F477019

General Info

Members Datasets Scaffolds Average Seq Length
715 446 535 340

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2501025504|2501410484
Length 396
Sequence PAFAGPLSLVPVRAALRALAAPVRRLTRLTRLTRLTRLTRLTRLTRLTRLTRLPRLTRFSHALPLAAGAAALVAGLAAPLAAQADQTAICYNCPPEWADWASQIQAIQKETGIRVPFDNKNSGQSIAQLMAEQKSPVADVVYLGVSSAFQAKDKGVITPYKPAHWNDIPADLKDPQGYWFAIHSGTLGFFVNKDALEGKPVPHSWADLLKPEYKGMVGYLDPSSAFVGYAGAVAVNLALGGTLDNFQPAFEWFGKLKANQPIVPKQTAYARVLSGEIPILLDYDFDAYRAKYKDHANVEFVIPKEGTISVPYVMSLVKNGPHEANGKKVLDFVLSDEGQKLWANAYLRPVRASALSPEAASKFLPASDYARAKPVDFAKMAAQQQAFGERYLQIMH

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
4 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
8 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
9 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
10 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
11 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
12 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
13 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
14 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
15 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
16 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
17 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
21 2519103095 Burkholderia sp. KJ006 Isolate Nodule
22 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
23 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
24 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
25 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
26 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
27 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
28 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
29 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
30 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
31 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
32 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
33 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
34 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
35 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
36 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
37 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
38 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
39 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
40 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
41 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
42 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
43 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
44 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
45 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
46 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
47 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
48 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
49 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
50 2643221609 Acidovorax sp. Root217 Isolate Unclassified
51 2643221611 Acidovorax sp. Root219 Isolate Unclassified
52 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
53 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
54 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
55 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
56 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
57 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
58 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
59 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
60 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
61 2721755523 Delftia sp. HK171 Isolate Unclassified
62 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
63 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
64 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
65 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
66 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
67 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
68 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
69 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
70 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
71 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
72 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
73 2738543012 Acidovorax sp. CF301 Isolate Unclassified
74 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
75 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
76 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
77 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
78 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
79 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
80 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
81 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
82 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
83 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
84 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
85 2816332133 Acidovorax radicis 2721A Isolate Unclassified
86 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
87 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
88 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
89 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
90 2818991450 Burkholderia sp. 604 Isolate Unclassified
91 2818991452 Burkholderia cepacia 561 Isolate Unclassified
92 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
93 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
94 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
95 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
96 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
97 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
98 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
99 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
100 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
101 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
102 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
103 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
104 2855730933 Achromobacter sp. HZ28 Isolate Nodule
105 2855767633 Achromobacter sp. HZ34 Isolate Nodule
106 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
107 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
108 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
109 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
110 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
111 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
112 2865014394 Pantoea sp. R-71966 Isolate Unclassified
113 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
114 2876601092 Pantoea endophytica 596 Isolate Unclassified
115 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
116 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
117 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
118 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
119 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
120 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
121 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
122 2904564687 Burkholderia sp. 571 Isolate Unclassified
123 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
124 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
125 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
126 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
127 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
128 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
129 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
130 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
131 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
132 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
133 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
134 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
135 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
136 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
137 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
138 2928163908 Burkholderia sp. 567 Isolate Unclassified
139 2928170801 Burkholderia sp. 572 Isolate Unclassified
140 2928536128 Burkholderia sola 565 Isolate Unclassified
141 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
142 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
143 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
144 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
145 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
146 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
147 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
148 2952252522 Salinicola sp. DM10 Isolate Unclassified
149 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
150 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
151 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
152 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
153 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
154 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
155 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
156 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
157 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
158 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
159 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
160 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
161 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
162 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
163 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
164 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
165 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
166 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
167 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
168 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
169 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
170 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
171 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
172 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
173 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
174 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
175 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
176 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
177 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
178 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
179 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
180 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
181 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
182 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
183 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
184 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
185 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
186 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
187 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
188 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
189 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
190 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
191 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
192 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
193 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
194 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
195 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
196 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
197 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
198 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
199 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
200 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
201 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
202 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
203 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
204 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
205 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
206 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
207 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
208 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
209 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
210 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
211 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
212 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
213 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
214 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
215 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
216 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
217 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
218 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
219 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
