F476924
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 290 | 1428 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10144180|Ga0070710_101441802 |
| Length | 186 |
| Sequence | MTLLCVPSAPPGGCHYSPDFVDETVTAYDADRSFLLQRVQPAMIGLIDGSLSTLAPIFAVALATHRPHYAFTAGLATAIGAGVSMAFSEGLSDTGEVTGRGSPLMRGTITGVGTFIGGIFHTLPFLIPHYRAALIAAVATIAIELVALAVLRWKFFETSFLRSFASVALGGAIIAGISAALGAAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 156 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 165 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 174 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 175 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 176 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 184 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 188 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 191 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 192 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 204 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 290 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.48 |
| Metatranscriptomes | 2.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 10.64 |
| Rhizosphere | 88.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070710_10144180 | 3300005437 | Bacteria | 1463 |
| 2 | rootH1_10097624 | 3300003323 | Bacteria | 2160 |
| 3 | Ga0070658_10178738 | 3300005327 | Bacteria | 1785 |
| 4 | Ga0070683_100113355 | 3300005329 | Bacteria | 2559 |
| 5 | Ga0070683_100232102 | 3300005329 | Bacteria | 1754 |
| 6 | Ga0070690_100372650 | 3300005330 | Bacteria | 1042 |
| 7 | Ga0068869_100162038 | 3300005334 | Bacteria | 1741 |
| 8 | Ga0070666_10361841 | 3300005335 | Bacteria | 1039 |
| 9 | Ga0070680_100018745 | 3300005336 | Bacteria | 5476 |
| 10 | Ga0070680_100152938 | 3300005336 | Bacteria | 1937 |
| 11 | Ga0070680_100412642 | 3300005336 | Bacteria | 1152 |
| 12 | Ga0070680_100523180 | 3300005336 | Bacteria | 1016 |
| 13 | Ga0070680_100797753 | 3300005336 | Bacteria | 814 |
| 14 | Ga0068868_100782135 | 3300005338 | Bacteria | 860 |
| 15 | Ga0070660_100008860 | 3300005339 | Bacteria | 7053 |
| 16 | Ga0070660_100530554 | 3300005339 | Bacteria | 981 |
| 17 | Ga0070689_100092808 | 3300005340 | Bacteria | 2382 |
| 18 | Ga0070687_100323514 | 3300005343 | Bacteria | 986 |
| 19 | Ga0070661_100072329 | 3300005344 | Bacteria | 2537 |
| 20 | Ga0070661_100192854 | 3300005344 | Bacteria | 1554 |
| 21 | Ga0070661_100449942 | 3300005344 | Bacteria | 1025 |
| 22 | Ga0070675_101328879 | 3300005354 | Bacteria | 662 |
| 23 | Ga0070671_100385812 | 3300005355 | Bacteria | 1197 |
| 24 | Ga0070674_101314313 | 3300005356 | Unclassified | 645 |
| 25 | Ga0070659_100143605 | 3300005366 | Bacteria | 1944 |
| 26 | Ga0070659_100880917 | 3300005366 | Bacteria | 782 |
| 27 | Ga0070667_100310441 | 3300005367 | Bacteria | 1421 |
| 28 | Ga0070709_10067776 | 3300005434 | Bacteria | 2293 |
| 29 | Ga0070714_100018943 | 3300005435 | Bacteria | 5599 |
| 30 | Ga0070714_100256785 | 3300005435 | Bacteria | 1617 |
| 31 | Ga0070714_100310941 | 3300005435 | Bacteria | 1471 |
| 32 | Ga0070713_100002039 | 3300005436 | Bacteria | 13064 |
| 33 | Ga0070713_100341833 | 3300005436 | Bacteria | 1387 |
| 34 | Ga0070713_100588793 | 3300005436 | Bacteria | 1056 |
| 35 | Ga0070710_10299952 | 3300005437 | Bacteria | 1048 |
| 36 | Ga0070710_10580539 | 3300005437 | Bacteria | 778 |
| 37 | Ga0070701_10486376 | 3300005438 | Bacteria | 799 |
| 38 | Ga0070711_100027002 | 3300005439 | Bacteria | 3766 |
| 39 | Ga0070705_100024164 | 3300005440 | Bacteria | 3276 |
