0068860_100142529 Ga0068860_1001425293 228
411 3300006881 Ga0068865_100691181 Ga0068865_1006911811 228
412 3300006931 Ga0097620_100111550 Ga0097620_1001115503 228
413 3300009098 Ga0105245_11286153 Ga0105245_112861531 228
414 3300009176 Ga0105242_10079340 Ga0105242_100793402 228
415 3300009176 Ga0105242_10292633 Ga0105242_102926332 228
416 3300009177 Ga0105248_10021914 Ga0105248_100219145 228
417 3300009551 Ga0105238_10053529 Ga0105238_100535294 228
418 3300009553 Ga0105249_10095589 Ga0105249_100955892 228
419 3300011119 Ga0105246_10031037 Ga0105246_100310372 228
420 3300011119 Ga0105246_10050745 Ga0105246_100507454 228
421 3300013308 Ga0157375_10818435 Ga0157375_108184352 228
422 3300013308 Ga0157375_11006324 Ga0157375_110063241 228
423 3300014968 Ga0157379_10234516 Ga0157379_102345161 228
424 3300014969 Ga0157376_10040256 Ga0157376_100402564 228
425 3300014969 Ga0157376_10477134 Ga0157376_104771341 228
426 3300025908 Ga0207643_10080686 Ga0207643_100806863 228
427 3300025916 Ga0207663_10097969 Ga0207663_100979693 228
428 3300025924 Ga0207694_10011929 Ga0207694_100119297 228
429 3300025927 Ga0207687_10020360 Ga0207687_100203602 228
430 3300025928 Ga0207700_10006899 Ga0207700_100068991 228
431 3300025934 Ga0207686_10109888 Ga0207686_101098881 228
432 3300025934 Ga0207686_10146335 Ga0207686_101463352 228
433 3300025936 Ga0207670_10322052 Ga0207670_103220522 228
434 3300025940 Ga0207691_10381312 Ga0207691_103813122 228
435 3300025942 Ga0207689_10210099 Ga0207689_102100992 228
436 3300025960 Ga0207651_10087711 Ga0207651_100877112 228
437 3300025961 Ga0207712_10233096 Ga0207712_102330962 228
438 3300025972 Ga0207668_10614417 Ga0207668_106144172 228
439 3300026035 Ga0207703_10039496 Ga0207703_100394962 228
440 3300026035 Ga0207703_10179248 Ga0207703_101792482 228
441 3300028381 Ga0268264_10108185 Ga0268264_101081852 228
442 3300031711 Ga0265314_10205104 Ga0265314_102051042 228
443 3300035086 Ga0373934_0106527 Ga0373934_0106527_11_703 228
444 3300035086 Ga0373934_0130018 Ga0373934_0130018_282_980 228
445 3300035172 Ga0373955_0134995 Ga0373955_0134995_661_1359 228
446 3300036401 Ga0373937_0013197 Ga0373937_0013197_484_1176 228
447 3300036401 Ga0373937_0206227 Ga0373937_0206227_612_1310 228
448 3300039437 Ga0436365_1565054 Ga0436365_1565054_1230_1925 228
449 3300039450 Ga0436363_0960435 Ga0436363_0960435_55_744 228
450 3300039453 Ga0436362_1195420 Ga0436362_1195420_51_746 228
451 3300046473 Ga0495582_0024457 Ga0495582_0024457_16_708 228
452 3300046526 Ga0495666_0127321 Ga0495666_0127321_74_766 228
453 3300046642 Ga0495634_0378321 Ga0495634_0378321_60_758 228
454 3300046663 Ga0495635_0110370 Ga0495635_0110370_1003_1701 228
455 3300046683 Ga0495658_0036949 Ga0495658_0036949_1759_2451 228
456 3300046689 Ga0495613_0115355 Ga0495613_0115355_687_1385 228
457 3300047319 Ga0495674_0069537 Ga0495674_0069537_499_1197 228
458 3300047471 Ga0495684_0165858 Ga0495684_0165858_289_987 228
459 3300049576 Ga0501040_0661289 Ga0501040_0661289_32_718 228
460 3300005435 Ga0070714_100035658 Ga0070714_1000356586 229
461 3300005436 Ga0070713_100015164 Ga0070713_1000151646 229
462 3300005439 Ga0070711_100166546 Ga0070711_1001665463 229
463 3300006028 Ga0070717_10080521 Ga0070717_100805213 229
464 3300006175 Ga0070712_100151740 Ga0070712_1001517402 229
465 3300009177 Ga0105248_10621572 Ga0105248_106215722 229