220 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
221 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
222 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
223 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
224 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
225 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
226 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
227 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
228 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
229 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
230 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
231 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
232 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
233 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
234 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
235 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
241 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
243 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
244 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
245 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
250 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
283 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
285 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
287 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
288 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
289 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
290 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
291 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
292 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
296 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
297 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
298 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
299 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
300 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
301 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
304 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
305 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
306 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
307 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
308 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
309 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
310 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
311 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
312 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
313 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
314 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
315 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
316 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
317 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
318 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
319 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
320 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
321 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
322 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
323 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
324 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
325 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
326 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
327 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
328 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
329 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
330 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
331 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
332 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
333 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
334 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
335 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
336 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
337 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
338 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
339 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
340 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
343 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
344 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
349 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
350 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
351 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
356 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
357 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
358 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
359 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
362 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
363 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
364 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
365 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
366 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
367 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
368 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
369 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
370 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
371 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
372 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
373 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
374 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
375 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
376 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
377 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
378 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
379 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
380 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
381 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
382 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
383 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
384 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
385 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
386 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
387 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
388 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
394 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
395 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
396 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
397 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
398 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
399 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
400 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
401 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
402 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
403 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
404 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
405 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
406 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
407 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
408 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
409 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
410 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
411 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
412 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
413 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
414 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
415 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
420 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
421 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
422 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
423 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
424 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
425 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
426 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
427 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
428 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
429 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
430 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
431 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
432 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
433 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
434 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
435 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
436 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
437 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
438 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
439 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
440 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
441 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
442 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
443 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
444 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
445 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
446 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.83
Metatranscriptomes 0
Isolates 25.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.56
Bulb 0
Endosphere 8.39
Nodule 3.36
Rhizoplane 6.29
Rhizosphere 60.42
Stem 0
Stem Tuber 0
Unclassified 20.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6865 2124908027 Bacteria 2759
2 MRS1b_contig_1130785 2162886011 Bacteria 1481
3 JGI24740J21852_10003531 3300001979 Bacteria 6850
4 JGI24740J21852_10044095 3300001979 Bacteria 1326
5 JGI24739J22299_10000111 3300001989 Bacteria 25218
6 JGI24739J22299_10009313 3300001989 Bacteria 3663
7 JGI24739J22299_10009453 3300001989 Bacteria 3633
8 JGI24735J21928_10000087 3300002067 Bacteria 35083
9 JGI24738J21930_10002901 3300002075 Bacteria 4390
10 JGI25156J39149_1000429 3300002705 Bacteria 26030
11 JGI25156J39149_1002844 3300002705 Bacteria 5955
12 JGI25156J39149_1017479 3300002705 Bacteria 1357
13 JGI25162J39368_1004043 3300002737 Bacteria 3672
14 JGI25165J46597_1000886 3300003214 Bacteria 21064
15 rootL2_10038977 3300003322 Bacteria 5679
16 rootL2_10137897 3300003322 Bacteria 2831
17 JGI25160J50197_1001438 3300003354 Bacteria 11911
18 Ga0055533_1000253 3300003756 Bacteria 32721
19 Ga0055533_1000303 3300003756 Bacteria 24530
20 Ga0055533_1001847 3300003756 Bacteria 5300
21 Ga0055532_1000001 3300003758 Bacteria 1119836
22 Ga0055532_1002855 3300003758 Bacteria 3304
23 Ga0055527_1000002 3300003760 Bacteria 830488
24 Ga0055527_1000564 3300003760 Bacteria 12217
25 Ga0055527_1000600 3300003760 Bacteria 11625
26 Ga0055535_1000001 3300003761 Bacteria 1119836
27 Ga0055535_1001424 3300003761 Bacteria 12217
28 Ga0055535_1001498 3300003761 Bacteria 11625
29 Ga0055542_1000001 3300003762 Bacteria 1119836
30 Ga0055542_1001400 3300003762 Bacteria 12217
31 Ga0055529_1000001 3300003763 Bacteria 826680
32 Ga0055529_1000418 3300003763 Bacteria 43789
33 Ga0055530_10000016 3300003791 Bacteria 146874
34 Ga0055540_1000048 3300003792 Bacteria 146874
35 Ga0058692_1000510 3300003856 Bacteria 17182
36 Ga0058692_1000633 3300003856 Bacteria 14532
37 Ga0058692_1000833 3300003856 Bacteria 12218
38 Ga0058692_1002146 3300003856 Bacteria 6783
39 Ga0065165_1002944 3300005262 Bacteria 12976
40 Ga0065714_10003520 3300005288 Bacteria 9242
41 Ga0065714_10066603 3300005288 Bacteria 6571
42 Ga0065704_10015303 3300005289 Bacteria 3570
43 Ga0065712_10000124 3300005290 Bacteria 105429
44 Ga0065712_10171664 3300005290 Bacteria 1240
45 Ga0070658_10008756 3300005327 Bacteria 8130
46 Ga0070658_10120180 3300005327 Bacteria 2183
47 Ga0070676_10062871 3300005328 Bacteria 2210
48 Ga0070670_100003668 3300005331 Bacteria 12797
49 Ga0070670_100004735 3300005331 Bacteria 11419
50 Ga0070670_100006345 3300005331 Bacteria 10007
51 Ga0070677_10002183 3300005333 Bacteria 6252
52 Ga0070660_100000028 3300005339 Bacteria 88388
53 Ga0070661_100000025 3300005344 Bacteria 121698
54 Ga0070661_100109132 3300005344 Bacteria 2065
55 Ga0070668_100008307 3300005347 Bacteria 7706
56 Ga0070669_100002340 3300005353 Bacteria 13700
57 Ga0070669_100101741 3300005353 Bacteria 2169
58 Ga0070675_100002569 3300005354 Bacteria 13593
59 Ga0070671_100018623 3300005355 Bacteria 5641
60 Ga0070674_100001349 3300005356 Bacteria 12937
61 Ga0070659_100000152 3300005366 Bacteria 52790
62 Ga0070667_100157580 3300005367 Bacteria 1998
63 Ga0070694_100219837 3300005444 Bacteria 1424
64 Ga0070663_100002650 3300005455 Bacteria 10129
65 Ga0070678_100014570 3300005456 Bacteria 4967
66 Ga0070662_100004610 3300005457 Bacteria 8732
67 Ga0070662_100007483 3300005457 Bacteria 7081
68 Ga0070685_10179210 3300005466 Bacteria 1363
69 Ga0068853_100131074 3300005539 Bacteria 2244
70 Ga0070672_100005395 3300005543 Bacteria 8468
