F476924

General Info

Members Datasets Scaffolds Average Seq Length
714 290 1428 159

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10144180|Ga0070710_101441802
Length 186
Sequence MTLLCVPSAPPGGCHYSPDFVDETVTAYDADRSFLLQRVQPAMIGLIDGSLSTLAPIFAVALATHRPHYAFTAGLATAIGAGVSMAFSEGLSDTGEVTGRGSPLMRGTITGVGTFIGGIFHTLPFLIPHYRAALIAAVATIAIELVALAVLRWKFFETSFLRSFASVALGGAIIAGISAALGAAAG

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
184 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
189 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
190 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
191 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
192 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
290 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 2.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 10.64
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 9.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10144180 3300005437 Bacteria 1463
2 rootH1_10097624 3300003323 Bacteria 2160
3 Ga0070658_10178738 3300005327 Bacteria 1785
4 Ga0070683_100113355 3300005329 Bacteria 2559
5 Ga0070683_100232102 3300005329 Bacteria 1754
6 Ga0070690_100372650 3300005330 Bacteria 1042
7 Ga0068869_100162038 3300005334 Bacteria 1741
8 Ga0070666_10361841 3300005335 Bacteria 1039
9 Ga0070680_100018745 3300005336 Bacteria 5476
10 Ga0070680_100152938 3300005336 Bacteria 1937
11 Ga0070680_100412642 3300005336 Bacteria 1152
12 Ga0070680_100523180 3300005336 Bacteria 1016
13 Ga0070680_100797753 3300005336 Bacteria 814
14 Ga0068868_100782135 3300005338 Bacteria 860
15 Ga0070660_100008860 3300005339 Bacteria 7053
16 Ga0070660_100530554 3300005339 Bacteria 981
17 Ga0070689_100092808 3300005340 Bacteria 2382
18 Ga0070687_100323514 3300005343 Bacteria 986
19 Ga0070661_100072329 3300005344 Bacteria 2537
20 Ga0070661_100192854 3300005344 Bacteria 1554
21 Ga0070661_100449942 3300005344 Bacteria 1025
22 Ga0070675_101328879 3300005354 Bacteria 662
23 Ga0070671_100385812 3300005355 Bacteria 1197
24 Ga0070674_101314313 3300005356 Unclassified 645
25 Ga0070659_100143605 3300005366 Bacteria 1944
26 Ga0070659_100880917 3300005366 Bacteria 782
27 Ga0070667_100310441 3300005367 Bacteria 1421
28 Ga0070709_10067776 3300005434 Bacteria 2293
29 Ga0070714_100018943 3300005435 Bacteria 5599
30 Ga0070714_100256785 3300005435 Bacteria 1617
31 Ga0070714_100310941 3300005435 Bacteria 1471
32 Ga0070713_100002039 3300005436 Bacteria 13064
33 Ga0070713_100341833 3300005436 Bacteria 1387
34 Ga0070713_100588793 3300005436 Bacteria 1056
35 Ga0070710_10299952 3300005437 Bacteria 1048
36 Ga0070710_10580539 3300005437 Bacteria 778
37 Ga0070701_10486376 3300005438 Bacteria 799
38 Ga0070711_100027002 3300005439 Bacteria 3766
39 Ga0070705_100024164 3300005440 Bacteria 3276
40 Ga0070708_100013353 3300005445 Bacteria 6722
41 Ga0070708_100414941 3300005445 Bacteria 1270
42 Ga0070663_100496596 3300005455 Bacteria 1013
43 Ga0070678_100273120 3300005456 Bacteria 1426
44 Ga0070678_100345293 3300005456 Unclassified 1278
45 Ga0070662_100332327 3300005457 Bacteria 1242
46 Ga0070662_101389575 3300005457 Bacteria 605
47 Ga0070681_10094788 3300005458 Bacteria 2933
48 Ga0070681_10124950 3300005458 Bacteria 2505
49 Ga0070681_10205944 3300005458 Bacteria 1884
50 Ga0070681_10225546 3300005458 Bacteria 1788
51 Ga0070681_10508081 3300005458 Bacteria 1118
52 Ga0068867_100494196 3300005459 Bacteria 1050
53 Ga0070706_100133081 3300005467 Bacteria 2321
54 Ga0070706_100689028 3300005467 Bacteria 948
55 Ga0070707_100054143 3300005468 Bacteria 3846
56 Ga0070707_100285116 3300005468 Bacteria 1605
57 Ga0070707_100313315 3300005468 Bacteria 1525
58 Ga0070698_100613353 3300005471 Bacteria 1029
59 Ga0070679_100013515 3300005530 Bacteria 7819
60 Ga0070679_100051491 3300005530 Bacteria 4101
61 Ga0070679_100057486 3300005530 Bacteria 3877
62 Ga0070679_100334964 3300005530 Bacteria 1461
63 Ga0070679_100364856 3300005530 Bacteria 1391
64 Ga0070679_100471492 3300005530 Bacteria 1200
65 Ga0070679_100728507 3300005530 Unclassified 934
66 Ga0070684_100060538 3300005535 Bacteria 3312
67 Ga0070684_100429147 3300005535 Bacteria 1220
68 Ga0070684_101149225 3300005535 Unclassified 730
69 Ga0068853_100377359 3300005539 Bacteria 1323
70 Ga0068853_101658063 3300005539 Bacteria 620
71 Ga0070672_100789092 3300005543 Bacteria 835
72 Ga0070695_100148698 3300005545 Bacteria 1632
73 Ga0070696_100011492 3300005546 Bacteria 5930
74 Ga0070693_100021282 3300005547 Bacteria 3433
75 Ga0070665_100068379 3300005548 Bacteria 3561
76 Ga0068855_100132521 3300005563 Bacteria 2845
77 Ga0068855_100182549 3300005563 Bacteria 2371
78 Ga0068855_100289158 3300005563 Bacteria 1817
79 Ga0068855_100436286 3300005563 Bacteria 1431
80 Ga0068855_100569481 3300005563 Bacteria 1224
81 Ga0068855_100675738 3300005563 Bacteria 1107
82 Ga0068855_101564365 3300005563 Bacteria 675
83 Ga0070664_100104647 3300005564 Bacteria 2464
84 Ga0070664_100320258 3300005564 Bacteria 1405
85 Ga0070664_101429094 3300005564 Bacteria 654
86 Ga0068857_100078809 3300005577 Bacteria 2940
87 Ga0068857_100098335 3300005577 Bacteria 2625
88 Ga0068854_100905422 3300005578 Bacteria 776
89 Ga0068856_100336563 3300005614 Bacteria 1527
90 Ga0068856_100438607 3300005614 Bacteria 1326
91 Ga0068856_101002195 3300005614 Bacteria 854
92 Ga0070702_100295300 3300005615 Bacteria 1118
93 Ga0070702_101068196 3300005615 Bacteria 643
94 Ga0068852_100214527 3300005616 Bacteria 1828
95 Ga0068852_100219032 3300005616 Bacteria 1809
96 Ga0068852_100316084 3300005616 Bacteria 1515
97 Ga0068852_101630464 3300005616 Bacteria 668
98 Ga0068859_100150049 3300005617 Bacteria 2406
99 Ga0068861_100160179 3300005719 Bacteria 1855
100 Ga0068851_10618153 3300005834 Bacteria 661
101 Ga0068870_10044406 3300005840 Bacteria 2322
102 Ga0068863_100156823 3300005841 Bacteria 2179
103 Ga0068858_101147058 3300005842 Bacteria 763
104 Ga0081455_10124991 3300005937 Bacteria 2020
105 Ga0081455_10176656 3300005937 Bacteria 1621
106 Ga0081539_10004001 3300005985 Bacteria 16979
107 Ga0070717_10162053 3300006028 Bacteria 1940
108 Ga0070717_10180328 3300006028 Bacteria 1840
109 Ga0070715_10183670 3300006163 Bacteria 1050
110 Ga0070716_100057879 3300006173 Bacteria 2229
111 Ga0070716_100487369 3300006173 Bacteria 907
112 Ga0070712_100096902 3300006175 Bacteria 2172
113 Ga0070712_100116288 3300006175 Bacteria 2005
114 Ga0070712_100510539 3300006175 Unclassified 1009
115 Ga0070712_101938247 3300006175 Bacteria 516
116 Ga0097621_101318524 3300006237 Bacteria 682
117 Ga0068871_100206101 3300006358 Bacteria 1699
118 Ga0075431_100335600 3300006847 Bacteria 1522
119 Ga0075433_10155826 3300006852 Bacteria 2032