466 3300025915 Ga0207693_10103616 Ga0207693_101036163 229
467 3300025916 Ga0207663_10648455 Ga0207663_106484551 229
468 3300025929 Ga0207664_10027284 Ga0207664_100272846 229
469 3300026078 Ga0207702_10256141 Ga0207702_102561412 229
470 3300035695 Ga0373927_0157975 Ga0373927_0157975_84_779 229
471 3300035724 Ga0373933_0024764 Ga0373933_0024764_2114_2809 229
472 3300036401 Ga0373937_0017647 Ga0373937_0017647_3566_4261 229
473 3300044712 Ga0453684_0616020 Ga0453684_0616020_84_803 229
474 3300005340 Ga0070689_100252999 Ga0070689_1002529992 230
475 3300005344 Ga0070661_100070988 Ga0070661_1000709882 230
476 3300005366 Ga0070659_100068616 Ga0070659_1000686162 230
477 3300005436 Ga0070713_100011179 Ga0070713_1000111794 230
478 3300005456 Ga0070678_100029205 Ga0070678_1000292053 230
479 3300005458 Ga0070681_10278669 Ga0070681_102786692 230
480 3300005563 Ga0068855_100232828 Ga0068855_1002328281 230
481 3300005564 Ga0070664_100099430 Ga0070664_1000994302 230
482 3300005614 Ga0068856_100039198 Ga0068856_1000391982 230
483 3300006028 Ga0070717_10132371 Ga0070717_101323713 230
484 3300010375 Ga0105239_10913614 Ga0105239_109136142 230
485 3300013105 Ga0157369_10001658 Ga0157369_1000165818 230
486 3300013105 Ga0157369_10258418 Ga0157369_102584182 230
487 3300013105 Ga0157369_10762999 Ga0157369_107629991 230
488 3300013296 Ga0157374_10013377 Ga0157374_100133774 230
489 3300013297 Ga0157378_10528588 Ga0157378_105285881 230
490 3300013307 Ga0157372_10119612 Ga0157372_101196123 230
491 3300013307 Ga0157372_10177581 Ga0157372_101775812 230
492 3300014969 Ga0157376_10298322 Ga0157376_102983222 230
493 3300025934 Ga0207686_10262465 Ga0207686_102624652 230
494 3300025936 Ga0207670_10219669 Ga0207670_102196692 230
495 3300025949 Ga0207667_10122473 Ga0207667_101224732 230
496 3300025949 Ga0207667_10163410 Ga0207667_101634103 230
497 3300026078 Ga0207702_10114177 Ga0207702_101141772 230
498 3300026121 Ga0207683_10092532 Ga0207683_100925322 230
499 3300049581 Ga0501047_0098218 Ga0501047_0098218_321_1013 230
500 3300049822 Ga0501035_0298501 Ga0501035_0298501_119_811 230
501 3300049823 Ga0501044_0001257 Ga0501044_0001257_5508_6200 230
502 3300005329 Ga0070683_100058234 Ga0070683_1000582342 231
503 3300005355 Ga0070671_100827823 Ga0070671_1008278231 231
504 3300005364 Ga0070673_100336184 Ga0070673_1003361842 231
505 3300005445 Ga0070708_100558281 Ga0070708_1005582811 231
506 3300005530 Ga0070679_100512726 Ga0070679_1005127261 231
507 3300005548 Ga0070665_100078224 Ga0070665_1000782245 231
508 3300005618 Ga0068864_100185073 Ga0068864_1001850732 231
509 3300005843 Ga0068860_100563834 Ga0068860_1005638342 231
510 3300006358 Ga0068871_100359031 Ga0068871_1003590312 231
511 3300006358 Ga0068871_100852967 Ga0068871_1008529671 231
512 3300006881 Ga0068865_100274378 Ga0068865_1002743782 231
513 3300009093 Ga0105240_10006267 Ga0105240_1000626711 231
514 3300009093 Ga0105240_10089673 Ga0105240_100896733 231
515 3300009093 Ga0105240_10313188 Ga0105240_103131882 231
516 3300009093 Ga0105240_10314740 Ga0105240_103147403 231
517 3300009098 Ga0105245_10049711 Ga0105245_100497114 231
518 3300009098 Ga0105245_10804944 Ga0105245_108049441 231
519 3300009177 Ga0105248_10098471 Ga0105248_100984712 231
520 3300009177 Ga0105248_10124733 Ga0105248_101247332 231
521 3300009177 Ga0105248_10955329 Ga0105248_109553291 231
522 3300009545 Ga0105237_10015643 Ga0105237_100156432 231