71 Ga0068855_100077059 3300005563 Bacteria 3868
72 Ga0068855_100136676 3300005563 Bacteria 2796
73 Ga0070664_100000019 3300005564 Bacteria 121708
74 Ga0068851_10000170 3300005834 Bacteria 33347
75 Ga0068851_10061925 3300005834 Bacteria 1919
76 Ga0075364_10006083 3300006051 Bacteria 7071
77 Ga0075364_10029261 3300006051 Bacteria 3532
78 Ga0075432_10001128 3300006058 Bacteria 8551
79 Ga0075366_10044050 3300006195 Bacteria 2644
80 Ga0097621_100048533 3300006237 Bacteria 3444
81 Ga0079104_1000004 3300006946 Bacteria 444549
82 Ga0105251_10000164 3300009011 Bacteria 68693
83 Ga0105251_10000870 3300009011 Bacteria 27091
84 Ga0105251_10004080 3300009011 Bacteria 10241
85 Ga0105251_10005616 3300009011 Bacteria 8157
86 Ga0105251_10005977 3300009011 Bacteria 7854
87 Ga0105251_10019299 3300009011 Bacteria 3605
88 Ga0105251_10020137 3300009011 Bacteria 3509
89 Ga0105251_10025501 3300009011 Bacteria 3023
90 Ga0105251_10071664 3300009011 Bacteria 1612
91 Ga0105244_10000327 3300009036 Bacteria 45346
92 Ga0105244_10001910 3300009036 Bacteria 16181
93 Ga0105244_10001938 3300009036 Bacteria 16083
94 Ga0105244_10002043 3300009036 Bacteria 15550
95 Ga0105244_10002430 3300009036 Bacteria 14052
96 Ga0105244_10004588 3300009036 Bacteria 9455
97 Ga0105244_10020953 3300009036 Bacteria 3622
98 Ga0105250_10000337 3300009092 Bacteria 36160
99 Ga0105250_10003445 3300009092 Bacteria 7496
100 Ga0105250_10018785 3300009092 Bacteria 2797
101 Ga0105243_10000067 3300009148 Bacteria 123656
102 Ga0105243_10002650 3300009148 Bacteria 14865
103 Ga0105242_10002802 3300009176 Bacteria 13656
104 Ga0105242_10442567 3300009176 Bacteria 1223
105 Ga0105248_10097045 3300009177 Bacteria 3321
106 Ga0105248_10129630 3300009177 Bacteria 2845
107 Ga0105237_10000093 3300009545 Bacteria 122006
108 Ga0105237_10229880 3300009545 Bacteria 1855
109 Ga0105238_10018266 3300009551 Bacteria 7133
110 Ga0105246_10002024 3300011119 Bacteria 12250
111 Ga0105246_10008857 3300011119 Bacteria 6193
112 Ga0105246_10009427 3300011119 Bacteria 6017
113 Ga0105246_10018354 3300011119 Bacteria 4458
114 Ga0157373_10000739 3300013100 Bacteria 25327
115 Ga0157373_10047786 3300013100 Bacteria 3052
116 Ga0157373_10087852 3300013100 Bacteria 2190
117 Ga0157373_10103295 3300013100 Bacteria 2005
118 Ga0157373_10131437 3300013100 Bacteria 1760
119 Ga0157371_10000780 3300013102 Bacteria 36631
120 Ga0157371_10013564 3300013102 Bacteria 6187
121 Ga0157371_10020225 3300013102 Bacteria 4899
122 Ga0157370_10000053 3300013104 Bacteria 119285
123 Ga0157370_10001977 3300013104 Bacteria 25193
124 Ga0157370_10037342 3300013104 Bacteria 4709
125 Ga0157370_10284624 3300013104 Bacteria 1527
126 Ga0157370_10285909 3300013104 Bacteria 1523
127 Ga0157369_10002960 3300013105 Bacteria 20309
128 Ga0157369_10011611 3300013105 Bacteria 10001
129 Ga0157369_10012325 3300013105 Bacteria 9711
130 Ga0171462_1023 3300013250 Bacteria 136797
131 Ga0157378_10205415 3300013297 Bacteria 1865
132 Ga0163162_10065393 3300013306 Bacteria 3683
133 Ga0163162_10242625 3300013306 Bacteria 1933
134 Ga0163162_10257219 3300013306 Bacteria 1878
135 Ga0163162_10472826 3300013306 Bacteria 1385
136 Ga0157372_10027933 3300013307 Bacteria 6150
137 Ga0157375_10001719 3300013308 Bacteria 18803
138 Ga0157375_10052240 3300013308 Bacteria 4017
139 Ga0157375_10070605 3300013308 Bacteria 3503
140 Ga0182008_10009313 3300014497 Bacteria 5307
141 Ga0182008_10059835 3300014497 Bacteria 1879
142 Ga0182008_10089892 3300014497 Bacteria 1513
143 Ga0157376_10152552 3300014969 Bacteria 2085
144 Ga0182006_1006542 3300015261 Bacteria 5407
145 Ga0182007_10002335 3300015262 Bacteria 9499
146 Ga0182007_10008173 3300015262 Bacteria 4315
147 Ga0182007_10009615 3300015262 Bacteria 3882
148 Ga0182007_10034779 3300015262 Bacteria 1700
149 Ga0182005_1011725 3300015265 Bacteria 2491
150 Ga0183361_10006 3300016635 Bacteria 368532
151 Ga0163161_10004415 3300017792 Bacteria 9809
152 Ga0213872_10045946 3300021361 Bacteria 1987
153 Ga0209566_100276 3300025225 Bacteria 47894
154 Ga0209674_100005 3300025226 Bacteria 1708125
155 Ga0209674_100146 3300025226 Bacteria 98804
156 Ga0209674_103030 3300025226 Bacteria 3239
157 Ga0209672_100001 3300025228 Bacteria 2828210
158 Ga0209672_100019 3300025228 Bacteria 432215
159 Ga0209672_100069 3300025228 Bacteria 174956
160 Ga0209147_100001 3300025229 Bacteria 2384371
161 Ga0209147_100026 3300025229 Bacteria 421622
162 Ga0209147_100044 3300025229 Bacteria 300330
163 Ga0209147_100128 3300025229 Bacteria 122259
164 Ga0209563_104186 3300025230 Bacteria 2804
165 Ga0209437_100115 3300025233 Bacteria 209911
166 Ga0209258_100001 3300025242 Bacteria 2384269
167 Ga0209258_100031 3300025242 Bacteria 463572
168 Ga0209258_100079 3300025242 Bacteria 263132
169 Ga0209148_1000003 3300025254 Bacteria 2384288
170 Ga0209148_1000027 3300025254 Bacteria 616374
171 Ga0209148_1001002 3300025254 Bacteria 17931
172 Ga0209759_1000079 3300025256 Bacteria 174354
173 Ga0209759_1000088 3300025256 Bacteria 165748
174 Ga0209759_1007984 3300025256 Bacteria 3343
175 Ga0209759_1019292 3300025256 Bacteria 1622
176 Ga0209233_1000016 3300025261 Bacteria 907830
177 Ga0209455_1000001 3300025272 Bacteria 2384278
178 Ga0209455_1000058 3300025272 Bacteria 342028
179 Ga0209455_1000421 3300025272 Bacteria 33292
180 Ga0209673_1000059 3300025273 Bacteria 268892
181 Ga0209676_1003489 3300025292 Bacteria 9630
182 Ga0209025_1002963 3300025294 Bacteria 16867
183 Ga0209564_1001947 3300025295 Bacteria 18289
184 Ga0209564_1011838 3300025295 Bacteria 3868
185 Ga0209050_1000013 3300025298 Bacteria 811408
186 Ga0207426_1000245 3300025302 Bacteria 120041
187 Ga0209051_1000007 3300025303 Bacteria 811408
188 Ga0207656_10042641 3300025321 Bacteria 1932
189 Ga0207696_1000035 3300025711 Bacteria 339626
190 Ga0207696_1000090 3300025711 Bacteria 188474
191 Ga0207696_1000176 3300025711 Bacteria 100134
192 Ga0207696_1000177 3300025711 Bacteria 100134
193 Ga0207696_1000348 3300025711 Bacteria 47596
194 Ga0207655_1000006 3300025728 Bacteria 861092
195 Ga0207655_1000137 3300025728 Bacteria 140084
196 Ga0207655_1000171 3300025728 Bacteria 118865
197 Ga0207655_1000628 3300025728 Bacteria 42395
198 Ga0207655_1002225 3300025728 Bacteria 16067
199 Ga0207655_1002878 3300025728 Bacteria 13293
200 Ga0207655_1033103 3300025728 Bacteria 2349
201 Ga0207655_1048410 3300025728 Bacteria 1745
202 Ga0207713_1000001 3300025735 Bacteria 2295391
203 Ga0207713_1000716 3300025735 Bacteria 30986
204 Ga0207713_1004703 3300025735 Bacteria 8791
205 Ga0207713_1006091 3300025735 Bacteria 7426
206 Ga0207713_1048709 3300025735 Bacteria 1704
207 Ga0207682_10003822 3300025893 Bacteria 6463
208 Ga0207647_10015111 3300025904 Bacteria 5303
209 Ga0207647_10159390 3300025904 Bacteria 1317
210 Ga0207645_10019998 3300025907 Bacteria 4383
211 Ga0207705_10000545 3300025909 Bacteria 31747
212 Ga0207695_10000625 3300025913 Bacteria 70978
213 Ga0207671_10000261 3300025914 Bacteria 79200
214 Ga0207671_10032044 3300025914 Bacteria 3914
215 Ga0207657_10000001 3300025919 Bacteria 458536
216 Ga0207649_10000207 3300025920 Bacteria 49166
217 Ga0207681_10012408 3300025923 Bacteria 5259
218 Ga0207650_10000145 3300025925 Bacteria 85892
219 Ga0207650_10001015 3300025925 Bacteria 21083
220 Ga0207650_10001027 3300025925 Bacteria 20954
221 Ga0207659_10001133 3300025926 Bacteria 15808
222 Ga0207644_10021910 3300025931 Bacteria 4358
223 Ga0207690_10000072 3300025932 Bacteria 88241
224 Ga0207706_10002953 3300025933 Bacteria 16416
225 Ga0207686_10008721 3300025934 Bacteria 5477
226 Ga0207709_10000004 3300025935 Bacteria 825156
227 Ga0207709_10000138 3300025935 Bacteria 104006
228 Ga0207669_10106232 3300025937 Bacteria 1869
229 Ga0207691_10001104 3300025940 Bacteria 26843
230 Ga0207679_10000045 3300025945 Bacteria 121851
231 Ga0207667_10001276 3300025949 Bacteria 31586
232 Ga0207651_10003576 3300025960 Bacteria 7641
233 Ga0207668_10187802 3300025972 Bacteria 1635
234 Ga0207639_10027034 3300026041 Bacteria 4175
235 Ga0207678_10001622 3300026067 Bacteria 20679
236 Ga0207683_10004624 3300026121 Bacteria 11862
237 Ga0209281_1000005 3300027111 Bacteria 1242284
238 Ga0209371_1000084 3300027312 Bacteria 180842
239 Ga0209371_1000127 3300027312 Bacteria 127069
240 Ga0209371_1000186 3300027312 Bacteria 90597
241 Ga0209371_1000190 3300027312 Bacteria 89981
242 Ga0209371_1000258 3300027312 Bacteria 64241
243 Ga0209371_1000457 3300027312 Bacteria 40260
244 Ga0209371_1001415 3300027312 Bacteria 16436
245 Ga0209371_1007034 3300027312 Bacteria 4015
246 Ga0209371_1008131 3300027312 Bacteria 3534
247 Ga0207428_10012907 3300027907 Bacteria 7324
248 Ga0268266_10183440 3300028379 Bacteria 1907
249 Ga0265338_10000437 3300028800 Bacteria 74941
250 Ga0268256_1000069 3300030500 Bacteria 195391
251 Ga0268256_1000075 3300030500 Bacteria 180814
252 Ga0268256_1000104 3300030500 Bacteria 127069
253 Ga0268256_1000215 3300030500 Bacteria 64669
254 Ga0268256_1000439 3300030500 Bacteria 37097
255 Ga0268256_1001212 3300030500 Bacteria 16436
256 Ga0268256_1004606 3300030500 Bacteria 5655
257 Ga0268256_1008907 3300030500 Bacteria 3390
258 Ga0307511_10000406 3300030521 Bacteria 45893
259 Ga0307408_100123246 3300031548 Bacteria 2011
260 Ga0307405_10000073 3300031731 Bacteria 44879
261 Ga0307405_10012594 3300031731 Bacteria 4485
262 Ga0307412_10000008 3300031911 Bacteria 461034
263 Ga0307416_100163487 3300032002 Bacteria 2061
264 Ga0373924_0002525 3300035410 Bacteria 6167
265 Ga0395901_0000011 3300038443 Bacteria 400724
266 Ga0400484_35478 3300038725 Bacteria 1485
267 Ga0400490_35226 3300038726 Bacteria 5129
268 Ga0400483_099993 3300039062 Bacteria 19421
269 Ga0400483_229956 3300039062 Bacteria 24419
270 Ga0400487_02139 3300039110 Bacteria 2134
271 Ga0436361_0296121 3300039447 Bacteria 160237
272 Ga0436361_0865024 3300039447 Bacteria 19252
273 Ga0439436_0016981 3300041404 Bacteria 2179
274 Ga0439447_040104 3300041407 Bacteria 1144
275 Ga0439465_0009313 3300041413 Bacteria 3094
276 Ga0439433_0000364 3300041999 Bacteria 8025
277 Ga0439445_0002315 3300042004 Bacteria 4226
278 Ga0439432_004301 3300042006 Bacteria 5206
279 Ga0439449_0006098 3300042007 Bacteria 4606
280 Ga0439452_000015 3300042010 Bacteria 342948
281 Ga0439452_000914 3300042010 Bacteria 13457
282 Ga0439462_0025859 3300042015 Bacteria 1546
283 Ga0450907_000104 3300042146 Bacteria 32519
284 Ga0439464_0016940 3300042439 Bacteria 1973
285 Ga0439464_0029536 3300042439 Bacteria 1532
286 Ga0451577_0038179 3300042876 Bacteria 4319
287 Ga0466965_0023874 3300044683 Bacteria 2955
288 Ga0466966_0000002 3300044684 Bacteria 370962
289 Ga0466961_0002576 3300044693 Bacteria 11238
290 Ga0466961_0111305 3300044693 Bacteria 1722
291 Ga0466963_0007401 3300044694 Bacteria 6542
292 Ga0466963_0204480 3300044694 Bacteria 1381
293 Ga0453684_0009647 3300044712 Bacteria 16822
294 Ga0453684_0061215 3300044712 Bacteria 4834
295 Ga0466971_0004081 3300044719 Bacteria 6286
296 Ga0466957_0130658 3300044842 Bacteria 1608
297 Ga0466957_0198140 3300044842 Bacteria 1318
298 Ga0466959_0040833 3300045049 Bacteria 3426
299 Ga0466958_0002465 3300045836 Bacteria 9300
300 Ga0495627_000023 3300046453 Bacteria 251113
301 Ga0495592_0000085 3300046454 Bacteria 82502
302 Ga0495592_0026430 3300046454 Bacteria 4401
303 Ga0495603_0009018 3300046455 Bacteria 6034
304 Ga0495603_0012089 3300046455 Bacteria 5226
305 Ga0495590_0001854 3300046457 Bacteria 8939
306 Ga0495590_0007039 3300046457 Bacteria 4359
307 Ga0495590_0026329 3300046457 Bacteria 2042
308 Ga0495591_000025 3300046458 Bacteria 189897
309 Ga0495591_009570 3300046458 Bacteria 3835
310 Ga0495629_0000022 3300046459 Bacteria 151761
311 Ga0495629_0001615 3300046459 Bacteria 17706
312 Ga0495629_0003716 3300046459 Bacteria 11502
313 Ga0495641_0013663 3300046461 Bacteria 4447
314 Ga0495641_0031135 3300046461 Bacteria 2551
315 Ga0495651_0123433 3300046462 Bacteria 1899
316 Ga0495653_0001160 3300046463 Bacteria 20299
317 Ga0495653_0007937 3300046463 Bacteria 8688
318 Ga0495653_0009844 3300046463 Bacteria 7817
319 Ga0495653_0077557 3300046463 Bacteria 2466
320 Ga0495650_0000149 3300046471 Bacteria 159524
321 Ga0495650_0001500 3300046471 Bacteria 22243
322 Ga0495650_0007453 3300046471 Bacteria 6569
323 Ga0495650_0020989 3300046471 Bacteria 3170
324 Ga0495580_0000047 3300046472 Bacteria 68842
325 Ga0495580_0001313 3300046472 Bacteria 21956
326 Ga0495580_0003496 3300046472 Bacteria 13367
327 Ga0495580_0070679 3300046472 Bacteria 2438
328 Ga0495580_0189525 3300046472 Bacteria 1418
329 Ga0495580_0189530 3300046472 Bacteria 1418
330 Ga0495582_0076613 3300046473 Bacteria 1854
331 Ga0495605_0000848 3300046474 Bacteria 21346
332 Ga0495605_0001095 3300046474 Bacteria 18057
333 Ga0495605_0001468 3300046474 Bacteria 15396
334 Ga0495605_0015260 3300046474 Bacteria 4184