| 40 | Ga0070708_100013353 | 3300005445 | Bacteria | 6722 |
| 41 | Ga0070708_100414941 | 3300005445 | Bacteria | 1270 |
| 42 | Ga0070663_100496596 | 3300005455 | Bacteria | 1013 |
| 43 | Ga0070678_100273120 | 3300005456 | Bacteria | 1426 |
| 44 | Ga0070678_100345293 | 3300005456 | Unclassified | 1278 |
| 45 | Ga0070662_100332327 | 3300005457 | Bacteria | 1242 |
| 46 | Ga0070662_101389575 | 3300005457 | Bacteria | 605 |
| 47 | Ga0070681_10094788 | 3300005458 | Bacteria | 2933 |
| 48 | Ga0070681_10124950 | 3300005458 | Bacteria | 2505 |
| 49 | Ga0070681_10205944 | 3300005458 | Bacteria | 1884 |
| 50 | Ga0070681_10225546 | 3300005458 | Bacteria | 1788 |
| 51 | Ga0070681_10508081 | 3300005458 | Bacteria | 1118 |
| 52 | Ga0068867_100494196 | 3300005459 | Bacteria | 1050 |
| 53 | Ga0070706_100133081 | 3300005467 | Bacteria | 2321 |
| 54 | Ga0070706_100689028 | 3300005467 | Bacteria | 948 |
| 55 | Ga0070707_100054143 | 3300005468 | Bacteria | 3846 |
| 56 | Ga0070707_100285116 | 3300005468 | Bacteria | 1605 |
| 57 | Ga0070707_100313315 | 3300005468 | Bacteria | 1525 |
| 58 | Ga0070698_100613353 | 3300005471 | Bacteria | 1029 |
| 59 | Ga0070679_100013515 | 3300005530 | Bacteria | 7819 |
| 60 | Ga0070679_100051491 | 3300005530 | Bacteria | 4101 |
| 61 | Ga0070679_100057486 | 3300005530 | Bacteria | 3877 |
| 62 | Ga0070679_100334964 | 3300005530 | Bacteria | 1461 |
| 63 | Ga0070679_100364856 | 3300005530 | Bacteria | 1391 |
| 64 | Ga0070679_100471492 | 3300005530 | Bacteria | 1200 |
| 65 | Ga0070679_100728507 | 3300005530 | Unclassified | 934 |
| 66 | Ga0070684_100060538 | 3300005535 | Bacteria | 3312 |
| 67 | Ga0070684_100429147 | 3300005535 | Bacteria | 1220 |
| 68 | Ga0070684_101149225 | 3300005535 | Unclassified | 730 |
| 69 | Ga0068853_100377359 | 3300005539 | Bacteria | 1323 |
| 70 | Ga0068853_101658063 | 3300005539 | Bacteria | 620 |
| 71 | Ga0070672_100789092 | 3300005543 | Bacteria | 835 |
| 72 | Ga0070695_100148698 | 3300005545 | Bacteria | 1632 |
| 73 | Ga0070696_100011492 | 3300005546 | Bacteria | 5930 |
| 74 | Ga0070693_100021282 | 3300005547 | Bacteria | 3433 |
| 75 | Ga0070665_100068379 | 3300005548 | Bacteria | 3561 |
| 76 | Ga0068855_100132521 | 3300005563 | Bacteria | 2845 |
| 77 | Ga0068855_100182549 | 3300005563 | Bacteria | 2371 |
| 78 | Ga0068855_100289158 | 3300005563 | Bacteria | 1817 |
| 79 | Ga0068855_100436286 | 3300005563 | Bacteria | 1431 |
| 80 | Ga0068855_100569481 | 3300005563 | Bacteria | 1224 |
| 81 | Ga0068855_100675738 | 3300005563 | Bacteria | 1107 |
| 82 | Ga0068855_101564365 | 3300005563 | Bacteria | 675 |
| 83 | Ga0070664_100104647 | 3300005564 | Bacteria | 2464 |
| 84 | Ga0070664_100320258 | 3300005564 | Bacteria | 1405 |
| 85 | Ga0070664_101429094 | 3300005564 | Bacteria | 654 |
| 86 | Ga0068857_100078809 | 3300005577 | Bacteria | 2940 |
| 87 | Ga0068857_100098335 | 3300005577 | Bacteria | 2625 |
| 88 | Ga0068854_100905422 | 3300005578 | Bacteria | 776 |
| 89 | Ga0068856_100336563 | 3300005614 | Bacteria | 1527 |
| 90 | Ga0068856_100438607 | 3300005614 | Bacteria | 1326 |
| 91 | Ga0068856_101002195 | 3300005614 | Bacteria | 854 |
| 92 | Ga0070702_100295300 | 3300005615 | Bacteria | 1118 |
| 93 | Ga0070702_101068196 | 3300005615 | Bacteria | 643 |
| 94 | Ga0068852_100214527 | 3300005616 | Bacteria | 1828 |
| 95 | Ga0068852_100219032 | 3300005616 | Bacteria | 1809 |
| 96 | Ga0068852_100316084 | 3300005616 | Bacteria | 1515 |
| 97 | Ga0068852_101630464 | 3300005616 | Bacteria | 668 |
| 98 | Ga0068859_100150049 | 3300005617 | Bacteria | 2406 |