120 Ga0075433_10497676 3300006852 Bacteria 1073
121 Ga0075433_10716899 3300006852 Bacteria 876
122 Ga0075434_100110909 3300006871 Bacteria 2754
123 Ga0075434_100371983 3300006871 Bacteria 1450
124 Ga0075434_101274595 3300006871 Bacteria 746
125 Ga0097620_100150059 3300006931 Bacteria 2406
126 Ga0105251_10027162 3300009011 Bacteria 2906
127 Ga0105240_10078072 3300009093 Bacteria 4078
128 Ga0105240_10168570 3300009093 Bacteria 2595
129 Ga0105240_11456748 3300009093 Unclassified 719
130 Ga0111539_10266606 3300009094 Bacteria 1994
131 Ga0111539_10470683 3300009094 Bacteria 1463
132 Ga0105245_10171557 3300009098 Bacteria 2066
133 Ga0105245_10308762 3300009098 Unclassified 1554
134 Ga0114129_10066241 3300009147 Bacteria 5038
135 Ga0114129_10087539 3300009147 Bacteria 4319
136 Ga0114129_11780724 3300009147 Bacteria 749
137 Ga0105243_10267170 3300009148 Bacteria 1534
138 Ga0105243_10819421 3300009148 Unclassified 919
139 Ga0105243_11981966 3300009148 Bacteria 616
140 Ga0105241_10262328 3300009174 Bacteria 1468
141 Ga0105241_10416956 3300009174 Bacteria 1181
142 Ga0105241_10945988 3300009174 Bacteria 803
143 Ga0105242_10027312 3300009176 Bacteria 4530
144 Ga0105242_10528525 3300009176 Unclassified 1127
145 Ga0105237_10058856 3300009545 Bacteria 3846
146 Ga0105237_10475436 3300009545 Bacteria 1256
147 Ga0105237_12416132 3300009545 Unclassified 536
148 Ga0105238_10180038 3300009551 Bacteria 2091
149 Ga0105238_10340795 3300009551 Bacteria 1487
150 Ga0105238_11318791 3300009551 Bacteria 748
151 Ga0105249_10615477 3300009553 Bacteria 1142
152 Ga0105239_10013170 3300010375 Bacteria 9189
153 Ga0105239_10675439 3300010375 Bacteria 1180
154 Ga0105239_12049553 3300010375 Bacteria 665
155 Ga0157373_10116855 3300013100 Bacteria 1874
156 Ga0157373_10134866 3300013100 Bacteria 1736
157 Ga0157371_10144521 3300013102 Bacteria 1695
158 Ga0157371_10150653 3300013102 Bacteria 1659
159 Ga0157371_10766664 3300013102 Bacteria 725
160 Ga0157370_10061947 3300013104 Bacteria 3550
161 Ga0157370_10102251 3300013104 Bacteria 2683
162 Ga0157370_10180649 3300013104 Bacteria 1961
163 Ga0157370_10781280 3300013104 Bacteria 869
164 Ga0157369_10006426 3300013105 Bacteria 13626
165 Ga0157369_10024249 3300013105 Bacteria 6751
166 Ga0157369_10087505 3300013105 Bacteria 3326
167 Ga0157369_10224684 3300013105 Bacteria 1964
168 Ga0157369_10316144 3300013105 Bacteria 1623
169 Ga0157369_10528206 3300013105 Bacteria 1220
170 Ga0157369_11186610 3300013105 Bacteria 779
171 Ga0157374_10432255 3300013296 Bacteria 1316
172 Ga0157374_10444810 3300013296 Unclassified 1297
173 Ga0157374_10636154 3300013296 Bacteria 1078
174 Ga0157374_10814206 3300013296 Bacteria 950
175 Ga0157378_11003784 3300013297 Unclassified 869
176 Ga0157372_10204804 3300013307 Bacteria 2286
177 Ga0157372_10229806 3300013307 Bacteria 2150
178 Ga0157372_10277292 3300013307 Bacteria 1949
179 Ga0157372_10415588 3300013307 Bacteria 1567
180 Ga0157375_10176907 3300013308 Bacteria 2284
181 Ga0163163_10286987 3300014325 Bacteria 1698
182 Ga0163163_10413310 3300014325 Bacteria 1408
183 Ga0182008_10237232 3300014497 Bacteria 937
184 Ga0157377_10226841 3300014745 Unclassified 1199
185 Ga0157379_10115896 3300014968 Bacteria 2409
186 Ga0182007_10146926 3300015262 Unclassified 800
187 Ga0197907_10538464 3300020069 Bacteria 1763
188 Ga0197907_11496924 3300020069 Bacteria 2721
189 Ga0206356_10303150 3300020070 Bacteria 1575
190 Ga0206356_10304786 3300020070 Bacteria 1654
191 Ga0206356_10632632 3300020070 Bacteria 1667
192 Ga0206356_10721937 3300020070 Bacteria 1826
193 Ga0206355_1578225 3300020076 Unclassified 951
194 Ga0206354_11110297 3300020081 Bacteria 3760
195 Ga0206354_11595453 3300020081 Bacteria 1424
196 Ga0206353_10167500 3300020082 Bacteria 4116
197 Ga0206353_11762150 3300020082 Bacteria 1048
198 Ga0224712_10026174 3300022467 Bacteria 2059
199 Ga0224712_10186195 3300022467 Bacteria 938
200 Ga0224712_10267721 3300022467 Bacteria 793
201 Ga0207656_10113340 3300025321 Bacteria 1255
202 Ga0207713_1088725 3300025735 Bacteria 1092
203 Ga0207692_10108651 3300025898 Bacteria 1535
204 Ga0207642_10379491 3300025899 Bacteria 841
205 Ga0207710_10031448 3300025900 Bacteria 2321
206 Ga0207688_10360581 3300025901 Bacteria 897
207 Ga0207680_10174850 3300025903 Bacteria 1448
208 Ga0207647_10211340 3300025904 Bacteria 1120
209 Ga0207699_10083969 3300025906 Bacteria 1982
210 Ga0207699_10458760 3300025906 Bacteria 915
211 Ga0207699_10473924 3300025906 Bacteria 901
212 Ga0207699_10478502 3300025906 Unclassified 897
213 Ga0207643_10030053 3300025908 Bacteria 3023
214 Ga0207705_10134952 3300025909 Bacteria 1839
215 Ga0207705_10137992 3300025909 Bacteria 1819
216 Ga0207705_10497719 3300025909 Bacteria 946
217 Ga0207705_10579585 3300025909 Bacteria 872
218 Ga0207684_10679902 3300025910 Bacteria 876
219 Ga0207654_10797800 3300025911 Bacteria 682
220 Ga0207707_10107584 3300025912 Bacteria 2438
221 Ga0207707_10130255 3300025912 Bacteria 2200
222 Ga0207707_10159957 3300025912 Bacteria 1969
223 Ga0207707_10612667 3300025912 Unclassified 920
224 Ga0207707_10756651 3300025912 Bacteria 812
225 Ga0207695_10099742 3300025913 Bacteria 2901
226 Ga0207695_10119226 3300025913 Bacteria 2609
227 Ga0207695_10381210 3300025913 Bacteria 1296
228 Ga0207671_10480749 3300025914 Bacteria 990
229 Ga0207693_10017254 3300025915 Bacteria 5757
230 Ga0207693_10105996 3300025915 Bacteria 2204
231 Ga0207693_10127319 3300025915 Bacteria 2002
232 Ga0207693_10132306 3300025915 Bacteria 1961
233 Ga0207693_10470329 3300025915 Unclassified 982
234 Ga0207693_10972844 3300025915 Unclassified 649
235 Ga0207663_10546918 3300025916 Bacteria 905
236 Ga0207663_10573060 3300025916 Bacteria 884
237 Ga0207663_10782475 3300025916 Unclassified 759
238 Ga0207660_10030615 3300025917 Bacteria 3700
239 Ga0207660_10288987 3300025917 Bacteria 1303
240 Ga0207660_10303458 3300025917 Bacteria 1272
241 Ga0207660_11146717 3300025917 Bacteria 633
242 Ga0207657_10009333 3300025919 Bacteria 9874
243 Ga0207657_10020324 3300025919 Bacteria 6277
244 Ga0207657_10029814 3300025919 Bacteria 4960
245 Ga0207657_10045506 3300025919 Bacteria 3851
246 Ga0207657_10070674 3300025919 Bacteria 2958
247 Ga0207657_10156439 3300025919 Bacteria 1853
248 Ga0207657_10292244 3300025919 Bacteria 1292
249 Ga0207649_10091705 3300025920 Bacteria 1991
250 Ga0207649_10162335 3300025920 Bacteria 1549
251 Ga0207649_10540561 3300025920 Unclassified 890
252 Ga0207649_10602345 3300025920 Bacteria 845
253 Ga0207652_10052441 3300025921 Bacteria 3501
254 Ga0207652_10308349 3300025921 Bacteria 1429
255 Ga0207652_10706593 3300025921 Bacteria 899
256 Ga0207652_10826978 3300025921 Bacteria 821