335 Ga0495605_0042865 3300046474 Bacteria 2246
336 Ga0495639_0000049 3300046475 Bacteria 52674
337 Ga0495662_0011151 3300046476 Bacteria 4391
338 Ga0495664_0000200 3300046477 Bacteria 28962
339 Ga0495585_0025767 3300046492 Bacteria 3364
340 Ga0495594_0002273 3300046499 Bacteria 10011
341 Ga0495607_0000069 3300046501 Bacteria 101754
342 Ga0495607_0001068 3300046501 Bacteria 25025
343 Ga0495607_0022294 3300046501 Bacteria 3979
344 Ga0495607_0085198 3300046501 Bacteria 1726
345 Ga0495607_0100113 3300046501 Bacteria 1554
346 Ga0495583_0004214 3300046506 Bacteria 10464
347 Ga0495583_0016067 3300046506 Bacteria 4041
348 Ga0495606_0000155 3300046507 Bacteria 119163
349 Ga0495606_0001836 3300046507 Bacteria 26858
350 Ga0495606_0114438 3300046507 Bacteria 1623
351 Ga0495610_0001890 3300046512 Bacteria 18092
352 Ga0495616_0111828 3300046513 Bacteria 1268
353 Ga0495618_0128142 3300046514 Bacteria 1624
354 Ga0495620_0000110 3300046515 Bacteria 65755
355 Ga0495620_0013063 3300046515 Bacteria 4262
356 Ga0495628_0009213 3300046516 Bacteria 8438
357 Ga0495628_0018011 3300046516 Bacteria 5860
358 Ga0495630_0002611 3300046517 Bacteria 12479
359 Ga0495630_0014467 3300046517 Bacteria 5751
360 Ga0495632_0017180 3300046519 Bacteria 4001
361 Ga0495637_0003528 3300046520 Bacteria 8295
362 Ga0495637_0004992 3300046520 Bacteria 6828
363 Ga0495648_0003948 3300046524 Bacteria 12837
364 Ga0495648_0007625 3300046524 Bacteria 8634
365 Ga0495648_0046319 3300046524 Bacteria 2696
366 Ga0495666_0026417 3300046526 Bacteria 2861
367 Ga0495666_0043158 3300046526 Bacteria 2179
368 Ga0495666_0079012 3300046526 Bacteria 1558
369 Ga0495654_0060710 3300046530 Bacteria 1817
370 Ga0495665_0035541 3300046531 Bacteria 2661
371 Ga0495640_0034914 3300046533 Bacteria 3561
372 Ga0495587_0007840 3300046536 Bacteria 6896
373 Ga0495609_0049658 3300046538 Bacteria 1872
374 Ga0495597_0000068 3300046542 Bacteria 90143
375 Ga0495622_0000139 3300046557 Bacteria 62387
376 Ga0495622_0000528 3300046557 Bacteria 23093
377 Ga0495633_0000020 3300046558 Bacteria 227180
378 Ga0495667_0101079 3300046559 Bacteria 1866
379 Ga0495634_0026852 3300046642 Bacteria 4014
380 Ga0495611_0076242 3300046648 Bacteria 1537
381 Ga0495625_0017360 3300046660 Bacteria 5636
382 Ga0495635_0031160 3300046663 Bacteria 3704
383 Ga0495659_0000448 3300046664 Bacteria 15410
384 Ga0495661_0000009 3300046665 Bacteria 291327
385 Ga0495661_0000093 3300046665 Bacteria 109808
386 Ga0495661_0000100 3300046665 Bacteria 104957
387 Ga0495661_0001422 3300046665 Bacteria 20072
388 Ga0495661_0012289 3300046665 Bacteria 5783
389 Ga0495661_0013579 3300046665 Bacteria 5467
390 Ga0495599_0003484 3300046678 Bacteria 9208
391 Ga0495623_0038986 3300046679 Bacteria 3037
392 Ga0495623_0245793 3300046679 Bacteria 1008
393 Ga0495646_0049968 3300046680 Bacteria 2536
394 Ga0495646_0055390 3300046680 Bacteria 2381
395 Ga0495669_0070243 3300046684 Bacteria 1595
396 Ga0495613_0005055 3300046689 Bacteria 9888
397 Ga0495624_0001495 3300046690 Bacteria 18147
398 Ga0495624_0010050 3300046690 Bacteria 6530
399 Ga0495624_0055117 3300046690 Bacteria 2505
400 Ga0495624_0144421 3300046690 Bacteria 1456
401 Ga0495671_0042657 3300046692 Bacteria 2279
402 Ga0495649_0000336 3300046694 Bacteria 40372
403 Ga0495649_0002361 3300046694 Bacteria 13349
404 Ga0495649_0087709 3300046694 Bacteria 1660
405 Ga0495649_0136387 3300046694 Bacteria 1293
406 Ga0495589_0002872 3300046794 Bacteria 9536
407 Ga0495589_0005686 3300046794 Bacteria 6573
408 Ga0495589_0006461 3300046794 Bacteria 6180
409 Ga0495600_0013615 3300046809 Bacteria 5116
410 Ga0495660_0000761 3300046810 Bacteria 24239
411 Ga0495581_0019145 3300047315 Bacteria 3973
412 Ga0495674_0000750 3300047319 Bacteria 30755
413 Ga0495674_0008469 3300047319 Bacteria 9795
414 Ga0495674_0026003 3300047319 Bacteria 5356
415 Ga0495672_0000001 3300047320 Bacteria 1458820
416 Ga0495672_0000052 3300047320 Bacteria 236266
417 Ga0495672_0031408 3300047320 Bacteria 3315
418 Ga0495676_0000804 3300047321 Bacteria 26197
419 Ga0495676_0055845 3300047321 Bacteria 3127
420 Ga0495676_0059017 3300047321 Bacteria 3015
421 Ga0495676_0140118 3300047321 Bacteria 1734
422 Ga0495680_0005110 3300047322 Bacteria 12389
423 Ga0495680_0053008 3300047322 Bacteria 3159
424 Ga0495683_0000254 3300047323 Bacteria 48222
425 Ga0495683_0001678 3300047323 Bacteria 14099
426 Ga0495683_0003858 3300047323 Bacteria 8636
427 Ga0495683_0018026 3300047323 Bacteria 3654
428 Ga0495683_0102893 3300047323 Bacteria 1371
429 Ga0495687_003713 3300047443 Bacteria 10844
430 Ga0495687_039789 3300047443 Bacteria 2077
431 Ga0495675_0027315 3300047444 Bacteria 3636
432 Ga0495675_0106586 3300047444 Bacteria 1751
433 Ga0495675_0133940 3300047444 Bacteria 1539
434 Ga0495679_000033 3300047446 Bacteria 166523
435 Ga0495679_001055 3300047446 Bacteria 16754
436 Ga0495679_034159 3300047446 Bacteria 1620
437 Ga0495673_0000972 3300047469 Bacteria 25751
438 Ga0495673_0013456 3300047469 Bacteria 4293
439 Ga0495681_0022553 3300047470 Bacteria 3366
440 Ga0495684_0184129 3300047471 Bacteria 1547
441 Ga0495686_0000080 3300047472 Bacteria 201665
442 Ga0495686_0034170 3300047472 Bacteria 3277
443 Ga0495593_0009310 3300047673 Bacteria 5702
444 Ga0495593_0019388 3300047673 Bacteria 3813
445 Ga0495593_0032560 3300047673 Bacteria 2841
446 Ga0495593_0032665 3300047673 Bacteria 2835
447 Ga0495602_0052023 3300048088 Bacteria 3641
448 Ga0496100_0007475 3300048903 Bacteria 6030
449 Ga0496100_0032485 3300048903 Bacteria 3256
450 Ga0496100_0089522 3300048903 Bacteria 2097
451 Ga0496101_0000365 3300048904 Bacteria 30062
452 Ga0496101_0006013 3300048904 Bacteria 7782
453 Ga0496101_0196727 3300048904 Bacteria 1557
454 Ga0496102_0003703 3300048905 Bacteria 12922
455 Ga0496102_0012212 3300048905 Bacteria 7426
456 Ga0496102_0053540 3300048905 Bacteria 3678
457 Ga0496102_0094026 3300048905 Bacteria 2777
458 Ga0496103_0000509 3300048906 Bacteria 32057
459 Ga0496104_0154070 3300048907 Bacteria 2206
460 Ga0496105_0007423 3300048908 Bacteria 8483
461 Ga0496105_0058288 3300048908 Bacteria 3188
462 Ga0496106_0031483 3300048909 Bacteria 3953
463 Ga0496106_0341149 3300048909 Bacteria 1203
464 Ga0496112_0030464 3300048915 Bacteria 5222
465 Ga0496113_0195220 3300048916 Bacteria 1608
466 Ga0496115_0137368 3300048918 Bacteria 2016
467 Ga0496116_0000237 3300048919 Bacteria 100835
468 Ga0496116_0002504 3300048919 Bacteria 19234
469 Ga0496116_0009238 3300048919 Bacteria 8436
470 Ga0496116_0054330 3300048919 Bacteria 2640
471 Ga0496117_0000073 3300048920 Bacteria 236223
472 Ga0496117_0000294 3300048920 Bacteria 89536
473 Ga0496117_0000359 3300048920 Bacteria 79857
474 Ga0496117_0001052 3300048920 Bacteria 42055
475 Ga0496117_0001351 3300048920 Bacteria 35913
476 Ga0496117_0001750 3300048920 Bacteria 29891
477 Ga0496117_0018487 3300048920 Bacteria 5767
478 Ga0496117_0024383 3300048920 Bacteria 4787
479 Ga0496117_0028205 3300048920 Bacteria 4351
480 Ga0496117_0029299 3300048920 Bacteria 4247
481 Ga0496117_0115293 3300048920 Bacteria 1663
482 Ga0496118_0000449 3300048921 Bacteria 68182
483 Ga0496118_0000508 3300048921 Bacteria 64418
484 Ga0496118_0002694 3300048921 Bacteria 23398
485 Ga0496118_0004769 3300048921 Bacteria 15859
486 Ga0496118_0013377 3300048921 Bacteria 7768
487 Ga0496118_0047406 3300048921 Bacteria 3330
488 Ga0496118_0158919 3300048921 Bacteria 1401
489 Ga0496119_0000400 3300048922 Bacteria 59582
490 Ga0496119_0000523 3300048922 Bacteria 52176
491 Ga0496119_0002263 3300048922 Bacteria 21397
492 Ga0496119_0044806 3300048922 Bacteria 2780
493 Ga0496120_0000524 3300048923 Bacteria 59374
494 Ga0496120_0000728 3300048923 Bacteria 48229
495 Ga0496120_0002026 3300048923 Bacteria 22033
496 Ga0496120_0022124 3300048923 Bacteria 4003
497 Ga0496121_0000626 3300048924 Bacteria 65892
498 Ga0496121_0001053 3300048924 Bacteria 48912
499 Ga0496121_0017234 3300048924 Bacteria 7395
500 Ga0496121_0039538 3300048924 Bacteria 4153
501 Ga0496121_0062041 3300048924 Bacteria 3064
502 Ga0496121_0091262 3300048924 Bacteria 2379
503 Ga0496122_0003103 3300048925 Bacteria 22321
504 Ga0496122_0010612 3300048925 Bacteria 9461
505 Ga0496122_0020704 3300048925 Bacteria 5925
506 Ga0496122_0029999 3300048925 Bacteria 4568
507 Ga0496123_0004591 3300048926 Bacteria 14379
508 Ga0496123_0020411 3300048926 Bacteria 5183
509 Ga0496123_0045540 3300048926 Bacteria 2987
510 Ga0496124_0000004 3300048927 Bacteria 976131
511 Ga0496124_0000309 3300048927 Bacteria 90452
512 Ga0496124_0000600 3300048927 Bacteria 60608
513 Ga0496124_0062338 3300048927 Bacteria 3121
514 Ga0496124_0082211 3300048927 Bacteria 2644
515 Ga0496124_0102660 3300048927 Bacteria 2314
516 Ga0496124_0148430 3300048927 Bacteria 1842
517 Ga0496125_0003909 3300048928 Bacteria 17584
518 Ga0496125_0006719 3300048928 Bacteria 12368
519 Ga0496126_0000098 3300048929 Bacteria 205129
520 Ga0496126_0001174 3300048929 Bacteria 43118
521 Ga0496126_0004745 3300048929 Bacteria 16024
522 Ga0496126_0053113 3300048929 Bacteria 3678
523 Ga0496126_0055817 3300048929 Bacteria 3572
524 Ga0496126_0173714 3300048929 Bacteria 1834
525 Ga0495678_000007 3300049459 Bacteria 448039
526 Ga0495682_0000011 3300049460 Bacteria 278474
527 Ga0501039_0089634 3300049575 Bacteria 2397
528 Ga0501070_0102486 3300049586 Bacteria 2367
529 Ga0501074_0150753 3300049590 Bacteria 1662
530 Ga0501045_0069718 3300049824 Bacteria 2585
531 nmdc:mga00v17_174512_c1 3300050491 Bacteria 1386
532 nmdc:mga00v17_449_c1 3300050491 Bacteria 23134
533 nmdc:mga00v17_83107_c1 3300050491 Bacteria 2002
534 nmdc:mga0sz30_3595_c2 3300050516 Bacteria 4771
535 Ga0500618_004950 3300053125 Bacteria 4133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013250 Ga0171462_1023 Ga0171462_102317 309
2 3300048915 Ga0496112_0030464 Ga0496112_0030464_2944_3936 310
3 3300005327 Ga0070658_10008756 Ga0070658_100087566 313
4 3300005563 Ga0068855_100077059 Ga0068855_1000770593 313
5 3300009545 Ga0105237_10229880 Ga0105237_102298802 313
6 3300013104 Ga0157370_10001977 Ga0157370_100019772 313
7 3300025909 Ga0207705_10000545 Ga0207705_1000054533 313
8 3300025949 Ga0207667_10001276 Ga0207667_100012767 313
9 3300039110 Ga0400487_02139 Ga0400487_02139_757_1764 316
10 3300047315 Ga0495581_0019145 Ga0495581_0019145_142_1128 316
11 3300046459 Ga0495629_0001615 Ga0495629_0001615_14817_15809 318
12 3300046463 Ga0495653_0007937 Ga0495653_0007937_307_1299 318
13 3300046472 Ga0495580_0001313 Ga0495580_0001313_13694_14686 318
14 3300046476 Ga0495662_0011151 Ga0495662_0011151_3216_4208 318
15 3300046477 Ga0495664_0000200 Ga0495664_0000200_6690_7682 318
16 3300046516 Ga0495628_0009213 Ga0495628_0009213_176_1168 318
17 3300046536 Ga0495587_0007840 Ga0495587_0007840_2179_3171 318
18 3300046642 Ga0495634_0026852 Ga0495634_0026852_2340_3332 318
19 3300046665 Ga0495661_0001422 Ga0495661_0001422_15548_16540 318
20 3300046678 Ga0495599_0003484 Ga0495599_0003484_854_1846 318
21 3300046679 Ga0495623_0038986 Ga0495623_0038986_1540_2532 318
22 3300046679 Ga0495623_0245793 Ga0495623_0245793_12_995 318
23 3300046689 Ga0495613_0005055 Ga0495613_0005055_8721_9713 318
24 3300046690 Ga0495624_0010050 Ga0495624_0010050_2827_3819 318
25 3300047321 Ga0495676_0000804 Ga0495676_0000804_4009_5001 318
26 3300047322 Ga0495680_0005110 Ga0495680_0005110_7396_8388 318
27 3300047444 Ga0495675_0106586 Ga0495675_0106586_567_1559 318
28 3300047446 Ga0495679_001055 Ga0495679_001055_7397_8389 318
29 3300047673 Ga0495593_0019388 Ga0495593_0019388_2240_3232 318
30 3300048088 Ga0495602_0052023 Ga0495602_0052023_2343_3335 318
31 3300048904 Ga0496101_0196727 Ga0496101_0196727_566_1540 318
32 iso_pu_bacteria 2501025502 2501083343 318
33 3300013104 Ga0157370_10284624 Ga0157370_102846242 319
34 3300035410 Ga0373924_0002525 Ga0373924_0002525_1593_2603 319
35 3300046794 Ga0495589_0002872 Ga0495589_0002872_3009_3995 319
36 3300047470 Ga0495681_0022553 Ga0495681_0022553_1858_2841 319
37 3300038443 Ga0395901_0000011 Ga0395901_0000011_272700_273743 321
38 3300042876 Ga0451577_0038179 Ga0451577_0038179_1668_2678 322
39 3300044693 Ga0466961_0111305 Ga0466961_0111305_305_1309 322
40 3300044712 Ga0453684_0061215 Ga0453684_0061215_2636_3646 322
41 3300046492 Ga0495585_0025767 Ga0495585_0025767_512_1480 322
42 3300046665 Ga0495661_0000093 Ga0495661_0000093_94892_95860 322
43 3300013297 Ga0157378_10205415 Ga0157378_102054152 323
44 3300046455 Ga0495603_0012089 Ga0495603_0012089_239_1255 323
45 3300046461 Ga0495641_0013663 Ga0495641_0013663_3325_4341 323
46 3300046517 Ga0495630_0002611 Ga0495630_0002611_3038_4054 323
47 3300046524 Ga0495648_0007625 Ga0495648_0007625_7305_8321 323
48 3300046533 Ga0495640_0034914 Ga0495640_0034914_1913_2929 323
49 3300049590 Ga0501074_0150753 Ga0501074_0150753_23_1012 323
50 iso_pu_bacteria 2501025501 2501072600 323
51 3300014497 Ga0182008_10059835 Ga0182008_100598352 324