523 3300010375 Ga0105239_10306404 Ga0105239_103064043 231
524 3300013306 Ga0163162_10822549 Ga0163162_108225492 231
525 3300013308 Ga0157375_10534948 Ga0157375_105349482 231
526 3300014969 Ga0157376_10615948 Ga0157376_106159482 231
527 3300025913 Ga0207695_10012024 Ga0207695_100120245 231
528 3300025913 Ga0207695_10051958 Ga0207695_100519585 231
529 3300025913 Ga0207695_10256765 Ga0207695_102567652 231
530 3300025914 Ga0207671_10108868 Ga0207671_101088682 231
531 3300025916 Ga0207663_10150776 Ga0207663_101507762 231
532 3300025927 Ga0207687_10419155 Ga0207687_104191551 231
533 3300025941 Ga0207711_10057465 Ga0207711_100574653 231
534 3300025944 Ga0207661_10151759 Ga0207661_101517592 231
535 3300028379 Ga0268266_10356035 Ga0268266_103560352 231
536 3300028653 Ga0265323_10001994 Ga0265323_100019948 231
537 3300031235 Ga0265330_10059710 Ga0265330_100597101 231
538 3300035117 Ga0373953_0025325 Ga0373953_0025325_1223_1918 231
539 3300035119 Ga0373956_0091373 Ga0373956_0091373_61_756 231
540 3300035120 Ga0373957_0057038 Ga0373957_0057038_288_983 231
541 3300035172 Ga0373955_0082222 Ga0373955_0082222_543_1238 231
542 3300036401 Ga0373937_0084305 Ga0373937_0084305_231_926 231
543 3300046472 Ga0495580_0136585 Ga0495580_0136585_506_1201 231
544 3300046526 Ga0495666_0243213 Ga0495666_0243213_60_755 231
545 3300046559 Ga0495667_0225505 Ga0495667_0225505_129_824 231
546 3300048907 Ga0496104_0791158 Ga0496104_0791158_116_811 231
547 3300005617 Ga0068859_100502784 Ga0068859_1005027842 232
548 3300006028 Ga0070717_10013526 Ga0070717_100135267 232
549 3300006846 Ga0075430_100004116 Ga0075430_10000411613 232
550 3300006846 Ga0075430_100549595 Ga0075430_1005495952 232
551 3300006931 Ga0097620_100502784 Ga0097620_1005027843 232
552 3300013308 Ga0157375_11182723 Ga0157375_111827232 232
553 3300014325 Ga0163163_10084857 Ga0163163_100848573 232
554 3300025927 Ga0207687_10459244 Ga0207687_104592442 232
555 3300028800 Ga0265338_10099579 Ga0265338_100995793 232
556 3300029957 Ga0265324_10035251 Ga0265324_100352513 232
557 3300031239 Ga0265328_10047867 Ga0265328_100478672 232
558 3300031240 Ga0265320_10001179 Ga0265320_100011794 232
559 3300031241 Ga0265325_10073697 Ga0265325_100736972 232
560 3300031247 Ga0265340_10018603 Ga0265340_100186032 232
561 3300031249 Ga0265339_10024191 Ga0265339_100241913 232
562 3300031250 Ga0265331_10134913 Ga0265331_101349131 232
563 3300031344 Ga0265316_10001368 Ga0265316_1000136822 232
564 3300031344 Ga0265316_10004197 Ga0265316_1000419712 232
565 3300031344 Ga0265316_10008612 Ga0265316_100086124 232
566 3300031344 Ga0265316_10013572 Ga0265316_100135722 232
567 3300031344 Ga0265316_10015903 Ga0265316_100159034 232
568 3300031344 Ga0265316_10226197 Ga0265316_102261971 232
569 3300031711 Ga0265314_10011367 Ga0265314_100113674 232
570 3300031711 Ga0265314_10111058 Ga0265314_101110582 232
571 3300031712 Ga0265342_10125986 Ga0265342_101259862 232
572 3300035691 Ga0373931_0310722 Ga0373931_0310722_179_877 232
573 3300050509 nmdc:mga0qj67_510669_c1 nmdc:mga0qj67_510669_c1_198_896 232
574 3300060353 Ga0501082_0000199 Ga0501082_0000199_29387_30085 232
575 3300005518 Ga0070699_100069549 Ga0070699_1000695492 233
576 3300005543 Ga0070672_100154173 Ga0070672_1001541732 233
577 3300005563 Ga0068855_100092641 Ga0068855_1000926415 233
578 3300005616 Ga0068852_100365620 Ga0068852_1003656202 233