257 Ga0207646_10004627 3300025922 Bacteria 14860
258 Ga0207646_10065360 3300025922 Bacteria 3247
259 Ga0207646_10238240 3300025922 Bacteria 1644
260 Ga0207694_10097852 3300025924 Bacteria 2322
261 Ga0207694_10127067 3300025924 Bacteria 2041
262 Ga0207694_10318479 3300025924 Bacteria 1283
263 Ga0207659_10579036 3300025926 Bacteria 956
264 Ga0207687_10127254 3300025927 Bacteria 1915
265 Ga0207687_10334818 3300025927 Unclassified 1229
266 Ga0207687_10592592 3300025927 Bacteria 934
267 Ga0207700_10000001 3300025928 Bacteria 1122509
268 Ga0207700_10174991 3300025928 Bacteria 1793
269 Ga0207700_10472335 3300025928 Bacteria 1107
270 Ga0207664_10016143 3300025929 Bacteria 5441
271 Ga0207664_10038163 3300025929 Bacteria 3723
272 Ga0207664_10126117 3300025929 Bacteria 2149
273 Ga0207664_10162735 3300025929 Bacteria 1904
274 Ga0207664_10789181 3300025929 Bacteria 854
275 Ga0207664_11093649 3300025929 Unclassified 713
276 Ga0207644_10512287 3300025931 Bacteria 991
277 Ga0207690_10034271 3300025932 Bacteria 3270
278 Ga0207690_10058997 3300025932 Bacteria 2598
279 Ga0207690_10059320 3300025932 Bacteria 2592
280 Ga0207690_10417347 3300025932 Bacteria 1073
281 Ga0207690_10666243 3300025932 Bacteria 854
282 Ga0207706_10037879 3300025933 Bacteria 4279
283 Ga0207706_10905280 3300025933 Bacteria 745
284 Ga0207686_10601713 3300025934 Unclassified 865
285 Ga0207670_10882086 3300025936 Bacteria 748
286 Ga0207669_10205359 3300025937 Bacteria 1434
287 Ga0207665_10001956 3300025939 Bacteria 13858
288 Ga0207665_10094519 3300025939 Bacteria 2076
289 Ga0207665_10718184 3300025939 Bacteria 786
290 Ga0207691_10076258 3300025940 Bacteria 3022
291 Ga0207711_10100821 3300025941 Bacteria 2554
292 Ga0207689_10004793 3300025942 Bacteria 12197
293 Ga0207661_10047724 3300025944 Bacteria 3401
294 Ga0207661_10084904 3300025944 Bacteria 2624
295 Ga0207661_10332319 3300025944 Bacteria 1368
296 Ga0207661_10540088 3300025944 Bacteria 1067
297 Ga0207661_10888989 3300025944 Bacteria 820
298 Ga0207679_11564442 3300025945 Bacteria 604
299 Ga0207667_10083868 3300025949 Bacteria 3299
300 Ga0207667_10150305 3300025949 Bacteria 2397
301 Ga0207667_10341469 3300025949 Bacteria 1528
302 Ga0207667_10345634 3300025949 Bacteria 1517
303 Ga0207667_10558465 3300025949 Unclassified 1157
304 Ga0207667_10935902 3300025949 Bacteria 857
305 Ga0207667_11040833 3300025949 Bacteria 804
306 Ga0207640_11204782 3300025981 Bacteria 673
307 Ga0207658_10226996 3300025986 Bacteria 1574
308 Ga0207677_11290247 3300026023 Bacteria 670
309 Ga0207678_10001425 3300026067 Bacteria 21927
310 Ga0207678_10585943 3300026067 Unclassified 977
311 Ga0207702_10034848 3300026078 Bacteria 4210
312 Ga0207702_10111759 3300026078 Bacteria 2430
313 Ga0207702_10340712 3300026078 Bacteria 1432
314 Ga0207702_11203465 3300026078 Bacteria 752
315 Ga0207674_10009796 3300026116 Bacteria 10912
316 Ga0207674_10023944 3300026116 Bacteria 6530
317 Ga0207674_10119230 3300026116 Bacteria 2608
318 Ga0207674_11330557 3300026116 Bacteria 688
319 Ga0207675_100061420 3300026118 Bacteria 3507
320 Ga0207675_100550253 3300026118 Bacteria 1153
321 Ga0207683_10018853 3300026121 Bacteria 5886
322 Ga0207683_10179137 3300026121 Bacteria 1921
323 Ga0207698_10253885 3300026142 Bacteria 1611
324 Ga0207698_11441627 3300026142 Bacteria 704
325 Ga0207428_10008222 3300027907 Bacteria 9434
326 Ga0268265_10058741 3300028380 Bacteria 2939
327 Ga0265337_1000303 3300028556 Bacteria 26144
328 Ga0265338_10098997 3300028800 Unclassified 2383
329 Ga0265338_10343089 3300028800 Unclassified 1076
330 Ga0265320_10036127 3300031240 Bacteria 2499
331 Ga0265340_10108985 3300031247 Bacteria 1281
332 Ga0265314_10252875 3300031711 Bacteria 1011
333 Ga0316583_10009479 3300032133 Bacteria 3506
334 Ga0373938_0023505 3300034957 Bacteria 1268
335 Ga0373926_0078253 3300035083 Unclassified 1220
336 Ga0373928_0038845 3300035084 Bacteria 1085
337 Ga0373949_0073862 3300035090 Bacteria 898
338 Ga0373923_0399868 3300035111 Unclassified 661
339 Ga0373936_0437579 3300035113 Unclassified 603
340 Ga0373941_0008720 3300035115 Bacteria 2530
341 Ga0373945_0026849 3300035116 Bacteria 2008
342 Ga0373954_0392687 3300035118 Unclassified 686
343 Ga0373956_0343812 3300035119 Unclassified 711
344 Ga0373960_0017725 3300035121 Bacteria 1848
345 Ga0373943_0262180 3300035170 Bacteria 973
346 Ga0373943_0592649 3300035170 Bacteria 652
347 Ga0373946_0078444 3300035171 Unclassified 1441
348 Ga0373942_0079554 3300035207 Bacteria 971
349 Ga0373961_0354944 3300035241 Unclassified 554
350 Ga0373962_0035193 3300035242 Bacteria 1390
351 Ga0373935_0215122 3300035692 Unclassified 1333
352 Ga0373935_0644443 3300035692 Bacteria 777
353 Ga0373935_1163580 3300035692 Unclassified 575
354 Ga0373927_0295580 3300035695 Bacteria 1066
355 Ga0373927_0377192 3300035695 Bacteria 935
356 Ga0373933_0055382 3300035724 Bacteria 2379
357 Ga0373947_0004671 3300035725 Bacteria 8028
358 Ga0373947_0558372 3300035725 Bacteria 779
359 Ga0373937_0027040 3300036401 Bacteria 5185
360 Ga0373937_0056510 3300036401 Bacteria 3604
361 Ga0373937_0386084 3300036401 Unclassified 1328
362 Ga0373925_0221508 3300037068 Bacteria 1510
363 Ga0373925_0527720 3300037068 Bacteria 970
364 Ga0395899_0003070 3300037312 Bacteria 13307
365 Ga0395899_0050833 3300037312 Bacteria 3076
366 Ga0395899_0181197 3300037312 Bacteria 1479
367 Ga0395899_0283790 3300037312 Bacteria 1125
368 Ga0395899_0393235 3300037312 Unclassified 919
369 Ga0395900_0004291 3300037418 Bacteria 15114
370 Ga0395900_0053991 3300037418 Bacteria 4136
371 Ga0395900_0084043 3300037418 Bacteria 3270
372 Ga0395900_0198048 3300037418 Bacteria 2034
373 Ga0395900_0243452 3300037418 Bacteria 1803
374 Ga0395900_0353317 3300037418 Bacteria 1443
375 Ga0395900_0361595 3300037418 Bacteria 1423
376 Ga0395900_0867547 3300037418 Bacteria 827
377 Ga0395898_0005687 3300037466 Bacteria 13435
378 Ga0395898_0018637 3300037466 Bacteria 7076
379 Ga0395898_0199520 3300037466 Bacteria 1910
380 Ga0395898_0245690 3300037466 Bacteria 1707
381 Ga0395898_0264307 3300037466 Unclassified 1641
382 Ga0395898_0436959 3300037466 Bacteria 1247
383 Ga0395898_0567727 3300037466 Bacteria 1077
384 Ga0395898_0764508 3300037466 Bacteria 907
385 Ga0395898_1068883 3300037466 Bacteria 741
386 Ga0395898_1248621 3300037466 Bacteria 673
387 Ga0395905_0007602 3300037471 Bacteria 10761
388 Ga0395905_0025852 3300037471 Bacteria 5533
389 Ga0395905_0027590 3300037471 Bacteria 5354
390 Ga0395905_0039342 3300037471 Bacteria 4436
391 Ga0395905_0201346 3300037471 Bacteria 1866
392 Ga0395905_0509649 3300037471 Bacteria 1103
393 Ga0395901_0001204 3300038443 Bacteria 27493
394 Ga0395901_0006114 3300038443 Bacteria 12198