52 3300046557 Ga0495622_0000139 Ga0495622_0000139_23194_24252 324
53 3300046471 Ga0495650_0001500 Ga0495650_0001500_15782_16795 325
54 3300027312 Ga0209371_1000190 Ga0209371_100019039 326
55 3300030500 Ga0268256_1000069 Ga0268256_1000069130 326
56 3300005444 Ga0070694_100219837 Ga0070694_1002198372 327
57 3300006051 Ga0075364_10029261 Ga0075364_100292614 327
58 3300009148 Ga0105243_10002650 Ga0105243_1000265012 327
59 3300025935 Ga0207709_10000138 Ga0207709_1000013852 327
60 3300028800 Ga0265338_10000437 Ga0265338_1000043748 327
61 3300046455 Ga0495603_0009018 Ga0495603_0009018_3039_4052 327
62 3300046457 Ga0495590_0026329 Ga0495590_0026329_535_1548 327
63 3300046472 Ga0495580_0189525 Ga0495580_0189525_319_1332 327
64 3300046506 Ga0495583_0016067 Ga0495583_0016067_1067_2080 327
65 3300046524 Ga0495648_0046319 Ga0495648_0046319_600_1613 327
66 3300046530 Ga0495654_0060710 Ga0495654_0060710_439_1422 327
67 3300047320 Ga0495672_0031408 Ga0495672_0031408_1641_2654 327
68 3300047321 Ga0495676_0055845 Ga0495676_0055845_1955_2938 327
69 3300048918 Ga0496115_0137368 Ga0496115_0137368_609_1628 327
70 3300048929 Ga0496126_0001174 Ga0496126_0001174_15598_16686 327
71 3300050491 nmdc:mga00v17_449_c1 nmdc:mga00v17_449_c1_13487_14500 327
72 3300053125 Ga0500618_004950 Ga0500618_004950_1843_2826 327
73 iso_pu_bacteria 2838054893 2838055577 327
74 iso_pu_bacteria 2885192300 2885194738 327
75 iso_pu_bacteria 2928115317 2928120447 327
76 iso_pu_bacteria 2952252522 2952255948 327
77 3300003322 rootL2_10038977 rootL2_100389772 328
78 3300003322 rootL2_10137897 rootL2_101378972 328
79 3300003354 JGI25160J50197_1001438 JGI25160J50197_10014384 328
80 3300005262 Ga0065165_1002944 Ga0065165_100294412 328
81 3300009176 Ga0105242_10442567 Ga0105242_104425672 328
82 3300009177 Ga0105248_10129630 Ga0105248_101296302 328
83 3300013306 Ga0163162_10065393 Ga0163162_100653933 328
84 3300013308 Ga0157375_10070605 Ga0157375_100706052 328
85 3300016635 Ga0183361_10006 Ga0183361_10006345 328
86 3300025295 Ga0209564_1011838 Ga0209564_10118382 328
87 3300025302 Ga0207426_1000245 Ga0207426_10002455 328
88 3300025972 Ga0207668_10187802 Ga0207668_101878022 328
89 3300038725 Ga0400484_35478 Ga0400484_35478_249_1256 328
90 3300038726 Ga0400490_35226 Ga0400490_35226_1046_2053 328
91 3300046454 Ga0495592_0000085 Ga0495592_0000085_77328_78335 328
92 3300046462 Ga0495651_0123433 Ga0495651_0123433_272_1321 328
93 3300046472 Ga0495580_0000047 Ga0495580_0000047_17158_18207 328
94 3300046472 Ga0495580_0189530 Ga0495580_0189530_54_1100 328
95 3300046474 Ga0495605_0000848 Ga0495605_0000848_1158_2162 328
96 3300046474 Ga0495605_0042865 Ga0495605_0042865_850_1896 328
97 3300046501 Ga0495607_0100113 Ga0495607_0100113_66_1070 328
98 3300046507 Ga0495606_0114438 Ga0495606_0114438_421_1425 328
99 3300046516 Ga0495628_0018011 Ga0495628_0018011_4352_5401 328
100 3300046517 Ga0495630_0014467 Ga0495630_0014467_3314_4363 328
101 3300046526 Ga0495666_0043158 Ga0495666_0043158_286_1335 328
102 3300046684 Ga0495669_0070243 Ga0495669_0070243_390_1394 328
103 3300046690 Ga0495624_0055117 Ga0495624_0055117_35_1084 328
104 3300046794 Ga0495589_0006461 Ga0495589_0006461_643_1647 328
105 3300047319 Ga0495674_0000750 Ga0495674_0000750_15091_16104 328
106 3300047319 Ga0495674_0026003 Ga0495674_0026003_3389_4435 328
107 3300047322 Ga0495680_0053008 Ga0495680_0053008_2028_3077 328
108 3300047323 Ga0495683_0102893 Ga0495683_0102893_35_1081 328
109 3300047443 Ga0495687_039789 Ga0495687_039789_715_1761 328
110 3300047444 Ga0495675_0133940 Ga0495675_0133940_42_1091 328
111 3300047469 Ga0495673_0013456 Ga0495673_0013456_158_1204 328
112 3300047471 Ga0495684_0184129 Ga0495684_0184129_153_1202 328
113 3300047472 Ga0495686_0000080 Ga0495686_0000080_26866_27879 328
114 3300048903 Ga0496100_0007475 Ga0496100_0007475_1411_2457 328
115 3300048903 Ga0496100_0089522 Ga0496100_0089522_456_1460 328
116 3300048904 Ga0496101_0006013 Ga0496101_0006013_3025_4071 328
117 3300048905 Ga0496102_0003703 Ga0496102_0003703_8303_9349 328
118 3300048905 Ga0496102_0094026 Ga0496102_0094026_1324_2328 328
119 3300048906 Ga0496103_0000509 Ga0496103_0000509_94_1140 328
120 3300048907 Ga0496104_0154070 Ga0496104_0154070_592_1596 328
121 3300048919 Ga0496116_0054330 Ga0496116_0054330_1294_2340 328
122 3300048920 Ga0496117_0001052 Ga0496117_0001052_3574_4620 328
123 3300048920 Ga0496117_0001750 Ga0496117_0001750_457_1467 328
124 3300048921 Ga0496118_0002694 Ga0496118_0002694_3574_4620 328
125 3300048921 Ga0496118_0158919 Ga0496118_0158919_225_1229 328
126 3300048924 Ga0496121_0017234 Ga0496121_0017234_2638_3684 328
127 3300048927 Ga0496124_0102660 Ga0496124_0102660_1221_2267 328
128 3300048929 Ga0496126_0000098 Ga0496126_0000098_121523_122533 328
129 3300049586 Ga0501070_0102486 Ga0501070_0102486_705_1712 328
130 iso_pu_bacteria 2513237166 2514048933 328
131 iso_pu_bacteria 2562617112 2563058881 328
132 iso_pu_bacteria 2643221609 2644059588 328
133 iso_pu_bacteria 2643221611 2644074730 328
134 iso_pu_bacteria 2711768613 2713480069 328
135 iso_pu_bacteria 2721755763 2723877538 328
136 iso_pu_bacteria 2738543012 2739241118 328
137 iso_pu_bacteria 2816332133 2816471804 328
138 iso_pu_bacteria 2855730933 2855732769 328
139 iso_pu_bacteria 2855767633 2855771521 328
140 iso_pu_bacteria 2881412998 2881415565 328
141 iso_pu_bacteria 2921643360 2921654174 328
142 iso_pu_bacteria 2929160207 2929161767 328
143 iso_pu_bacteria 641736151 642426786 328
144 iso_pu_bacteria 642555112 642593285 328
145 3300001979 JGI24740J21852_10003531 JGI24740J21852_100035316 329
146 3300002067 JGI24735J21928_10000087 JGI24735J21928_1000008722 329
147 3300005290 Ga0065712_10171664 Ga0065712_101716641 329
148 3300005328 Ga0070676_10062871 Ga0070676_100628712 329
149 3300005331 Ga0070670_100004735 Ga0070670_1000047358 329
150 3300005333 Ga0070677_10002183 Ga0070677_100021833 329
151 3300005353 Ga0070669_100101741 Ga0070669_1001017413 329
152 3300005354 Ga0070675_100002569 Ga0070675_10000256910 329
153 3300005355 Ga0070671_100018623 Ga0070671_1000186235 329
154 3300005356 Ga0070674_100001349 Ga0070674_1000013493 329
155 3300005456 Ga0070678_100014570 Ga0070678_1000145703 329
156 3300005466 Ga0070685_10179210 Ga0070685_101792102 329
157 3300005543 Ga0070672_100005395 Ga0070672_1000053953 329
158 3300005834 Ga0068851_10061925 Ga0068851_100619252 329
159 3300006195 Ga0075366_10044050 Ga0075366_100440502 329
160 3300006237 Ga0097621_100048533 Ga0097621_1000485333 329
161 3300013306 Ga0163162_10472826 Ga0163162_104728262 329
162 3300014969 Ga0157376_10152552 Ga0157376_101525522 329
163 3300017792 Ga0163161_10004415 Ga0163161_100044153 329
164 3300025256 Ga0209759_1019292 Ga0209759_10192922 329
165 3300025321 Ga0207656_10042641 Ga0207656_100426412 329
166 3300025893 Ga0207682_10003822 Ga0207682_100038223 329
167 3300025907 Ga0207645_10019998 Ga0207645_100199982 329
168 3300025923 Ga0207681_10012408 Ga0207681_100124084 329
169 3300025925 Ga0207650_10001027 Ga0207650_1000102712 329
170 3300025926 Ga0207659_10001133 Ga0207659_1000113312 329
171 3300025931 Ga0207644_10021910 Ga0207644_100219104 329
172 3300025937 Ga0207669_10106232 Ga0207669_101062322 329
173 3300025940 Ga0207691_10001104 Ga0207691_1000110419 329
174 3300025960 Ga0207651_10003576 Ga0207651_100035765 329
175 3300026121 Ga0207683_10004624 Ga0207683_100046242 329
176 3300028379 Ga0268266_10183440 Ga0268266_101834402 329
177 3300041404 Ga0439436_0016981 Ga0439436_0016981_543_1553 329
178 3300041407 Ga0439447_040104 Ga0439447_040104_50_1060 329
179 3300041413 Ga0439465_0009313 Ga0439465_0009313_1755_2765 329
180 3300041999 Ga0439433_0000364 Ga0439433_0000364_2981_3991 329
181 3300042004 Ga0439445_0002315 Ga0439445_0002315_492_1502 329
182 3300042007 Ga0439449_0006098 Ga0439449_0006098_45_1055 329
183 3300042010 Ga0439452_000914 Ga0439452_000914_3975_4985 329
184 3300042015 Ga0439462_0025859 Ga0439462_0025859_525_1535 329
185 3300046512 Ga0495610_0001890 Ga0495610_0001890_1574_2614 329
186 iso_pu_bacteria 2826581358 2826582029 329
187 iso_pu_bacteria 2842815866 2842819388 329
188 iso_pu_bacteria 2842849001 2842852364 329
189 iso_pu_bacteria 2857542790 2857546196 329
190 3300001979 JGI24740J21852_10044095 JGI24740J21852_100440951 330
191 3300001989 JGI24739J22299_10009313 JGI24739J22299_100093134 330
192 3300001989 JGI24739J22299_10009453 JGI24739J22299_100094532 330
193 3300002075 JGI24738J21930_10002901 JGI24738J21930_100029013 330
194 3300003758 Ga0055532_1002855 Ga0055532_10028553 330
195 3300003760 Ga0055527_1000564 Ga0055527_100056413 330
196 3300003760 Ga0055527_1000600 Ga0055527_10006003 330
197 3300003761 Ga0055535_1001424 Ga0055535_10014242 330
198 3300003761 Ga0055535_1001498 Ga0055535_10014983 330
199 3300003762 Ga0055542_1001400 Ga0055542_10014002 330
200 3300003763 Ga0055529_1000418 Ga0055529_100041813 330
201 3300005327 Ga0070658_10120180 Ga0070658_101201802 330
202 3300005339 Ga0070660_100000028 Ga0070660_10000002819 330
203 3300005344 Ga0070661_100109132 Ga0070661_1001091322 330
204 3300005366 Ga0070659_100000152 Ga0070659_10000015212 330
205 3300005367 Ga0070667_100157580 Ga0070667_1001575801 330
206 3300005455 Ga0070663_100002650 Ga0070663_1000026505 330
207 3300005563 Ga0068855_100136676 Ga0068855_1001366763 330
208 3300006946 Ga0079104_1000004 Ga0079104_1000004347 330
209 3300009011 Ga0105251_10000164 Ga0105251_1000016455 330
210 3300009092 Ga0105250_10018785 Ga0105250_100187853 330
211 3300009551 Ga0105238_10018266 Ga0105238_100182665 330
212 3300013100 Ga0157373_10131437 Ga0157373_101314372 330
213 3300015262 Ga0182007_10034779 Ga0182007_100347792 330
214 3300015265 Ga0182005_1011725 Ga0182005_10117252 330
215 3300021361 Ga0213872_10045946 Ga0213872_100459462 330
216 3300025225 Ga0209566_100276 Ga0209566_10027619 330
217 3300025226 Ga0209674_103030 Ga0209674_1030304 330
218 3300025228 Ga0209672_100019 Ga0209672_100019203 330
219 3300025228 Ga0209672_100069 Ga0209672_100069101 330
220 3300025229 Ga0209147_100026 Ga0209147_100026203 330
221 3300025229 Ga0209147_100044 Ga0209147_100044166 330
222 3300025229 Ga0209147_100128 Ga0209147_10012856 330
223 3300025242 Ga0209258_100031 Ga0209258_100031245 330
224 3300025242 Ga0209258_100079 Ga0209258_10007933 330
225 3300025254 Ga0209148_1000027 Ga0209148_1000027245 330
226 3300025254 Ga0209148_1001002 Ga0209148_100100212 330
227 3300025272 Ga0209455_1000058 Ga0209455_1000058203 330
228 3300025272 Ga0209455_1000421 Ga0209455_100042112 330
229 3300025273 Ga0209673_1000059 Ga0209673_1000059182 330
230 3300025294 Ga0209025_1002963 Ga0209025_10029635 330
231 3300025295 Ga0209564_1001947 Ga0209564_100194713 330
232 3300025735 Ga0207713_1000716 Ga0207713_100071614 330
233 3300025904 Ga0207647_10015111 Ga0207647_100151113 330
234 3300025913 Ga0207695_10000625 Ga0207695_1000062529 330
235 3300025914 Ga0207671_10032044 Ga0207671_100320443 330
236 3300025919 Ga0207657_10000001 Ga0207657_10000001217 330
237 3300025932 Ga0207690_10000072 Ga0207690_100000728 330
238 3300026067 Ga0207678_10001622 Ga0207678_100016226 330
239 3300027111 Ga0209281_1000005 Ga0209281_1000005553 330
240 3300027312 Ga0209371_1000258 Ga0209371_10002585 330
241 3300027312 Ga0209371_1008131 Ga0209371_10081312 330
242 3300030500 Ga0268256_1000215 Ga0268256_100021540 330
243 3300030500 Ga0268256_1008907 Ga0268256_10089073 330
244 3300030521 Ga0307511_10000406 Ga0307511_100004063 330
245 3300031731 Ga0307405_10012594 Ga0307405_100125944 330
246 3300031911 Ga0307412_10000008 Ga0307412_10000008120 330
247 3300039447 Ga0436361_0296121 Ga0436361_0296121_94114_95124 330
248 3300044683 Ga0466965_0023874 Ga0466965_0023874_1552_2565 330
249 3300044684 Ga0466966_0000002 Ga0466966_0000002_223502_224545 330
250 3300044693 Ga0466961_0002576 Ga0466961_0002576_5855_6898 330
251 3300044694 Ga0466963_0007401 Ga0466963_0007401_3578_4621 330
252 3300044694 Ga0466963_0204480 Ga0466963_0204480_187_1215 330
253 3300044719 Ga0466971_0004081 Ga0466971_0004081_3352_4395 330
254 3300044842 Ga0466957_0130658 Ga0466957_0130658_246_1367 330
255 3300045049 Ga0466959_0040833 Ga0466959_0040833_917_1960 330
256 3300045836 Ga0466958_0002465 Ga0466958_0002465_4890_5933 330
257 3300046454 Ga0495592_0026430 Ga0495592_0026430_1627_2661 330
258 3300046457 Ga0495590_0007039 Ga0495590_0007039_2995_4029 330
259 3300046459 Ga0495629_0003716 Ga0495629_0003716_8480_9514 330
260 3300046461 Ga0495641_0031135 Ga0495641_0031135_1249_2283 330
261 3300046463 Ga0495653_0077557 Ga0495653_0077557_381_1415 330
262 3300046471 Ga0495650_0020989 Ga0495650_0020989_92_1126 330
263 3300046507 Ga0495606_0001836 Ga0495606_0001836_24106_25140 330
264 3300046514 Ga0495618_0128142 Ga0495618_0128142_38_1072 330
265 3300046526 Ga0495666_0026417 Ga0495666_0026417_397_1431 330