579 3300009551 Ga0105238_10492204 Ga0105238_104922042 233
580 3300014325 Ga0163163_10115921 Ga0163163_101159212 233
581 3300014969 Ga0157376_10327085 Ga0157376_103270852 233
582 3300021358 Ga0213873_10028021 Ga0213873_100280212 233
583 3300021361 Ga0213872_10000337 Ga0213872_1000033721 233
584 3300021384 Ga0213876_10142792 Ga0213876_101427922 233
585 3300025909 Ga0207705_10253061 Ga0207705_102530612 233
586 3300025949 Ga0207667_10080063 Ga0207667_100800635 233
587 3300026078 Ga0207702_10266649 Ga0207702_102666492 233
588 3300026142 Ga0207698_10156504 Ga0207698_101565042 233
589 3300035170 Ga0373943_0044678 Ga0373943_0044678_568_1272 233
590 3300035692 Ga0373935_0011987 Ga0373935_0011987_1609_2313 233
591 3300035725 Ga0373947_0021389 Ga0373947_0021389_1980_2684 233
592 3300037068 Ga0373925_0197725 Ga0373925_0197725_404_1108 233
593 3300037853 Ga0436364_0319084 Ga0436364_0319084_3292_3993 233
594 3300037853 Ga0436364_0699166 Ga0436364_0699166_137_844 233
595 3300039437 Ga0436365_0810573 Ga0436365_0810573_4105_4815 233
596 3300039447 Ga0436361_0793152 Ga0436361_0793152_8472_9185 233
597 3300039453 Ga0436362_0139354 Ga0436362_0139354_4277_4987 233
598 3300044712 Ga0453684_0246527 Ga0453684_0246527_20_721 233
599 3300045976 Ga0466967_0265592 Ga0466967_0265592_594_1295 233
600 3300046472 Ga0495580_0011536 Ga0495580_0011536_1014_1715 233
601 3300046472 Ga0495580_0013676 Ga0495580_0013676_3579_4280 233
602 3300046511 Ga0495608_0419503 Ga0495608_0419503_50_751 233
603 3300046529 Ga0495652_0351008 Ga0495652_0351008_209_910 233
604 3300046531 Ga0495665_0033307 Ga0495665_0033307_595_1296 233
605 3300046531 Ga0495665_0199065 Ga0495665_0199065_203_904 233
606 3300046559 Ga0495667_0051911 Ga0495667_0051911_1309_2010 233
607 3300047317 Ga0495604_0094000 Ga0495604_0094000_779_1480 233
608 3300047444 Ga0495675_0115170 Ga0495675_0115170_587_1288 233
609 3300048088 Ga0495602_0317269 Ga0495602_0317269_384_1085 233
610 3300050510 nmdc:mga06r32_7934_c1 nmdc:mga06r32_7934_c1_8380_9081 233
611 3300005327 Ga0070658_10001950 Ga0070658_1000195013 234
612 3300005329 Ga0070683_100000019 Ga0070683_10000001953 234
613 3300005329 Ga0070683_100131383 Ga0070683_1001313832 234
614 3300005329 Ga0070683_100408800 Ga0070683_1004088002 234
615 3300005336 Ga0070680_100224222 Ga0070680_1002242222 234
616 3300005337 Ga0070682_100054565 Ga0070682_1000545653 234
617 3300005339 Ga0070660_100260748 Ga0070660_1002607482 234
618 3300005367 Ga0070667_100159141 Ga0070667_1001591412 234
619 3300005455 Ga0070663_100043729 Ga0070663_1000437293 234
620 3300005458 Ga0070681_10039248 Ga0070681_100392482 234
621 3300005518 Ga0070699_100170336 Ga0070699_1001703362 234
622 3300005530 Ga0070679_100029497 Ga0070679_1000294972 234
623 3300005535 Ga0070684_100000003 Ga0070684_100000003111 234
624 3300005563 Ga0068855_100122286 Ga0068855_1001222862 234
625 3300005563 Ga0068855_100482082 Ga0068855_1004820822 234
626 3300005577 Ga0068857_100190026 Ga0068857_1001900262 234
627 3300005614 Ga0068856_100017001 Ga0068856_1000170012 234
628 3300005617 Ga0068859_100811833 Ga0068859_1008118332 234
629 3300005618 Ga0068864_100238417 Ga0068864_1002384172 234
630 3300005841 Ga0068863_100208467 Ga0068863_1002084672 234
631 3300006852 Ga0075433_10265231 Ga0075433_102652312 234
632 3300006931 Ga0097620_100811800 Ga0097620_1008118002 234
633 3300009093 Ga0105240_10320558 Ga0105240_103205582 234