395 Ga0395901_0020367 3300038443 Bacteria 6790
396 Ga0395901_0041442 3300038443 Bacteria 4772
397 Ga0395901_0059617 3300038443 Bacteria 3971
398 Ga0395901_0094232 3300038443 Bacteria 3136
399 Ga0395901_0212678 3300038443 Bacteria 2023
400 Ga0395901_0335026 3300038443 Bacteria 1563
401 Ga0395901_0469871 3300038443 Bacteria 1284
402 Ga0395901_0563954 3300038443 Bacteria 1153
403 Ga0395901_0693898 3300038443 Unclassified 1016
404 Ga0395901_0728276 3300038443 Bacteria 987
405 Ga0395901_0745601 3300038443 Bacteria 973
406 Ga0395901_0855920 3300038443 Bacteria 894
407 Ga0395901_0923616 3300038443 Bacteria 853
408 Ga0395901_1349372 3300038443 Bacteria 673
409 Ga0242419_003968 3300038698 Bacteria 1018
410 Ga0242420_018167 3300038996 Bacteria 1236
411 Ga0436365_0119942 3300039437 Unclassified 1027
412 Ga0436365_1657328 3300039437 Bacteria 1875
413 Ga0436363_0411511 3300039450 Bacteria 2317
414 Ga0436362_0632253 3300039453 Unclassified 942
415 Ga0451793_0774295 3300041452 Bacteria 790
416 Ga0451800_1315738 3300041459 Bacteria 1160
417 Ga0451833_0229488 3300041491 Bacteria 654
418 Ga0451849_0298821 3300041505 Bacteria 1542
419 Ga0451853_1363423 3300041512 Bacteria 951
420 Ga0451853_1693471 3300041512 Bacteria 2572
421 Ga0466969_0000416 3300044656 Bacteria 23320
422 Ga0466969_0034554 3300044656 Bacteria 2561
423 Ga0466969_0062079 3300044656 Bacteria 1814
424 Ga0466969_0152573 3300044656 Bacteria 1064
425 Ga0466965_0165586 3300044683 Bacteria 1161
426 Ga0466965_0301032 3300044683 Unclassified 870
427 Ga0466965_0360824 3300044683 Unclassified 797
428 Ga0466965_0377848 3300044683 Bacteria 780
429 Ga0466966_0026940 3300044684 Bacteria 3748
430 Ga0466966_0105133 3300044684 Bacteria 1743
431 Ga0466966_0289169 3300044684 Bacteria 985
432 Ga0466966_0305803 3300044684 Bacteria 955
433 Ga0466961_0032654 3300044693 Bacteria 3345
434 Ga0466961_0041061 3300044693 Bacteria 2965
435 Ga0466961_0043803 3300044693 Bacteria 2865
436 Ga0466961_0044333 3300044693 Bacteria 2846
437 Ga0466961_0356966 3300044693 Bacteria 889
438 Ga0466961_0370186 3300044693 Bacteria 871
439 Ga0466963_0000055 3300044694 Bacteria 37968
440 Ga0466963_0004990 3300044694 Bacteria 7747
441 Ga0466963_0006939 3300044694 Bacteria 6738
442 Ga0466963_0033564 3300044694 Bacteria 3333
443 Ga0466963_0078327 3300044694 Bacteria 2234
444 Ga0466963_0109706 3300044694 Bacteria 1893
445 Ga0466963_0118080 3300044694 Bacteria 1824
446 Ga0466963_0173418 3300044694 Bacteria 1504
447 Ga0466963_0233012 3300044694 Bacteria 1290
448 Ga0466963_0308312 3300044694 Bacteria 1113
449 Ga0466963_0315925 3300044694 Bacteria 1099
450 Ga0466963_0705705 3300044694 Archaea 712
451 Ga0466964_0037854 3300044706 Unclassified 1938
452 Ga0466964_0078069 3300044706 Bacteria 1415
453 Ga0466964_0113272 3300044706 Bacteria 1213
454 Ga0466964_0843875 3300044706 Unclassified 520
455 Ga0466971_0001289 3300044719 Bacteria 10464
456 Ga0466971_0001665 3300044719 Bacteria 9393
457 Ga0466971_0028337 3300044719 Bacteria 2506
458 Ga0466971_0036589 3300044719 Bacteria 2201
459 Ga0466971_0040227 3300044719 Bacteria 2100
460 Ga0466968_0006553 3300044735 Bacteria 4394
461 Ga0466968_0024813 3300044735 Bacteria 2452
462 Ga0466968_0073683 3300044735 Bacteria 1490
463 Ga0466968_0306962 3300044735 Bacteria 764
464 Ga0466968_0588345 3300044735 Unclassified 561
465 Ga0466970_0059057 3300044765 Bacteria 2054
466 Ga0466970_0314081 3300044765 Bacteria 885
467 Ga0466970_0541138 3300044765 Bacteria 672
468 Ga0466957_0000919 3300044842 Bacteria 15079
469 Ga0466957_0016592 3300044842 Bacteria 4307
470 Ga0466957_0016687 3300044842 Bacteria 4295
471 Ga0466957_0024670 3300044842 Bacteria 3560
472 Ga0466957_0305382 3300044842 Bacteria 1070
473 Ga0466957_0319994 3300044842 Bacteria 1046
474 Ga0466957_1070901 3300044842 Archaea 581
475 Ga0466959_0000761 3300045049 Bacteria 18843
476 Ga0466959_0037704 3300045049 Bacteria 3572
477 Ga0466959_0098996 3300045049 Bacteria 2088
478 Ga0466959_0159447 3300045049 Bacteria 1586
479 Ga0466959_0495459 3300045049 Bacteria 826
480 Ga0451576_0460799 3300045051 Bacteria 1335
481 Ga0466958_0000980 3300045836 Bacteria 12902
482 Ga0466958_0003538 3300045836 Bacteria 8123
483 Ga0466958_0011776 3300045836 Bacteria 4937
484 Ga0466958_0036545 3300045836 Bacteria 2941
485 Ga0466958_0264396 3300045836 Bacteria 1101
486 Ga0466967_0006265 3300045976 Bacteria 8391
487 Ga0466967_0008256 3300045976 Bacteria 7605
488 Ga0466967_0009834 3300045976 Bacteria 7132
489 Ga0466967_0034604 3300045976 Bacteria 4290
490 Ga0466967_0053233 3300045976 Bacteria 3556
491 Ga0466967_0076844 3300045976 Bacteria 3004
492 Ga0466967_0078859 3300045976 Bacteria 2967
493 Ga0466967_0081344 3300045976 Bacteria 2925
494 Ga0466967_0099988 3300045976 Bacteria 2649
495 Ga0466967_0118146 3300045976 Bacteria 2445
496 Ga0466967_0129801 3300045976 Bacteria 2338
497 Ga0466967_0234686 3300045976 Bacteria 1747
498 Ga0466967_0235994 3300045976 Bacteria 1743
499 Ga0466967_0238028 3300045976 Bacteria 1735
500 Ga0466967_0312156 3300045976 Bacteria 1515
501 Ga0466967_0441058 3300045976 Bacteria 1271
502 Ga0466967_0719415 3300045976 Bacteria 989
503 Ga0466967_0811490 3300045976 Bacteria 929
504 Ga0466967_1325334 3300045976 Bacteria 717
505 Ga0466967_1327450 3300045976 Bacteria 716
506 Ga0466967_1443316 3300045976 Bacteria 685
507 Ga0495592_0114740 3300046454 Unclassified 1902
508 Ga0495592_0180740 3300046454 Bacteria 1437
509 Ga0495629_0032484 3300046459 Bacteria 3695
510 Ga0495629_0077562 3300046459 Bacteria 2319
511 Ga0495629_0398343 3300046459 Unclassified 936
512 Ga0495641_0099560 3300046461 Unclassified 1297
513 Ga0495641_0248756 3300046461 Bacteria 799
514 Ga0495641_0341600 3300046461 Bacteria 676
515 Ga0495641_0408121 3300046461 Bacteria 616
516 Ga0495641_0434110 3300046461 Bacteria 597
517 Ga0495651_0041099 3300046462 Bacteria 3592
518 Ga0495651_0080743 3300046462 Bacteria 2456
519 Ga0495651_0098007 3300046462 Bacteria 2188
520 Ga0495651_0706982 3300046462 Unclassified 628
521 Ga0495653_0039247 3300046463 Bacteria 3710
522 Ga0495653_0193343 3300046463 Bacteria 1386
523 Ga0495653_0456477 3300046463 Bacteria 803
524 Ga0495580_0296459 3300046472 Bacteria 1102
525 Ga0495582_0014320 3300046473 Bacteria 4361
526 Ga0495582_0665604 3300046473 Bacteria 602
527 Ga0495662_0522440 3300046476 Unclassified 582
528 Ga0495664_0218540 3300046477 Bacteria 1154
529 Ga0495608_0018480 3300046511 Bacteria 4808
530 Ga0495608_0040218 3300046511 Bacteria 3133
531 Ga0495608_0466167 3300046511 Bacteria 767
532 Ga0495628_0135048 3300046516 Bacteria 1886
533 Ga0495628_0628707 3300046516 Unclassified 764
534 Ga0495630_0055067 3300046517 Bacteria 2980