266 3300046531 Ga0495665_0035541 Ga0495665_0035541_1476_2510 330
267 3300046559 Ga0495667_0101079 Ga0495667_0101079_449_1483 330
268 3300046663 Ga0495635_0031160 Ga0495635_0031160_1043_2077 330
269 3300046680 Ga0495646_0055390 Ga0495646_0055390_400_1434 330
270 3300046690 Ga0495624_0144421 Ga0495624_0144421_148_1182 330
271 3300046694 Ga0495649_0000336 Ga0495649_0000336_20112_21146 330
272 3300046694 Ga0495649_0087709 Ga0495649_0087709_510_1544 330
273 3300046694 Ga0495649_0136387 Ga0495649_0136387_104_1147 330
274 3300046809 Ga0495600_0013615 Ga0495600_0013615_2638_3672 330
275 3300047321 Ga0495676_0059017 Ga0495676_0059017_1052_2086 330
276 3300047323 Ga0495683_0001678 Ga0495683_0001678_6906_7940 330
277 3300047323 Ga0495683_0018026 Ga0495683_0018026_1826_2869 330
278 3300047444 Ga0495675_0027315 Ga0495675_0027315_642_1676 330
279 3300047673 Ga0495593_0032665 Ga0495593_0032665_1392_2426 330
280 3300048920 Ga0496117_0024383 Ga0496117_0024383_1300_2349 330
281 3300048920 Ga0496117_0028205 Ga0496117_0028205_1716_2759 330
282 3300048920 Ga0496117_0115293 Ga0496117_0115293_389_1474 330
283 3300048921 Ga0496118_0013377 Ga0496118_0013377_1806_2849 330
284 iso_pu_bacteria 2511231025 2511381697 330
285 iso_pu_bacteria 2519103095 2519458369 330
286 iso_pu_bacteria 2582581311 2585292756 330
287 iso_pu_bacteria 2599185167 2599397559 330
288 iso_pu_bacteria 2599185179 2599452004 330
289 iso_pu_bacteria 2599185188 2599500771 330
290 iso_pu_bacteria 2599185190 2599513614 330
291 iso_pu_bacteria 2599185191 2599517886 330
292 iso_pu_bacteria 2599185212 2599612508 330
293 iso_pu_bacteria 2599185239 2599738233 330
294 iso_pu_bacteria 2599185240 2599742396 330
295 iso_pu_bacteria 2599185288 2599880662 330
296 iso_pu_bacteria 2599185290 2599892291 330
297 iso_pu_bacteria 2599185300 2599932437 330
298 iso_pu_bacteria 2599185303 2599952037 330
299 iso_pu_bacteria 2599185316 2600022113 330
300 iso_pu_bacteria 2599185317 2600028379 330
301 iso_pu_bacteria 2599185319 2600040760 330
302 iso_pu_bacteria 2599185322 2600059375 330
303 iso_pu_bacteria 2599185323 2600063097 330
304 iso_pu_bacteria 2599185325 2600075387 330
305 iso_pu_bacteria 2599185355 2600204514 330
306 iso_pu_bacteria 2600254930 2600357546 330
307 iso_pu_bacteria 2619619299 2621300165 330
308 iso_pu_bacteria 2623620446 2624493096 330
309 iso_pu_bacteria 2643221650 2644284468 330
310 iso_pu_bacteria 2667528176 2671126466 330
311 iso_pu_bacteria 2675903129 2676741499 330
312 iso_pu_bacteria 2675903420 2677901191 330
313 iso_pu_bacteria 2675903515 2678265453 330
314 iso_pu_bacteria 2721755523 2722884250 330
315 iso_pu_bacteria 2738541265 2738675138 330
316 iso_pu_bacteria 2738541282 2738753428 330
317 iso_pu_bacteria 2738541294 2738806217 330
318 iso_pu_bacteria 2738541303 2738862340 330
319 iso_pu_bacteria 2738541309 2738893577 330
320 iso_pu_bacteria 2744054620 2745005904 330
321 iso_pu_bacteria 2791355137 2792836167 330
322 iso_pu_bacteria 2791355520 2794597284 330
323 iso_pu_bacteria 2808606382 2808959050 330
324 iso_pu_bacteria 2808606385 2808980348 330
325 iso_pu_bacteria 2808606388 2808996069 330
326 iso_pu_bacteria 2816332253 2817260513 330
327 iso_pu_bacteria 2816332256 2817278200 330
328 iso_pu_bacteria 2816332286 2817452561 330
329 iso_pu_bacteria 2816332298 2817491511 330
330 iso_pu_bacteria 2818991450 2819624667 330
331 iso_pu_bacteria 2818991452 2819633057 330
332 iso_pu_bacteria 2834028612 2834033428 330
333 iso_pu_bacteria 2852612431 2852613950 330
334 iso_pu_bacteria 2852667396 2852668313 330
335 iso_pu_bacteria 2860339153 2860344324 330
336 iso_pu_bacteria 2860867994 2860870024 330
337 iso_pu_bacteria 2863421361 2863422064 330
338 iso_pu_bacteria 2870068957 2870071996 330
339 iso_pu_bacteria 2876601092 2876603099 330
340 iso_pu_bacteria 2904564687 2904566227 330
341 iso_pu_bacteria 2904571731 2904573271 330
342 iso_pu_bacteria 2904615490 2904617335 330
343 iso_pu_bacteria 2913036834 2913039851 330
344 iso_pu_bacteria 2919481497 2919484890 330
345 iso_pu_bacteria 2919501602 2919502000 330
346 iso_pu_bacteria 2923586266 2923588683 330
347 iso_pu_bacteria 2926063275 2926063673 330
348 iso_pu_bacteria 2928108538 2928110643 330
349 iso_pu_bacteria 2928135762 2928140159 330
350 iso_pu_bacteria 2928157003 2928159352 330
351 iso_pu_bacteria 2928163908 2928164587 330
352 iso_pu_bacteria 2928170801 2928177288 330
353 iso_pu_bacteria 2928536128 2928538207 330
354 iso_pu_bacteria 2931369376 2931375392 330
355 iso_pu_bacteria 2931390751 2931393486 330
356 iso_pu_bacteria 2945928738 2945933000 330
357 iso_pu_bacteria 2981990288 2981993783 330
358 iso_pu_bacteria 3007315729 3007320426 330
359 iso_pu_bacteria 641736154 642416404 330
360 iso_pu_bacteria 8016733728 8016734896 330
361 iso_pu_bacteria 8018845410 8018850545 330
362 iso_pu_bacteria 8019499862 8019501618 330
363 iso_pu_bacteria 8020807995 8020812046 330
364 iso_pu_bacteria 8020938398 8020944399 330
365 iso_pu_bacteria 8020945358 8020947075 330
366 iso_pu_bacteria 8020953355 8020960097 330
367 iso_pu_bacteria 8021120328 8021122957 330
368 iso_pu_bacteria 8039098773 8039104211 330
369 iso_pu_bacteria 8040167225 8040169172 330
370 iso_pu_bacteria 8040173305 8040177847 330
371 iso_pu_bacteria 8054285046 8054287570 330
372 iso_pu_bacteria 8054503363 8054506783 330
373 iso_pu_bacteria 8055817908 8055821556 330
374 iso_pu_bacteria 8056131705 8056135225 330
375 iso_pu_bacteria 8056161164 8056165646 330
376 3300002705 JGI25156J39149_1000429 JGI25156J39149_100042919 331
377 3300002705 JGI25156J39149_1002844 JGI25156J39149_10028443 331
378 3300003214 JGI25165J46597_1000886 JGI25165J46597_100088611 331
379 3300003756 Ga0055533_1000253 Ga0055533_10002539 331
380 3300003756 Ga0055533_1000303 Ga0055533_100030322 331
381 3300003756 Ga0055533_1001847 Ga0055533_10018474 331
382 3300003758 Ga0055532_1000001 Ga0055532_1000001422 331
383 3300003760 Ga0055527_1000002 Ga0055527_1000002336 331
384 3300003761 Ga0055535_1000001 Ga0055535_1000001582 331
385 3300003762 Ga0055542_1000001 Ga0055542_1000001421 331
386 3300003763 Ga0055529_1000001 Ga0055529_1000001582 331
387 3300025226 Ga0209674_100005 Ga0209674_100005787 331
388 3300025226 Ga0209674_100146 Ga0209674_10014664 331
389 3300025228 Ga0209672_100001 Ga0209672_1000011251 331
390 3300025229 Ga0209147_100001 Ga0209147_1000011251 331
391 3300025230 Ga0209563_104186 Ga0209563_1041863 331
392 3300025242 Ga0209258_100001 Ga0209258_1000011251 331
393 3300025254 Ga0209148_1000003 Ga0209148_10000031251 331
394 3300025256 Ga0209759_1000079 Ga0209759_100007934 331
395 3300025256 Ga0209759_1000088 Ga0209759_100008886 331
396 3300025261 Ga0209233_1000016 Ga0209233_1000016213 331
397 3300025272 Ga0209455_1000001 Ga0209455_10000011251 331
398 3300025904 Ga0207647_10159390 Ga0207647_101593902 331
399 3300027312 Ga0209371_1000457 Ga0209371_100045710 331
400 3300030500 Ga0268256_1000439 Ga0268256_10004398 331
401 3300030500 Ga0268256_1004606 Ga0268256_10046065 331
402 3300032002 Ga0307416_100163487 Ga0307416_1001634872 331
403 3300039447 Ga0436361_0865024 Ga0436361_0865024_10813_11826 331
404 3300044712 Ga0453684_0009647 Ga0453684_0009647_4199_5215 331
405 3300044842 Ga0466957_0198140 Ga0466957_0198140_16_1098 331
406 3300046457 Ga0495590_0001854 Ga0495590_0001854_1329_2408 331
407 3300046459 Ga0495629_0000022 Ga0495629_0000022_38604_39683 331
408 3300046463 Ga0495653_0001160 Ga0495653_0001160_16909_17988 331
409 3300046463 Ga0495653_0009844 Ga0495653_0009844_1331_2413 331
410 3300046471 Ga0495650_0007453 Ga0495650_0007453_4823_5902 331
411 3300046472 Ga0495580_0003496 Ga0495580_0003496_5691_6770 331
412 3300046472 Ga0495580_0070679 Ga0495580_0070679_987_2066 331
413 3300046473 Ga0495582_0076613 Ga0495582_0076613_522_1601 331
414 3300046474 Ga0495605_0001095 Ga0495605_0001095_2557_3636 331
415 3300046506 Ga0495583_0004214 Ga0495583_0004214_3596_4675 331
416 3300046526 Ga0495666_0079012 Ga0495666_0079012_72_1151 331
417 3300046538 Ga0495609_0049658 Ga0495609_0049658_116_1195 331
418 3300046648 Ga0495611_0076242 Ga0495611_0076242_206_1285 331
419 3300046665 Ga0495661_0013579 Ga0495661_0013579_3034_4113 331
420 3300046680 Ga0495646_0049968 Ga0495646_0049968_1214_2293 331
421 3300046690 Ga0495624_0001495 Ga0495624_0001495_9627_10706 331
422 3300046692 Ga0495671_0042657 Ga0495671_0042657_334_1413 331
423 3300047319 Ga0495674_0008469 Ga0495674_0008469_3926_5005 331
424 3300047321 Ga0495676_0140118 Ga0495676_0140118_244_1323 331
425 3300047446 Ga0495679_000033 Ga0495679_000033_101292_102371 331
426 3300047472 Ga0495686_0034170 Ga0495686_0034170_657_1736 331
427 3300047673 Ga0495593_0032560 Ga0495593_0032560_373_1452 331
428 3300048920 Ga0496117_0029299 Ga0496117_0029299_177_1256 331
429 3300048924 Ga0496121_0001053 Ga0496121_0001053_25138_26220 331
430 3300048927 Ga0496124_0000004 Ga0496124_0000004_690572_691591 331
431 3300048929 Ga0496126_0004745 Ga0496126_0004745_5850_6932 331
432 3300049575 Ga0501039_0089634 Ga0501039_0089634_967_1980 331
433 3300049824 Ga0501045_0069718 Ga0501045_0069718_1233_2246 331
434 3300050516 nmdc:mga0sz30_3595_c2 nmdc:mga0sz30_3595_c2_2752_3771 331
435 iso_pu_bacteria 2510065045 2510251567 331
436 iso_pu_bacteria 2510917013 2511087081 331
437 iso_pu_bacteria 2512047030 2512345456 331
438 iso_pu_bacteria 2513237151 2513960162 331
439 iso_pu_bacteria 2515154122 2515680701 331
440 iso_pu_bacteria 2526164713 2527075602 331
441 iso_pu_bacteria 2600255067 2600812210 331
442 iso_pu_bacteria 2718217991 2719640681 331
443 iso_pu_bacteria 2738541296 2738818742 331
444 iso_pu_bacteria 2738541298 2738831102 331
445 iso_pu_bacteria 2738541306 2738872629 331
446 iso_pu_bacteria 2738543002 2739184259 331
447 iso_pu_bacteria 2738543008 2739219229 331
448 iso_pu_bacteria 2744054900 2746089767 331
449 iso_pu_bacteria 2744054901 2746094414 331
450 iso_pu_bacteria 2751185846 2753567127 331
451 iso_pu_bacteria 2842324504 2842328535 331
452 iso_pu_bacteria 2842348783 2842352851 331
453 iso_pu_bacteria 2842454564 2842458794 331
454 iso_pu_bacteria 2885270888 2885275689 331
455 iso_pu_bacteria 2902682994 2902683785 331
456 iso_pu_bacteria 2904483920 2904484497 331
457 iso_pu_bacteria 2919527303 2919531539 331
458 iso_pu_bacteria 2945934425 2945937442 331
459 iso_pu_bacteria 2990703756 2990705862 331
460 iso_pu_bacteria 646564506 646814399 331
461 iso_pu_bacteria 8055266321 8055269024 331
462 iso_pu_bacteria 8055301274 8055301989 331
463 3300009177 Ga0105248_10097045 Ga0105248_100970453 332
464 3300048924 Ga0496121_0091262 Ga0496121_0091262_1035_2087 332
465 3300048929 Ga0496126_0173714 Ga0496126_0173714_201_1199 332
466 iso_pu_bacteria 2501025504 2501410484 332
467 iso_pu_bacteria 2510065053 2510281912 332
468 iso_pu_bacteria 2510065055 2510291926 332
469 iso_pu_bacteria 2510065058 2510310060 332
470 iso_pu_bacteria 2510917014 2511097050 332
471 iso_pu_bacteria 2510917015 2511103860 332
472 iso_pu_bacteria 2513237082 2513552290 332
473 iso_pu_bacteria 2513237083 2513561078 332
474 iso_pu_bacteria 2515154189 2516019524 332
475 iso_pu_bacteria 2773857672 2774129917 332
476 iso_pu_bacteria 2856287931 2856294155 332
477 iso_pu_bacteria 2857357740 2857367409 332
478 iso_pu_bacteria 2883087390 2883093118 332
479 iso_pu_bacteria 2917832318 2917832682 332
480 iso_pu_bacteria 2919125081 2919125471 332
481 iso_pu_bacteria 2974298342 2974300294 332
482 iso_pu_bacteria 2984499530 2984502714 332
483 iso_pu_bacteria 2984504281 2984508674 332
484 iso_pu_bacteria 8003955200 8003955649 332
485 iso_pu_bacteria 8016728285 8016729050 332
486 2162886011 MRS1b_contig_1130785 MRS1b_0057.00002580 333
487 3300005290 Ga0065712_10000124 Ga0065712_1000012491 333
488 3300009011 Ga0105251_10019299 Ga0105251_100192992 333
489 3300009011 Ga0105251_10025501 Ga0105251_100255012 333
490 3300009036 Ga0105244_10002430 Ga0105244_100024309 333
491 3300009092 Ga0105250_10003445 Ga0105250_100034455 333
492 3300011119 Ga0105246_10002024 Ga0105246_100020248 333
493 3300011119 Ga0105246_10009427 Ga0105246_100094274 333
494 3300013100 Ga0157373_10000739 Ga0157373_1000073914 333
495 3300013102 Ga0157371_10000780 Ga0157371_1000078018 333
496 3300013102 Ga0157371_10020225 Ga0157371_100202253 333
497 3300013105 Ga0157369_10002960 Ga0157369_1000296020 333
498 3300025711 Ga0207696_1000035 Ga0207696_100003586 333
499 3300025728 Ga0207655_1002878 Ga0207655_10028788 333
500 3300025735 Ga0207713_1004703 Ga0207713_10047032 333
501 3300039062 Ga0400483_099993 Ga0400483_099993_5085_6098 333
502 3300039062 Ga0400483_229956 Ga0400483_229956_414_1427 333
503 3300046471 Ga0495650_0000149 Ga0495650_0000149_29468_30487 333
504 3300047320 Ga0495672_0000001 Ga0495672_0000001_1328230_1329249 333
505 3300048903 Ga0496100_0032485 Ga0496100_0032485_489_1502 333
506 3300048904 Ga0496101_0000365 Ga0496101_0000365_22828_23841 333