634 3300009093 Ga0105240_10341934 Ga0105240_103419343 234
635 3300009177 Ga0105248_10084076 Ga0105248_100840762 234
636 3300009177 Ga0105248_10667654 Ga0105248_106676542 234
637 3300009553 Ga0105249_10006424 Ga0105249_100064245 234
638 3300013102 Ga0157371_10249358 Ga0157371_102493582 234
639 3300013104 Ga0157370_10549591 Ga0157370_105495912 234
640 3300013105 Ga0157369_10042841 Ga0157369_100428415 234
641 3300013105 Ga0157369_10320995 Ga0157369_103209952 234
642 3300013105 Ga0157369_10330484 Ga0157369_103304842 234
643 3300013307 Ga0157372_10014611 Ga0157372_100146117 234
644 3300013307 Ga0157372_10411308 Ga0157372_104113082 234
645 3300014969 Ga0157376_10044253 Ga0157376_100442532 234
646 3300021384 Ga0213876_10001214 Ga0213876_1000121415 234
647 3300021384 Ga0213876_10074751 Ga0213876_100747512 234
648 3300021384 Ga0213876_10091139 Ga0213876_100911392 234
649 3300021388 Ga0213875_10000055 Ga0213875_1000005575 234
650 3300021388 Ga0213875_10000108 Ga0213875_1000010872 234
651 3300021388 Ga0213875_10010188 Ga0213875_100101885 234
652 3300021388 Ga0213875_10015031 Ga0213875_100150312 234
653 3300021388 Ga0213875_10072622 Ga0213875_100726222 234
654 3300021388 Ga0213875_10278870 Ga0213875_102788701 234
655 3300025909 Ga0207705_10057769 Ga0207705_100577694 234
656 3300025912 Ga0207707_10100588 Ga0207707_101005882 234
657 3300025912 Ga0207707_10119632 Ga0207707_101196322 234
658 3300025913 Ga0207695_10005525 Ga0207695_1000552512 234
659 3300025913 Ga0207695_10478877 Ga0207695_104788772 234
660 3300025917 Ga0207660_10411795 Ga0207660_104117952 234
661 3300025919 Ga0207657_10283510 Ga0207657_102835102 234
662 3300025921 Ga0207652_10119181 Ga0207652_101191813 234
663 3300025936 Ga0207670_10601007 Ga0207670_106010072 234
664 3300025944 Ga0207661_10000019 Ga0207661_10000019107 234
665 3300025944 Ga0207661_10415840 Ga0207661_104158402 234
666 3300025949 Ga0207667_10100696 Ga0207667_101006962 234
667 3300026067 Ga0207678_10042953 Ga0207678_100429533 234
668 3300026078 Ga0207702_10056240 Ga0207702_100562405 234
669 3300026088 Ga0207641_10021590 Ga0207641_100215907 234
670 3300026095 Ga0207676_10240478 Ga0207676_102404782 234
671 3300026116 Ga0207674_10195251 Ga0207674_101952512 234
672 3300028800 Ga0265338_10175597 Ga0265338_101755972 234
673 3300031344 Ga0265316_10001444 Ga0265316_1000144410 234
674 3300031344 Ga0265316_10015592 Ga0265316_100155927 234
675 3300031344 Ga0265316_10120136 Ga0265316_101201361 234
676 3300035695 Ga0373927_0361506 Ga0373927_0361506_241_945 234
677 3300036401 Ga0373937_0196111 Ga0373937_0196111_699_1466 234
678 3300037853 Ga0436364_0115933 Ga0436364_0115933_12029_12736 234
679 3300037853 Ga0436364_0134922 Ga0436364_0134922_65_775 234
680 3300037853 Ga0436364_0148095 Ga0436364_0148095_2553_3263 234
681 3300037853 Ga0436364_0205975 Ga0436364_0205975_3430_4143 234
682 3300037853 Ga0436364_0334136 Ga0436364_0334136_187_909 234
683 3300037853 Ga0436364_0633516 Ga0436364_0633516_18899_19615 234
684 3300037853 Ga0436364_0755992 Ga0436364_0755992_2463_3170 234
685 3300037853 Ga0436364_0835808 Ga0436364_0835808_2175_2888 234
686 3300037853 Ga0436364_0836594 Ga0436364_0836594_693_1403 234
687 3300037853 Ga0436364_1104632 Ga0436364_1104632_236_946 234
688 3300037853 Ga0436364_1193035 Ga0436364_1193035_3445_4152 234
689 3300037853 Ga0436364_1293248 Ga0436364_1293248_842_1549 234