535 Ga0495630_0692814 3300046517 Unclassified 780
536 Ga0495644_0249087 3300046523 Bacteria 690
537 Ga0495652_0053666 3300046529 Bacteria 3435
538 Ga0495652_0129750 3300046529 Unclassified 1997
539 Ga0495640_0233498 3300046533 Bacteria 1156
540 Ga0495586_0000744 3300046535 Bacteria 18696
541 Ga0495587_0021953 3300046536 Bacteria 3934
542 Ga0495587_0121202 3300046536 Bacteria 1498
543 Ga0495645_0110485 3300046543 Unclassified 1946
544 Ga0495667_0012097 3300046559 Bacteria 5845
545 Ga0495667_0038099 3300046559 Bacteria 3202
546 Ga0495656_0080125 3300046615 Bacteria 1472
547 Ga0495634_0372424 3300046642 Bacteria 852
548 Ga0495635_0076743 3300046663 Bacteria 2290
549 Ga0495635_0872184 3300046663 Bacteria 577
550 Ga0495659_0225878 3300046664 Bacteria 774
551 Ga0495657_0028235 3300046675 Bacteria 3949
552 Ga0495657_0225831 3300046675 Unclassified 1134
553 Ga0495657_0535788 3300046675 Bacteria 681
554 Ga0495657_0711969 3300046675 Bacteria 577
555 Ga0495599_0069761 3300046678 Unclassified 2193
556 Ga0495599_0229307 3300046678 Bacteria 1134
557 Ga0495623_0012946 3300046679 Bacteria 5399
558 Ga0495646_0124958 3300046680 Bacteria 1453
559 Ga0495658_0038255 3300046683 Bacteria 2656
560 Ga0495658_0243364 3300046683 Bacteria 1130
561 Ga0495658_0636222 3300046683 Bacteria 683
562 Ga0495613_0048918 3300046689 Bacteria 3121
563 Ga0495613_0064480 3300046689 Bacteria 2679
564 Ga0495613_0143356 3300046689 Bacteria 1706
565 Ga0495613_0777328 3300046689 Bacteria 626
566 Ga0495624_0071704 3300046690 Bacteria 2155
567 Ga0495624_0248320 3300046690 Bacteria 1076
568 Ga0495589_0017212 3300046794 Bacteria 3712
569 Ga0495600_0087754 3300046809 Bacteria 2029
570 Ga0495600_0102764 3300046809 Bacteria 1863
571 Ga0495581_0398263 3300047315 Bacteria 803
572 Ga0495604_0104955 3300047317 Bacteria 2069
573 Ga0495674_0057067 3300047319 Bacteria 3418
574 Ga0495674_0162618 3300047319 Bacteria 1867
575 Ga0495674_0298703 3300047319 Bacteria 1316
576 Ga0495676_0154887 3300047321 Bacteria 1627
577 Ga0495676_0822226 3300047321 Unclassified 597
578 Ga0495680_0006379 3300047322 Bacteria 10973
579 Ga0495680_0021203 3300047322 Bacteria 5444
580 Ga0495680_0097937 3300047322 Bacteria 2189
581 Ga0495680_0757873 3300047322 Bacteria 637
582 Ga0495675_0117686 3300047444 Unclassified 1656
583 Ga0495675_0140872 3300047444 Bacteria 1495
584 Ga0495684_0016275 3300047471 Bacteria 5726
585 Ga0495684_0030774 3300047471 Bacteria 4121
586 Ga0495684_0083757 3300047471 Bacteria 2419
587 Ga0495593_0330626 3300047673 Bacteria 762
588 Ga0495602_0049222 3300048088 Bacteria 3777
589 Ga0495602_0293627 3300048088 Unclassified 1192
590 Ga0496100_0038887 3300048903 Bacteria 3017
591 Ga0496100_0083926 3300048903 Bacteria 2158
592 Ga0496101_0005743 3300048904 Bacteria 7927
593 Ga0496101_0008872 3300048904 Bacteria 6583
594 Ga0496101_0385215 3300048904 Bacteria 1103
595 Ga0496101_0567058 3300048904 Unclassified 898
596 Ga0496101_0880783 3300048904 Bacteria 705
597 Ga0496102_0041444 3300048905 Bacteria 4169
598 Ga0496102_0097386 3300048905 Bacteria 2728
599 Ga0496102_0355371 3300048905 Bacteria 1379
600 Ga0496102_0425739 3300048905 Bacteria 1247
601 Ga0496102_1223115 3300048905 Bacteria 671
602 Ga0496102_1462254 3300048905 Archaea 602
603 Ga0496103_0243264 3300048906 Bacteria 1158
604 Ga0496104_0042593 3300048907 Bacteria 4261
605 Ga0496104_0077385 3300048907 Bacteria 3170
606 Ga0496104_0108399 3300048907 Bacteria 2662
607 Ga0496104_0589440 3300048907 Bacteria 1022
608 Ga0496104_1224448 3300048907 Bacteria 654
609 Ga0496104_1278849 3300048907 Bacteria 637
610 Ga0496105_0001009 3300048908 Bacteria 19456
611 Ga0496105_0051839 3300048908 Bacteria 3388
612 Ga0496105_0059383 3300048908 Bacteria 3156
613 Ga0496106_0048960 3300048909 Bacteria 3183
614 Ga0496106_0204971 3300048909 Bacteria 1570
615 Ga0496106_0530183 3300048909 Bacteria 945
616 Ga0496107_0118830 3300048910 Bacteria 1946
617 Ga0496107_0238463 3300048910 Bacteria 1353
618 Ga0496107_0989581 3300048910 Unclassified 610
619 Ga0496108_0062726 3300048911 Bacteria 3129
620 Ga0496108_0065980 3300048911 Bacteria 3052
621 Ga0496108_0152179 3300048911 Bacteria 1996
622 Ga0496108_0337900 3300048911 Bacteria 1314
623 Ga0496108_0484336 3300048911 Bacteria 1081
624 Ga0496109_0001990 3300048912 Bacteria 16940
625 Ga0496109_0089325 3300048912 Bacteria 2848
626 Ga0496109_0159628 3300048912 Bacteria 2112
627 Ga0496109_0266127 3300048912 Bacteria 1615
628 Ga0496109_0282493 3300048912 Bacteria 1564
629 Ga0496109_0520902 3300048912 Bacteria 1122
630 Ga0496110_0014624 3300048913 Bacteria 6520
631 Ga0496110_0026581 3300048913 Bacteria 4955
632 Ga0496110_0038192 3300048913 Bacteria 4176
633 Ga0496110_0055427 3300048913 Bacteria 3488
634 Ga0496110_0139427 3300048913 Bacteria 2192
635 Ga0496110_0258881 3300048913 Bacteria 1584
636 Ga0496110_0438408 3300048913 Bacteria 1191
637 Ga0496110_0801814 3300048913 Bacteria 846
638 Ga0496110_1543378 3300048913 Bacteria 574
639 Ga0496111_0017069 3300048914 Bacteria 5011
640 Ga0496111_0061242 3300048914 Bacteria 2728
641 Ga0496111_0241543 3300048914 Bacteria 1341
642 Ga0496111_0309581 3300048914 Bacteria 1170
643 Ga0496111_0382394 3300048914 Bacteria 1041
644 Ga0496112_0008753 3300048915 Bacteria 9080
645 Ga0496112_0016684 3300048915 Bacteria 6885
646 Ga0496112_0048149 3300048915 Bacteria 4180
647 Ga0496112_0132384 3300048915 Bacteria 2464
648 Ga0496112_0336711 3300048915 Bacteria 1452
649 Ga0496112_0346109 3300048915 Bacteria 1429
650 Ga0496112_0350679 3300048915 Bacteria 1418
651 Ga0496112_0531893 3300048915 Bacteria 1110
652 Ga0496112_0534120 3300048915 Bacteria 1107
653 Ga0496112_1722560 3300048915 Bacteria 539
654 Ga0496113_0043876 3300048916 Bacteria 3310
655 Ga0496113_0048764 3300048916 Bacteria 3152
656 Ga0496113_0084245 3300048916 Bacteria 2440
657 Ga0496113_0663475 3300048916 Bacteria 834
658 Ga0496114_0049876 3300048917 Bacteria 3483
659 Ga0496114_0097329 3300048917 Bacteria 2506
660 Ga0496114_0191951 3300048917 Bacteria 1787
661 Ga0496114_0472871 3300048917 Bacteria 1109
662 Ga0496115_0059418 3300048918 Bacteria 3079
663 Ga0496115_0180289 3300048918 Bacteria 1746
664 Ga0501034_0676801 3300049571 Bacteria 932
665 Ga0501047_0059298 3300049581 Bacteria 3695
666 Ga0501047_0671412 3300049581 Bacteria 855
667 Ga0501067_0003763 3300049583 Bacteria 8362
668 Ga0501067_0192541 3300049583 Bacteria 1136
669 Ga0501069_0002252 3300049585 Bacteria 9730
670 Ga0501069_0033384 3300049585 Bacteria 2835
671 Ga0501069_0232927 3300049585 Bacteria 1072
672 Ga0501070_0008023 3300049586 Bacteria 8941
673 Ga0501070_0069654 3300049586 Bacteria 2912
674 Ga0501070_0348497 3300049586 Bacteria 1202