507 3300048919 Ga0496116_0009238 Ga0496116_0009238_2334_3347 333
508 3300048920 Ga0496117_0018487 Ga0496117_0018487_1875_2888 333
509 3300048921 Ga0496118_0047406 Ga0496118_0047406_247_1260 333
510 3300048922 Ga0496119_0002263 Ga0496119_0002263_11408_12421 333
511 3300048923 Ga0496120_0000728 Ga0496120_0000728_39322_40335 333
512 3300048925 Ga0496122_0010612 Ga0496122_0010612_5952_6965 333
513 3300048926 Ga0496123_0020411 Ga0496123_0020411_943_1956 333
514 3300048927 Ga0496124_0148430 Ga0496124_0148430_277_1290 333
515 3300048929 Ga0496126_0055817 Ga0496126_0055817_1142_2155 333
516 3300049460 Ga0495682_0000011 Ga0495682_0000011_140876_141895 333
517 3300050491 nmdc:mga00v17_83107_c1 nmdc:mga00v17_83107_c1_853_1866 333
518 iso_pu_bacteria 2599185299 2599926707 333
519 iso_pu_bacteria 2608642108 2608670176 333
520 iso_pu_bacteria 2648501693 2650895951 333
521 iso_pu_bacteria 2684622997 2686356077 333
522 iso_pu_bacteria 2808606414 2809125412 333
523 iso_pu_bacteria 2844528606 2844529305 333
524 iso_pu_bacteria 2847797336 2847798768 333
525 iso_pu_bacteria 2865014394 2865017115 333
526 iso_pu_bacteria 2904434214 2904437534 333
527 iso_pu_bacteria 2939602548 2939604390 333
528 iso_pu_bacteria 2945951305 2945952021 333
529 iso_pu_bacteria 2978975091 2978978513 333
530 iso_pu_bacteria 2984494565 2984497733 333
531 iso_pu_bacteria 2990261002 2990261678 333
532 2124908027 MRS2a_Contig_6865 MRS2a_00712760 334
533 3300001989 JGI24739J22299_10000111 JGI24739J22299_100001116 334
534 3300002705 JGI25156J39149_1017479 JGI25156J39149_10174792 334
535 3300002737 JGI25162J39368_1004043 JGI25162J39368_10040432 334
536 3300003791 Ga0055530_10000016 Ga0055530_1000001618 334
537 3300003792 Ga0055540_1000048 Ga0055540_100004818 334
538 3300003856 Ga0058692_1000510 Ga0058692_100051010 334
539 3300003856 Ga0058692_1000633 Ga0058692_10006339 334
540 3300003856 Ga0058692_1000833 Ga0058692_100083310 334
541 3300003856 Ga0058692_1002146 Ga0058692_10021465 334
542 3300005288 Ga0065714_10003520 Ga0065714_100035206 334
543 3300005288 Ga0065714_10066603 Ga0065714_100666034 334
544 3300005289 Ga0065704_10015303 Ga0065704_100153032 334
545 3300005331 Ga0070670_100003668 Ga0070670_1000036682 334
546 3300005331 Ga0070670_100006345 Ga0070670_1000063452 334
547 3300005344 Ga0070661_100000025 Ga0070661_10000002528 334
548 3300005347 Ga0070668_100008307 Ga0070668_1000083072 334
549 3300005353 Ga0070669_100002340 Ga0070669_10000234014 334
550 3300005457 Ga0070662_100004610 Ga0070662_1000046102 334
551 3300005457 Ga0070662_100007483 Ga0070662_1000074832 334
552 3300005539 Ga0068853_100131074 Ga0068853_1001310741 334
553 3300005564 Ga0070664_100000019 Ga0070664_10000001929 334
554 3300005834 Ga0068851_10000170 Ga0068851_1000017026 334
555 3300006051 Ga0075364_10006083 Ga0075364_100060836 334
556 3300006058 Ga0075432_10001128 Ga0075432_100011283 334
557 3300009011 Ga0105251_10000870 Ga0105251_1000087030 334
558 3300009011 Ga0105251_10004080 Ga0105251_100040808 334
559 3300009011 Ga0105251_10005616 Ga0105251_100056166 334
560 3300009011 Ga0105251_10005977 Ga0105251_100059777 334
561 3300009011 Ga0105251_10020137 Ga0105251_100201372 334
562 3300009011 Ga0105251_10071664 Ga0105251_100716642 334
563 3300009036 Ga0105244_10000327 Ga0105244_1000032739 334
564 3300009036 Ga0105244_10001910 Ga0105244_1000191018 334
565 3300009036 Ga0105244_10001938 Ga0105244_1000193812 334
566 3300009036 Ga0105244_10002043 Ga0105244_1000204310 334
567 3300009036 Ga0105244_10004588 Ga0105244_100045889 334
568 3300009036 Ga0105244_10020953 Ga0105244_100209533 334
569 3300009092 Ga0105250_10000337 Ga0105250_100003372 334
570 3300009148 Ga0105243_10000067 Ga0105243_1000006728 334
571 3300009176 Ga0105242_10002802 Ga0105242_1000280210 334
572 3300009545 Ga0105237_10000093 Ga0105237_100000933 334
573 3300011119 Ga0105246_10008857 Ga0105246_100088572 334
574 3300011119 Ga0105246_10018354 Ga0105246_100183544 334
575 3300013100 Ga0157373_10047786 Ga0157373_100477863 334
576 3300013100 Ga0157373_10087852 Ga0157373_100878522 334
577 3300013100 Ga0157373_10103295 Ga0157373_101032951 334
578 3300013102 Ga0157371_10013564 Ga0157371_100135644 334
579 3300013104 Ga0157370_10000053 Ga0157370_1000005366 334
580 3300013104 Ga0157370_10037342 Ga0157370_100373423 334
581 3300013104 Ga0157370_10285909 Ga0157370_102859092 334
582 3300013105 Ga0157369_10011611 Ga0157369_100116117 334
583 3300013105 Ga0157369_10012325 Ga0157369_100123259 334
584 3300013306 Ga0163162_10242625 Ga0163162_102426252 334
585 3300013306 Ga0163162_10257219 Ga0163162_102572192 334
586 3300013307 Ga0157372_10027933 Ga0157372_100279333 334
587 3300013308 Ga0157375_10001719 Ga0157375_1000171918 334
588 3300013308 Ga0157375_10052240 Ga0157375_100522402 334
589 3300014497 Ga0182008_10009313 Ga0182008_100093133 334
590 3300014497 Ga0182008_10089892 Ga0182008_100898922 334
591 3300015261 Ga0182006_1006542 Ga0182006_10065423 334
592 3300015262 Ga0182007_10002335 Ga0182007_100023356 334
593 3300015262 Ga0182007_10008173 Ga0182007_100081732 334
594 3300015262 Ga0182007_10009615 Ga0182007_100096152 334
595 3300025233 Ga0209437_100115 Ga0209437_100115147 334
596 3300025256 Ga0209759_1007984 Ga0209759_10079843 334
597 3300025292 Ga0209676_1003489 Ga0209676_10034892 334
598 3300025298 Ga0209050_1000013 Ga0209050_1000013228 334
599 3300025303 Ga0209051_1000007 Ga0209051_1000007228 334
600 3300025711 Ga0207696_1000090 Ga0207696_1000090168 334
601 3300025711 Ga0207696_1000176 Ga0207696_100017656 334
602 3300025711 Ga0207696_1000177 Ga0207696_100017753 334
603 3300025711 Ga0207696_1000348 Ga0207696_100034821 334
604 3300025728 Ga0207655_1000006 Ga0207655_1000006314 334
605 3300025728 Ga0207655_1000137 Ga0207655_100013758 334
606 3300025728 Ga0207655_1000171 Ga0207655_100017140 334
607 3300025728 Ga0207655_1000628 Ga0207655_100062812 334
608 3300025728 Ga0207655_1002225 Ga0207655_100222513 334
609 3300025728 Ga0207655_1033103 Ga0207655_10331032 334
610 3300025728 Ga0207655_1048410 Ga0207655_10484102 334
611 3300025735 Ga0207713_1000001 Ga0207713_10000012069 334
612 3300025735 Ga0207713_1006091 Ga0207713_10060917 334
613 3300025735 Ga0207713_1048709 Ga0207713_10487092 334
614 3300025914 Ga0207671_10000261 Ga0207671_1000026110 334
615 3300025920 Ga0207649_10000207 Ga0207649_1000020729 334
616 3300025925 Ga0207650_10000145 Ga0207650_1000014558 334
617 3300025925 Ga0207650_10001015 Ga0207650_1000101517 334
618 3300025933 Ga0207706_10002953 Ga0207706_100029538 334
619 3300025934 Ga0207686_10008721 Ga0207686_100087212 334
620 3300025935 Ga0207709_10000004 Ga0207709_10000004732 334
621 3300025945 Ga0207679_10000045 Ga0207679_1000004529 334
622 3300026041 Ga0207639_10027034 Ga0207639_100270343 334
623 3300027312 Ga0209371_1000084 Ga0209371_1000084128 334
624 3300027312 Ga0209371_1000127 Ga0209371_100012719 334
625 3300027312 Ga0209371_1000186 Ga0209371_100018672 334
626 3300027312 Ga0209371_1001415 Ga0209371_10014159 334
627 3300027312 Ga0209371_1007034 Ga0209371_10070343 334
628 3300027907 Ga0207428_10012907 Ga0207428_100129073 334
629 3300030500 Ga0268256_1000075 Ga0268256_100007537 334
630 3300030500 Ga0268256_1000104 Ga0268256_100010419 334
631 3300030500 Ga0268256_1001212 Ga0268256_10012129 334
632 3300031548 Ga0307408_100123246 Ga0307408_1001232462 334
633 3300031731 Ga0307405_10000073 Ga0307405_100000732 334
634 3300042006 Ga0439432_004301 Ga0439432_004301_419_1423 334
635 3300042010 Ga0439452_000015 Ga0439452_000015_236027_237049 334
636 3300042146 Ga0450907_000104 Ga0450907_000104_8571_9617 334
637 3300042439 Ga0439464_0016940 Ga0439464_0016940_512_1516 334
638 3300042439 Ga0439464_0029536 Ga0439464_0029536_432_1478 334
639 3300046453 Ga0495627_000023 Ga0495627_000023_170566_171570 334
640 3300046458 Ga0495591_000025 Ga0495591_000025_114514_115518 334
641 3300046458 Ga0495591_009570 Ga0495591_009570_2425_3429 334
642 3300046474 Ga0495605_0001468 Ga0495605_0001468_8019_9023 334
643 3300046474 Ga0495605_0015260 Ga0495605_0015260_2216_3220 334
644 3300046475 Ga0495639_0000049 Ga0495639_0000049_39104_40108 334
645 3300046499 Ga0495594_0002273 Ga0495594_0002273_3575_4579 334
646 3300046501 Ga0495607_0000069 Ga0495607_0000069_60424_61428 334
647 3300046501 Ga0495607_0001068 Ga0495607_0001068_18369_19373 334
648 3300046501 Ga0495607_0022294 Ga0495607_0022294_1889_2893 334
649 3300046501 Ga0495607_0085198 Ga0495607_0085198_36_1040 334
650 3300046507 Ga0495606_0000155 Ga0495606_0000155_106146_107150 334
651 3300046513 Ga0495616_0111828 Ga0495616_0111828_100_1104 334
652 3300046515 Ga0495620_0000110 Ga0495620_0000110_20955_21959 334
653 3300046515 Ga0495620_0013063 Ga0495620_0013063_2649_3653 334
654 3300046519 Ga0495632_0017180 Ga0495632_0017180_2418_3422 334
655 3300046520 Ga0495637_0003528 Ga0495637_0003528_2760_3764 334
656 3300046520 Ga0495637_0004992 Ga0495637_0004992_4193_5197 334
657 3300046524 Ga0495648_0003948 Ga0495648_0003948_2973_4019 334
658 3300046542 Ga0495597_0000068 Ga0495597_0000068_26141_27145 334
659 3300046557 Ga0495622_0000528 Ga0495622_0000528_6296_7300 334
660 3300046558 Ga0495633_0000020 Ga0495633_0000020_31631_32635 334
661 3300046660 Ga0495625_0017360 Ga0495625_0017360_1897_2901 334
662 3300046664 Ga0495659_0000448 Ga0495659_0000448_3398_4402 334
663 3300046665 Ga0495661_0000009 Ga0495661_0000009_151283_152287 334
664 3300046665 Ga0495661_0000100 Ga0495661_0000100_3336_4340 334
665 3300046665 Ga0495661_0012289 Ga0495661_0012289_3374_4378 334
666 3300046694 Ga0495649_0002361 Ga0495649_0002361_7741_8745 334
667 3300046794 Ga0495589_0005686 Ga0495589_0005686_3361_4365 334
668 3300046810 Ga0495660_0000761 Ga0495660_0000761_1745_2749 334
669 3300047320 Ga0495672_0000052 Ga0495672_0000052_143592_144638 334
670 3300047323 Ga0495683_0000254 Ga0495683_0000254_13976_14980 334
671 3300047323 Ga0495683_0003858 Ga0495683_0003858_1116_2120 334
672 3300047443 Ga0495687_003713 Ga0495687_003713_6428_7432 334
673 3300047446 Ga0495679_034159 Ga0495679_034159_157_1161 334
674 3300047469 Ga0495673_0000972 Ga0495673_0000972_11685_12689 334
675 3300047673 Ga0495593_0009310 Ga0495593_0009310_4398_5402 334
676 3300048905 Ga0496102_0012212 Ga0496102_0012212_1163_2209 334
677 3300048905 Ga0496102_0053540 Ga0496102_0053540_910_1956 334
678 3300048908 Ga0496105_0007423 Ga0496105_0007423_1817_2863 334
679 3300048908 Ga0496105_0058288 Ga0496105_0058288_1310_2314 334
680 3300048909 Ga0496106_0031483 Ga0496106_0031483_2574_3578 334
681 3300048909 Ga0496106_0341149 Ga0496106_0341149_24_1046 334
682 3300048916 Ga0496113_0195220 Ga0496113_0195220_231_1277 334
683 3300048919 Ga0496116_0000237 Ga0496116_0000237_26601_27623 334
684 3300048919 Ga0496116_0002504 Ga0496116_0002504_6651_7655 334
685 3300048920 Ga0496117_0000073 Ga0496117_0000073_52667_53713 334
686 3300048920 Ga0496117_0000294 Ga0496117_0000294_35448_36494 334
687 3300048920 Ga0496117_0000359 Ga0496117_0000359_4213_5217 334
688 3300048920 Ga0496117_0001351 Ga0496117_0001351_878_1900 334
689 3300048921 Ga0496118_0000449 Ga0496118_0000449_52667_53713 334
690 3300048921 Ga0496118_0000508 Ga0496118_0000508_52943_53989 334
691 3300048921 Ga0496118_0004769 Ga0496118_0004769_9164_10186 334
692 3300048922 Ga0496119_0000400 Ga0496119_0000400_5741_6787 334
693 3300048922 Ga0496119_0000523 Ga0496119_0000523_6601_7647 334
694 3300048922 Ga0496119_0044806 Ga0496119_0044806_533_1537 334
695 3300048923 Ga0496120_0000524 Ga0496120_0000524_52588_53634 334
696 3300048923 Ga0496120_0002026 Ga0496120_0002026_6601_7647 334
697 3300048923 Ga0496120_0022124 Ga0496120_0022124_605_1609 334
698 3300048924 Ga0496121_0000626 Ga0496121_0000626_51248_52294 334
699 3300048924 Ga0496121_0039538 Ga0496121_0039538_74_1078 334
700 3300048924 Ga0496121_0062041 Ga0496121_0062041_1217_2221 334
701 3300048925 Ga0496122_0003103 Ga0496122_0003103_13970_15016 334
702 3300048925 Ga0496122_0020704 Ga0496122_0020704_1529_2533 334
703 3300048925 Ga0496122_0029999 Ga0496122_0029999_1216_2220 334
704 3300048926 Ga0496123_0004591 Ga0496123_0004591_6025_7071 334
705 3300048926 Ga0496123_0045540 Ga0496123_0045540_1547_2551 334
706 3300048927 Ga0496124_0000309 Ga0496124_0000309_1417_2421 334
707 3300048927 Ga0496124_0000600 Ga0496124_0000600_31563_32609 334
708 3300048927 Ga0496124_0062338 Ga0496124_0062338_1492_2496 334
709 3300048927 Ga0496124_0082211 Ga0496124_0082211_1045_2067 334
710 3300048928 Ga0496125_0003909 Ga0496125_0003909_7550_8596 334
711 3300048928 Ga0496125_0006719 Ga0496125_0006719_7653_8657 334
712 3300048929 Ga0496126_0053113 Ga0496126_0053113_1403_2407 334
713 3300049459 Ga0495678_000007 Ga0495678_000007_31364_32368 334
714 3300050491 nmdc:mga00v17_174512_c1 nmdc:mga00v17_174512_c1_216_1262 334
715 iso_pu_bacteria 3007419365 3007422335 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