690 3300037853 Ga0436364_1298937 Ga0436364_1298937_8081_8785 234
691 3300037853 Ga0436364_1299576 Ga0436364_1299576_748_1455 234
692 3300037853 Ga0436364_1375522 Ga0436364_1375522_858_1565 234
693 3300038443 Ga0395901_0203680 Ga0395901_0203680_475_1179 234
694 3300039437 Ga0436365_0340201 Ga0436365_0340201_2570_3277 234
695 3300039437 Ga0436365_0461265 Ga0436365_0461265_906_1613 234
696 3300039437 Ga0436365_0809363 Ga0436365_0809363_1539_2252 234
697 3300039437 Ga0436365_1178155 Ga0436365_1178155_530_1240 234
698 3300039437 Ga0436365_1778817 Ga0436365_1778817_6256_6963 234
699 3300039450 Ga0436363_1405280 Ga0436363_1405280_139_861 234
700 3300039450 Ga0436363_1437195 Ga0436363_1437195_672_1388 234
701 3300039453 Ga0436362_0507053 Ga0436362_0507053_1129_1842 234
702 3300045051 Ga0451576_0065958 Ga0451576_0065958_1683_2396 234
703 3300045051 Ga0451576_0311321 Ga0451576_0311321_345_1073 234
704 3300046462 Ga0495651_0002965 Ga0495651_0002965_1054_1821 234
705 3300046472 Ga0495580_0058744 Ga0495580_0058744_1787_2491 234
706 3300046499 Ga0495594_0224652 Ga0495594_0224652_106_810 234
707 3300046516 Ga0495628_0133784 Ga0495628_0133784_979_1746 234
708 3300046559 Ga0495667_0045667 Ga0495667_0045667_909_1676 234
709 3300046678 Ga0495599_0050812 Ga0495599_0050812_660_1427 234
710 3300046679 Ga0495623_0009599 Ga0495623_0009599_2260_3027 234
711 3300046679 Ga0495623_0098521 Ga0495623_0098521_797_1564 234
712 3300047319 Ga0495674_0116622 Ga0495674_0116622_969_1736 234
713 3300047319 Ga0495674_0623856 Ga0495674_0623856_42_809 234
714 3300047444 Ga0495675_0036019 Ga0495675_0036019_1160_1927 234
715 3300047471 Ga0495684_0005866 Ga0495684_0005866_5261_6028 234
716 3300048918 Ga0496115_0209306 Ga0496115_0209306_366_1070 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

1

223

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5abt-assembly1.cif.gz_A s.enterica hisa mutant d7n, g102a, v106m, d176a 0.8965 1 229
5a5w-assembly1.cif.gz_A crystal structure of salmonella enterica hisa d7n d176a with profar 0.8943 1 229
3tdm-assembly2.cif.gz_C computationally designed tim-barrel protein, halfflr 0.8907 122 219
5ac6-assembly1.cif.gz_A s.enterica hisa mutant d10g, dup13-15, q24l, g102a 0.8896 1 229
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.8884 2 229
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9349 1 229 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9144 1 226 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9118 1 229 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9089 2 216 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.881 1 226 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7S7SMJ8-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 0.9921 1 230 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A838N3U2-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 0.9914 85 230 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V8X4V7-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase 0.9904 108 223 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V9U255-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9821 124 226 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V8GIP3-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9803 70 226 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Feature Viewer

pLDDT pTM Quality
92.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map