675 Ga0501070_0402145 3300049586 Unclassified 1107
676 Ga0501073_0226210 3300049589 Bacteria 1292
677 Ga0501074_0300206 3300049590 Bacteria 1141
678 Ga0501077_0922745 3300049593 Bacteria 562
679 Ga0501080_0275235 3300049742 Bacteria 1531
680 nmdc:mga0yw44_64454_c1 3300050492 Bacteria 2255
681 nmdc:mga05p37_189678_c1 3300050507 Bacteria 2497
682 nmdc:mga05p37_79810_c1 3300050507 Bacteria 4030
683 nmdc:mga06r32_292232_c1 3300050510 Bacteria 1616
684 nmdc:mga06r32_87547_c1 3300050510 Bacteria 3039
685 nmdc:mga08y16_40411_c1 3300050511 Bacteria 4890
686 nmdc:mga0n895_108484_c1 3300050512 Bacteria 2791
687 nmdc:mga0n895_147591_c1 3300050512 Bacteria 2381
688 nmdc:mga0n895_239718_c1 3300050512 Bacteria 1840
689 nmdc:mga0n895_329642_c1 3300050512 Bacteria 1547
690 nmdc:mga0rr50_204876_c1 3300050513 Bacteria 1623
691 nmdc:mga0rr50_26778_c1 3300050513 Bacteria 4030
692 nmdc:mga0a205_298857_c1 3300050515 Bacteria 1483
693 nmdc:mga0a205_459034_c1 3300050515 Bacteria 1133
694 nmdc:mga0a205_65807_c1 3300050515 Bacteria 3503
695 Ga0495612_0036382 3300053078 Bacteria 1998
696 Ga0495612_0170506 3300053078 Unclassified 953
697 Ga0495655_0003040 3300053083 Bacteria 2723
698 Ga0495595_0010440 3300053084 Bacteria 3858
699 Ga0495595_0107568 3300053084 Bacteria 1350
700 Ga0495595_0203565 3300053084 Bacteria 986
701 Ga0495595_0371250 3300053084 Bacteria 723
702 Ga0495619_0013521 3300053085 Bacteria 5142
703 Ga0495619_0134191 3300053085 Bacteria 1702
704 Ga0501084_0435919 3300054114 Unclassified 1108
705 Ga0587088_052178 3300059508 Bacteria 804
706 Ga0587115_040399 3300059626 Bacteria 727
707 Ga0587079_069933 3300059647 Bacteria 781
708 Ga0587114_022586 3300059655 Bacteria 901
709 Ga0466962_0001098 3300061719 Bacteria 12452
710 Ga0466962_0003534 3300061719 Bacteria 7448
711 Ga0466962_0013237 3300061719 Bacteria 3966
712 Ga0466962_0091742 3300061719 Bacteria 1456
713 Ga0530510_0024659 3300061734 Bacteria 4295
714 Ga0530510_0156658 3300061734 Bacteria 1684
715 Ga0070710_10144180
716 rootH1_10097624
717 Ga0070658_10178738
718 Ga0070683_100113355
719 Ga0070683_100232102
720 Ga0070690_100372650
721 Ga0068869_100162038
722 Ga0070666_10361841
723 Ga0070680_100018745
724 Ga0070680_100152938
725 Ga0070680_100412642
726 Ga0070680_100523180
727 Ga0070680_100797753
728 Ga0068868_100782135
729 Ga0070660_100008860
730 Ga0070660_100530554
731 Ga0070689_100092808
732 Ga0070687_100323514
733 Ga0070661_100072329
734 Ga0070661_100192854
735 Ga0070661_100449942
736 Ga0070675_101328879
737 Ga0070671_100385812
738 Ga0070674_101314313
739 Ga0070659_100143605
740 Ga0070659_100880917
741 Ga0070667_100310441
742 Ga0070709_10067776
743 Ga0070714_100018943
744 Ga0070714_100256785
745 Ga0070714_100310941
746 Ga0070713_100002039
747 Ga0070713_100341833
748 Ga0070713_100588793
749 Ga0070710_10299952
750 Ga0070710_10580539
751 Ga0070701_10486376
752 Ga0070711_100027002
753 Ga0070705_100024164
754 Ga0070708_100013353
755 Ga0070708_100414941
756 Ga0070663_100496596
757 Ga0070678_100273120
758 Ga0070678_100345293
759 Ga0070662_100332327
760 Ga0070662_101389575
761 Ga0070681_10094788
762 Ga0070681_10124950
763 Ga0070681_10205944
764 Ga0070681_10225546
765 Ga0070681_10508081
766 Ga0068867_100494196
767 Ga0070706_100133081
768 Ga0070706_100689028
769 Ga0070707_100054143
770 Ga0070707_100285116
771 Ga0070707_100313315
772 Ga0070698_100613353
773 Ga0070679_100013515
774 Ga0070679_100051491
775 Ga0070679_100057486
776 Ga0070679_100334964
777 Ga0070679_100364856
778 Ga0070679_100471492
779 Ga0070679_100728507
780 Ga0070684_100060538
781 Ga0070684_100429147
782 Ga0070684_101149225
783 Ga0068853_100377359
784 Ga0068853_101658063
785 Ga0070672_100789092
786 Ga0070695_100148698
787 Ga0070696_100011492
788 Ga0070693_100021282
789 Ga0070665_100068379
790 Ga0068855_100132521
791 Ga0068855_100182549
792 Ga0068855_100289158
793 Ga0068855_100436286
794 Ga0068855_100569481
795 Ga0068855_100675738
796 Ga0068855_101564365
797 Ga0070664_100104647
798 Ga0070664_100320258
799 Ga0070664_101429094
800 Ga0068857_100078809
801 Ga0068857_100098335
802 Ga0068854_100905422
803 Ga0068856_100336563
804 Ga0068856_100438607
805 Ga0068856_101002195
806 Ga0070702_100295300
807 Ga0070702_101068196
808 Ga0068852_100214527
809 Ga0068852_100219032
810 Ga0068852_100316084
811 Ga0068852_101630464
812 Ga0068859_100150049
813 Ga0068861_100160179
814 Ga0068851_10618153
815 Ga0068870_10044406
816 Ga0068863_100156823
817 Ga0068858_101147058
818 Ga0081455_10124991
819 Ga0081455_10176656
820 Ga0081539_10004001
821 Ga0070717_10162053
822 Ga0070717_10180328
823 Ga0070715_10183670
824 Ga0070716_100057879
825 Ga0070716_100487369
826 Ga0070712_100096902
827 Ga0070712_100116288
828 Ga0070712_100510539
829 Ga0070712_101938247
830 Ga0097621_101318524
831 Ga0068871_100206101
832 Ga0075431_100335600
833 Ga0075433_10155826
834 Ga0075433_10497676
835 Ga0075433_10716899
836 Ga0075434_100110909
837 Ga0075434_100371983
838 Ga0075434_101274595
839 Ga0097620_100150059
840 Ga0105251_10027162
841 Ga0105240_10078072
842 Ga0105240_10168570
843 Ga0105240_11456748
844 Ga0111539_10266606
845 Ga0111539_10470683
846 Ga0105245_10171557
847 Ga0105245_10308762
848 Ga0114129_10066241
849 Ga0114129_10087539
850 Ga0114129_11780724
851 Ga0105243_10267170
852 Ga0105243_10819421
853 Ga0105243_11981966
854 Ga0105241_10262328
855 Ga0105241_10416956
856 Ga0105241_10945988
857 Ga0105242_10027312
858 Ga0105242_10528525
859 Ga0105237_10058856
860 Ga0105237_10475436
861 Ga0105237_12416132
862 Ga0105238_10180038
863 Ga0105238_10340795
864 Ga0105238_11318791
865 Ga0105249_10615477
866 Ga0105239_10013170
867 Ga0105239_10675439
868 Ga0105239_12049553
869 Ga0157373_10116855
870 Ga0157373_10134866
871 Ga0157371_10144521
872 Ga0157371_10150653
873 Ga0157371_10766664
874 Ga0157370_10061947
875 Ga0157370_10102251
876 Ga0157370_10180649
877 Ga0157370_10781280
878 Ga0157369_10006426
879 Ga0157369_10024249
880 Ga0157369_10087505
881 Ga0157369_10224684
882 Ga0157369_10316144
883 Ga0157369_10528206
884 Ga0157369_11186610
885 Ga0157374_10432255
886 Ga0157374_10444810
887 Ga0157374_10636154
888 Ga0157374_10814206
889 Ga0157378_11003784
890 Ga0157372_10204804
891 Ga0157372_10229806
892 Ga0157372_10277292
893 Ga0157372_10415588
894 Ga0157375_10176907
895 Ga0163163_10286987
896 Ga0163163_10413310
897 Ga0182008_10237232
898 Ga0157377_10226841
899 Ga0157379_10115896
900 Ga0182007_10146926
901 Ga0197907_10538464
902 Ga0197907_11496924
903 Ga0206356_10303150
904 Ga0206356_10304786
905 Ga0206356_10632632
906 Ga0206356_10721937
907 Ga0206355_1578225
908 Ga0206354_11110297
909 Ga0206354_11595453
910 Ga0206353_10167500
911 Ga0206353_11762150
912 Ga0224712_10026174
913 Ga0224712_10186195