135

383

0.93

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

102

366

0.87

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

100

348

0.84

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

95

340

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r6y-assembly1.cif.gz_A crystal structure of solute-binding protein stm0429 from salmonella enterica subsp. enterica serovar typhimurium str. lt2, target efi-510776, a closed conformation, in complex with glycerol and acetate 0.8465 23 333
5t1p-assembly5.cif.gz_E crystal structure of the putative periplasmic solute-binding protein from campylobacter jejuni 0.8405 18 333
6j2s-assembly2.cif.gz_B structure of hita bound to gallium from pseudomonas aeruginosa 0.8382 24 334
7f6r-assembly1.cif.gz_A crystal structure of metal-citrate-binding mutant (s164a) protein (mcta) of abc transporter in apo state 0.8335 25 333
6j2s-assembly2.cif.gz_B structure of hita bound to gallium from pseudomonas aeruginosa 0.8332 24 334
ID Description Score Start End Superfamily
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8938 26 290 3.40.190.10
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8669 26 120 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8594 26 290 3.40.190.10
1q35A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8556 22 292 3.40.190.10
4r6yA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.855 23 299 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0K2W9X9-F1-model_v4 deleted 0.951 1 334
AF-A0A2W5PPI8-F1-model_v4 ABC transporter substrate-binding protein 0.9488 110 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0K2W9X9-F1-model_v4 deleted 0.9455 1 334
AF-A0A7J3XZ67-F1-model_v4 Extracellular solute-binding protein 0.9431 23 333 GO:0015888
GO:0030975
GO:0030976
AF-A0A2W5PPI8-F1-model_v4 ABC transporter substrate-binding protein 0.94 110 334 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Feature Viewer

pLDDT pTM Quality
92.36 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map