914 Ga0224712_10267721
915 Ga0207656_10113340
916 Ga0207713_1088725
917 Ga0207692_10108651
918 Ga0207642_10379491
919 Ga0207710_10031448
920 Ga0207688_10360581
921 Ga0207680_10174850
922 Ga0207647_10211340
923 Ga0207699_10083969
924 Ga0207699_10458760
925 Ga0207699_10473924
926 Ga0207699_10478502
927 Ga0207643_10030053
928 Ga0207705_10134952
929 Ga0207705_10137992
930 Ga0207705_10497719
931 Ga0207705_10579585
932 Ga0207684_10679902
933 Ga0207654_10797800
934 Ga0207707_10107584
935 Ga0207707_10130255
936 Ga0207707_10159957
937 Ga0207707_10612667
938 Ga0207707_10756651
939 Ga0207695_10099742
940 Ga0207695_10119226
941 Ga0207695_10381210
942 Ga0207671_10480749
943 Ga0207693_10017254
944 Ga0207693_10105996
945 Ga0207693_10127319
946 Ga0207693_10132306
947 Ga0207693_10470329
948 Ga0207693_10972844
949 Ga0207663_10546918
950 Ga0207663_10573060
951 Ga0207663_10782475
952 Ga0207660_10030615
953 Ga0207660_10288987
954 Ga0207660_10303458
955 Ga0207660_11146717
956 Ga0207657_10009333
957 Ga0207657_10020324
958 Ga0207657_10029814
959 Ga0207657_10045506
960 Ga0207657_10070674
961 Ga0207657_10156439
962 Ga0207657_10292244
963 Ga0207649_10091705
964 Ga0207649_10162335
965 Ga0207649_10540561
966 Ga0207649_10602345
967 Ga0207652_10052441
968 Ga0207652_10308349
969 Ga0207652_10706593
970 Ga0207652_10826978
971 Ga0207646_10004627
972 Ga0207646_10065360
973 Ga0207646_10238240
974 Ga0207694_10097852
975 Ga0207694_10127067
976 Ga0207694_10318479
977 Ga0207659_10579036
978 Ga0207687_10127254
979 Ga0207687_10334818
980 Ga0207687_10592592
981 Ga0207700_10000001
982 Ga0207700_10174991
983 Ga0207700_10472335
984 Ga0207664_10016143
985 Ga0207664_10038163
986 Ga0207664_10126117
987 Ga0207664_10162735
988 Ga0207664_10789181
989 Ga0207664_11093649
990 Ga0207644_10512287
991 Ga0207690_10034271
992 Ga0207690_10058997
993 Ga0207690_10059320
994 Ga0207690_10417347
995 Ga0207690_10666243
996 Ga0207706_10037879
997 Ga0207706_10905280
998 Ga0207686_10601713
999 Ga0207670_10882086
1000 Ga0207669_10205359
1001 Ga0207665_10001956
1002 Ga0207665_10094519
1003 Ga0207665_10718184
1004 Ga0207691_10076258
1005 Ga0207711_10100821
1006 Ga0207689_10004793
1007 Ga0207661_10047724
1008 Ga0207661_10084904
1009 Ga0207661_10332319
1010 Ga0207661_10540088
1011 Ga0207661_10888989
1012 Ga0207679_11564442
1013 Ga0207667_10083868
1014 Ga0207667_10150305
1015 Ga0207667_10341469
1016 Ga0207667_10345634
1017 Ga0207667_10558465
1018 Ga0207667_10935902
1019 Ga0207667_11040833
1020 Ga0207640_11204782
1021 Ga0207658_10226996
1022 Ga0207677_11290247
1023 Ga0207678_10001425
1024 Ga0207678_10585943
1025 Ga0207702_10034848
1026 Ga0207702_10111759
1027 Ga0207702_10340712
1028 Ga0207702_11203465
1029 Ga0207674_10009796
1030 Ga0207674_10023944
1031 Ga0207674_10119230
1032 Ga0207674_11330557
1033 Ga0207675_100061420
1034 Ga0207675_100550253
1035 Ga0207683_10018853
1036 Ga0207683_10179137
1037 Ga0207698_10253885
1038 Ga0207698_11441627
1039 Ga0207428_10008222
1040 Ga0268265_10058741
1041 Ga0265337_1000303
1042 Ga0265338_10098997
1043 Ga0265338_10343089
1044 Ga0265320_10036127
1045 Ga0265340_10108985
1046 Ga0265314_10252875
1047 Ga0316583_10009479
1048 Ga0373938_0023505
1049 Ga0373926_0078253
1050 Ga0373928_0038845
1051 Ga0373949_0073862
1052 Ga0373923_0399868
1053 Ga0373936_0437579
1054 Ga0373941_0008720
1055 Ga0373945_0026849
1056 Ga0373954_0392687
1057 Ga0373956_0343812
1058 Ga0373960_0017725
1059 Ga0373943_0262180
1060 Ga0373943_0592649
1061 Ga0373946_0078444
1062 Ga0373942_0079554
1063 Ga0373961_0354944
1064 Ga0373962_0035193
1065 Ga0373935_0215122
1066 Ga0373935_0644443
1067 Ga0373935_1163580
1068 Ga0373927_0295580
1069 Ga0373927_0377192
1070 Ga0373933_0055382
1071 Ga0373947_0004671
1072 Ga0373947_0558372
1073 Ga0373937_0027040
1074 Ga0373937_0056510
1075 Ga0373937_0386084
1076 Ga0373925_0221508
1077 Ga0373925_0527720
1078 Ga0395899_0003070
1079 Ga0395899_0050833
1080 Ga0395899_0181197
1081 Ga0395899_0283790
1082 Ga0395899_0393235
1083 Ga0395900_0004291
1084 Ga0395900_0053991
1085 Ga0395900_0084043
1086 Ga0395900_0198048
1087 Ga0395900_0243452
1088 Ga0395900_0353317
1089 Ga0395900_0361595
1090 Ga0395900_0867547
1091 Ga0395898_0005687
1092 Ga0395898_0018637
1093 Ga0395898_0199520
1094 Ga0395898_0245690
1095 Ga0395898_0264307
1096 Ga0395898_0436959
1097 Ga0395898_0567727
1098 Ga0395898_0764508
1099 Ga0395898_1068883
1100 Ga0395898_1248621
1101 Ga0395905_0007602
1102 Ga0395905_0025852
1103 Ga0395905_0027590
1104 Ga0395905_0039342
1105 Ga0395905_0201346
1106 Ga0395905_0509649
1107 Ga0395901_0001204
1108 Ga0395901_0006114
1109 Ga0395901_0020367
1110 Ga0395901_0041442
1111 Ga0395901_0059617
1112 Ga0395901_0094232
1113 Ga0395901_0212678
1114 Ga0395901_0335026
1115 Ga0395901_0469871
1116 Ga0395901_0563954
1117 Ga0395901_0693898
1118 Ga0395901_0728276
1119 Ga0395901_0745601
1120 Ga0395901_0855920
1121 Ga0395901_0923616
1122 Ga0395901_1349372
1123 Ga0242419_003968
1124 Ga0242420_018167
1125 Ga0436365_0119942
1126 Ga0436365_1657328
1127 Ga0436363_0411511
1128 Ga0436362_0632253
1129 Ga0451793_0774295
1130 Ga0451800_1315738
1131 Ga0451833_0229488
1132 Ga0451849_0298821
1133 Ga0451853_1363423
1134 Ga0451853_1693471
1135 Ga0466969_0000416
1136 Ga0466969_0034554
1137 Ga0466969_0062079
1138 Ga0466969_0152573
1139 Ga0466965_0165586
1140 Ga0466965_0301032
1141 Ga0466965_0360824
1142 Ga0466965_0377848
1143 Ga0466966_0026940
1144 Ga0466966_0105133
1145 Ga0466966_0289169
1146 Ga0466966_0305803
1147 Ga0466961_0032654
1148 Ga0466961_0041061
1149 Ga0466961_0043803
1150 Ga0466961_0044333
1151 Ga0466961_0356966
1152 Ga0466961_0370186
1153 Ga0466963_0000055
1154 Ga0466963_0004990
1155 Ga0466963_0006939
1156 Ga0466963_0033564
1157 Ga0466963_0078327
1158 Ga0466963_0109706
1159 Ga0466963_0118080
1160 Ga0466963_0173418
1161 Ga0466963_0233012
1162 Ga0466963_0308312
1163 Ga0466963_0315925
1164 Ga0466963_0705705
1165 Ga0466964_0037854
1166 Ga0466964_0078069
1167 Ga0466964_0113272
1168 Ga0466964_0843875
1169 Ga0466971_0001289
1170 Ga0466971_0001665
1171 Ga0466971_0028337
1172 Ga0466971_0036589
1173 Ga0466971_0040227
1174 Ga0466968_0006553
1175 Ga0466968_0024813
1176 Ga0466968_0073683
1177 Ga0466968_0306962
1178 Ga0466968_0588345
1179 Ga0466970_0059057
1180 Ga0466970_0314081
1181 Ga0466970_0541138
1182 Ga0466957_0000919
1183 Ga0466957_0016592
1184 Ga0466957_0016687
1185 Ga0466957_0024670
1186 Ga0466957_0305382
1187 Ga0466957_0319994
1188 Ga0466957_1070901
1189 Ga0466959_0000761
1190 Ga0466959_0037704
1191 Ga0466959_0098996
1192 Ga0466959_0159447
1193 Ga0466959_0495459
1194 Ga0451576_0460799
1195 Ga0466958_0000980
1196 Ga0466958_0003538
1197 Ga0466958_0011776
1198 Ga0466958_0036545
1199 Ga0466958_0264396
1200 Ga0466967_0006265
1201 Ga0466967_0008256
1202 Ga0466967_0009834
1203 Ga0466967_0034604
1204 Ga0466967_0053233
1205 Ga0466967_0076844
1206 Ga0466967_0078859
1207 Ga0466967_0081344
1208 Ga0466967_0099988
1209 Ga0466967_0118146
1210 Ga0466967_0129801
1211 Ga0466967_0234686
1212 Ga0466967_0235994
1213 Ga0466967_0238028
1214 Ga0466967_0312156
1215 Ga0466967_0441058
1216 Ga0466967_0719415
1217 Ga0466967_0811490
1218 Ga0466967_1325334
1219 Ga0466967_1327450
1220 Ga0466967_1443316
1221 Ga0495592_0114740
1222 Ga0495592_0180740
1223 Ga0495629_0032484
1224 Ga0495629_0077562
1225 Ga0495629_0398343
1226 Ga0495641_0099560
1227 Ga0495641_0248756
1228 Ga0495641_0341600
1229 Ga0495641_0408121
1230 Ga0495641_0434110
1231 Ga0495651_0041099
1232 Ga0495651_0080743
1233 Ga0495651_0098007
1234 Ga0495651_0706982
1235 Ga0495653_0039247
1236 Ga0495653_0193343
1237 Ga0495653_0456477
1238 Ga0495580_0296459
1239 Ga0495582_0014320
1240 Ga0495582_0665604
1241 Ga0495662_0522440
1242 Ga0495664_0218540
1243 Ga0495608_0018480
1244 Ga0495608_0040218
1245 Ga0495608_0466167
1246 Ga0495628_0135048
1247 Ga0495628_0628707
1248 Ga0495630_0055067
1249 Ga0495630_0692814
1250 Ga0495644_0249087
1251 Ga0495652_0053666
1252 Ga0495652_0129750
1253 Ga0495640_0233498
1254 Ga0495586_0000744
1255 Ga0495587_0021953
1256 Ga0495587_0121202
1257 Ga0495645_0110485
1258 Ga0495667_0012097
1259 Ga0495667_0038099
1260 Ga0495656_0080125
1261 Ga0495634_0372424
1262 Ga0495635_0076743
1263 Ga0495635_0872184
1264 Ga0495659_0225878
1265 Ga0495657_0028235
1266 Ga0495657_0225831
1267 Ga0495657_0535788
1268 Ga0495657_0711969
1269 Ga0495599_0069761
1270 Ga0495599_0229307
1271 Ga0495623_0012946
1272 Ga0495646_0124958
1273 Ga0495658_0038255
1274 Ga0495658_0243364
1275 Ga0495658_0636222
1276 Ga0495613_0048918
1277 Ga0495613_0064480
1278 Ga0495613_0143356
1279 Ga0495613_0777328
1280 Ga0495624_0071704
1281 Ga0495624_0248320
1282 Ga0495589_0017212
1283 Ga0495600_0087754
1284 Ga0495600_0102764
1285 Ga0495581_0398263
1286 Ga0495604_0104955
1287 Ga0495674_0057067
1288 Ga0495674_0162618
1289 Ga0495674_0298703
1290 Ga0495676_0154887
1291 Ga0495676_0822226
1292 Ga0495680_0006379
1293 Ga0495680_0021203
1294 Ga0495680_0097937
1295 Ga0495680_0757873
1296 Ga0495675_0117686
1297 Ga0495675_0140872
1298 Ga0495684_0016275
1299 Ga0495684_0030774
1300 Ga0495684_0083757
1301 Ga0495593_0330626
1302 Ga0495602_0049222
1303 Ga0495602_0293627
1304 Ga0496100_0038887
1305 Ga0496100_0083926
1306 Ga0496101_0005743
1307 Ga0496101_0008872
1308 Ga0496101_0385215
1309 Ga0496101_0567058
1310 Ga0496101_0880783
1311 Ga0496102_0041444
1312 Ga0496102_0097386
1313 Ga0496102_0355371
1314 Ga0496102_0425739
1315 Ga0496102_1223115
1316 Ga0496102_1462254
1317 Ga0496103_0243264
1318 Ga0496104_0042593
1319 Ga0496104_0077385
1320 Ga0496104_0108399
1321 Ga0496104_0589440
1322 Ga0496104_1224448
1323 Ga0496104_1278849
1324 Ga0496105_0001009
1325 Ga0496105_0051839
1326 Ga0496105_0059383
1327 Ga0496106_0048960
1328 Ga0496106_0204971
1329 Ga0496106_0530183
1330 Ga0496107_0118830
1331 Ga0496107_0238463
1332 Ga0496107_0989581
1333 Ga0496108_0062726
1334 Ga0496108_0065980
1335 Ga0496108_0152179
1336 Ga0496108_0337900
1337 Ga0496108_0484336
1338 Ga0496109_0001990
1339 Ga0496109_0089325
1340 Ga0496109_0159628
1341 Ga0496109_0266127
1342 Ga0496109_0282493
1343 Ga0496109_0520902
1344 Ga0496110_0014624
1345 Ga0496110_0026581
1346 Ga0496110_0038192
1347 Ga0496110_0055427
1348 Ga0496110_0139427
1349 Ga0496110_0258881
1350 Ga0496110_0438408
1351 Ga0496110_0801814
1352 Ga0496110_1543378
1353 Ga0496111_0017069
1354 Ga0496111_0061242
1355 Ga0496111_0241543
1356 Ga0496111_0309581
1357 Ga0496111_0382394
1358 Ga0496112_0008753
1359 Ga0496112_0016684
1360 Ga0496112_0048149
1361 Ga0496112_0132384
1362 Ga0496112_0336711
1363 Ga0496112_0346109
1364 Ga0496112_0350679
1365 Ga0496112_0531893
1366 Ga0496112_0534120
1367 Ga0496112_1722560
1368 Ga0496113_0043876
1369 Ga0496113_0048764
1370 Ga0496113_0084245
1371 Ga0496113_0663475
1372 Ga0496114_0049876
1373 Ga0496114_0097329
1374 Ga0496114_0191951
1375 Ga0496114_0472871
1376 Ga0496115_0059418
1377 Ga0496115_0180289
1378 Ga0501034_0676801
1379 Ga0501047_0059298
1380 Ga0501047_0671412
1381 Ga0501067_0003763
1382 Ga0501067_0192541
1383 Ga0501069_0002252
1384 Ga0501069_0033384
1385 Ga0501069_0232927
1386 Ga0501070_0008023
1387 Ga0501070_0069654
1388 Ga0501070_0348497
1389 Ga0501070_0402145
1390 Ga0501073_0226210
1391 Ga0501074_0300206
1392 Ga0501077_0922745
1393 Ga0501080_0275235
1394 nmdc:mga0yw44_64454_c1
1395 nmdc:mga05p37_189678_c1
1396 nmdc:mga05p37_79810_c1
1397 nmdc:mga06r32_292232_c1
1398 nmdc:mga06r32_87547_c1
1399 nmdc:mga08y16_40411_c1
1400 nmdc:mga0n895_108484_c1
1401 nmdc:mga0n895_147591_c1
1402 nmdc:mga0n895_239718_c1
1403 nmdc:mga0n895_329642_c1
1404 nmdc:mga0rr50_204876_c1
1405 nmdc:mga0rr50_26778_c1
1406 nmdc:mga0a205_298857_c1
1407 nmdc:mga0a205_459034_c1
1408 nmdc:mga0a205_65807_c1
1409 Ga0495612_0036382
1410 Ga0495612_0170506
1411 Ga0495655_0003040
1412 Ga0495595_0010440
1413 Ga0495595_0107568
1414 Ga0495595_0203565
1415 Ga0495595_0371250
1416 Ga0495619_0013521
1417 Ga0495619_0134191
1418 Ga0501084_0435919
1419 Ga0587088_052178
1420 Ga0587115_040399
1421 Ga0587079_069933
1422 Ga0587114_022586
1423 Ga0466962_0001098
1424 Ga0466962_0003534
1425 Ga0466962_0013237
1426 Ga0466962_0091742
1427 Ga0530510_0024659
1428 Ga0530510_0156658

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.7889 12 157
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.7297 12 157
7zq9-assembly1.cif.gz_L2 dimeric psi of chlamydomonas reinhardtii at 2.74 a resolution (symmetry expanded) 0.5422 12 111
3whn-assembly2.cif.gz_B hemerythrin-like domain of dcrh i119h mutant (met) 0.5379 20 114
7zqd-assembly1.cif.gz_L dimeric psi of chlamydomonas reinhardtii at 2.97 a resolution 0.5037 12 112
ID Description Score Start End Superfamily
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8792 13 155 1.20.1260.10
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8683 12 155 1.20.1260.10
af_Q54H42_48_275_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8652 13 155 1.20.1260.10
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7948 13 155 1.20.1260.10
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7904 12 155 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A856NMQ2-F1-model_v4 deleted 0.9875 4 158
AF-A0A538GHW0-F1-model_v4 VIT family protein 0.9863 4 156 GO:0016020
AF-A0A087C1I6-F1-model_v4 Rubrerythrin 0.9852 4 156 GO:0016020
AF-A0A538KVX8-F1-model_v4 VIT family protein 0.985 4 158 GO:0016020
AF-A0A7W1N482-F1-model_v4 VIT family protein 0.985 1 158 GO:0016020

Map