| 99 | Ga0068861_100160179 | 3300005719 | Bacteria | 1855 |
| 100 | Ga0068851_10618153 | 3300005834 | Bacteria | 661 |
| 101 | Ga0068870_10044406 | 3300005840 | Bacteria | 2322 |
| 102 | Ga0068863_100156823 | 3300005841 | Bacteria | 2179 |
| 103 | Ga0068858_101147058 | 3300005842 | Bacteria | 763 |
| 104 | Ga0081455_10124991 | 3300005937 | Bacteria | 2020 |
| 105 | Ga0081455_10176656 | 3300005937 | Bacteria | 1621 |
| 106 | Ga0081539_10004001 | 3300005985 | Bacteria | 16979 |
| 107 | Ga0070717_10162053 | 3300006028 | Bacteria | 1940 |
| 108 | Ga0070717_10180328 | 3300006028 | Bacteria | 1840 |
| 109 | Ga0070715_10183670 | 3300006163 | Bacteria | 1050 |
| 110 | Ga0070716_100057879 | 3300006173 | Bacteria | 2229 |
| 111 | Ga0070716_100487369 | 3300006173 | Bacteria | 907 |
| 112 | Ga0070712_100096902 | 3300006175 | Bacteria | 2172 |
| 113 | Ga0070712_100116288 | 3300006175 | Bacteria | 2005 |
| 114 | Ga0070712_100510539 | 3300006175 | Unclassified | 1009 |
| 115 | Ga0070712_101938247 | 3300006175 | Bacteria | 516 |
| 116 | Ga0097621_101318524 | 3300006237 | Bacteria | 682 |
| 117 | Ga0068871_100206101 | 3300006358 | Bacteria | 1699 |
| 118 | Ga0075431_100335600 | 3300006847 | Bacteria | 1522 |
| 119 | Ga0075433_10155826 | 3300006852 | Bacteria | 2032 |
| 120 | Ga0075433_10497676 | 3300006852 | Bacteria | 1073 |
| 121 | Ga0075433_10716899 | 3300006852 | Bacteria | 876 |
| 122 | Ga0075434_100110909 | 3300006871 | Bacteria | 2754 |
| 123 | Ga0075434_100371983 | 3300006871 | Bacteria | 1450 |
| 124 | Ga0075434_101274595 | 3300006871 | Bacteria | 746 |
| 125 | Ga0097620_100150059 | 3300006931 | Bacteria | 2406 |
| 126 | Ga0105251_10027162 | 3300009011 | Bacteria | 2906 |
| 127 | Ga0105240_10078072 | 3300009093 | Bacteria | 4078 |
| 128 | Ga0105240_10168570 | 3300009093 | Bacteria | 2595 |
| 129 | Ga0105240_11456748 | 3300009093 | Unclassified | 719 |
| 130 | Ga0111539_10266606 | 3300009094 | Bacteria | 1994 |
| 131 | Ga0111539_10470683 | 3300009094 | Bacteria | 1463 |
| 132 | Ga0105245_10171557 | 3300009098 | Bacteria | 2066 |
| 133 | Ga0105245_10308762 | 3300009098 | Unclassified | 1554 |
| 134 | Ga0114129_10066241 | 3300009147 | Bacteria | 5038 |
| 135 | Ga0114129_10087539 | 3300009147 | Bacteria | 4319 |
| 136 | Ga0114129_11780724 | 3300009147 | Bacteria | 749 |
| 137 | Ga0105243_10267170 | 3300009148 | Bacteria | 1534 |
| 138 | Ga0105243_10819421 | 3300009148 | Unclassified | 919 |
| 139 | Ga0105243_11981966 | 3300009148 | Bacteria | 616 |
| 140 | Ga0105241_10262328 | 3300009174 | Bacteria | 1468 |
| 141 | Ga0105241_10416956 | 3300009174 | Bacteria | 1181 |
| 142 | Ga0105241_10945988 | 3300009174 | Bacteria | 803 |
| 143 | Ga0105242_10027312 | 3300009176 | Bacteria | 4530 |
| 144 | Ga0105242_10528525 | 3300009176 | Unclassified | 1127 |
| 145 | Ga0105237_10058856 | 3300009545 | Bacteria | 3846 |
| 146 | Ga0105237_10475436 | 3300009545 | Bacteria | 1256 |
| 147 | Ga0105237_12416132 | 3300009545 | Unclassified | 536 |
| 148 | Ga0105238_10180038 | 3300009551 | Bacteria | 2091 |
| 149 | Ga0105238_10340795 | 3300009551 | Bacteria | 1487 |
| 150 | Ga0105238_11318791 | 3300009551 | Bacteria | 748 |
| 151 | Ga0105249_10615477 | 3300009553 | Bacteria | 1142 |
| 152 | Ga0105239_10013170 | 3300010375 | Bacteria | 9189 |
| 153 | Ga0105239_10675439 | 3300010375 | Bacteria | 1180 |
| 154 | Ga0105239_12049553 | 3300010375 | Bacteria | 665 |
| 155 | Ga0157373_10116855 | 3300013100 | Bacteria | 1874 |
| 156 | Ga0157373_10134866 | 3300013100 | Bacteria | 1736 |
| 157 | Ga0157371_10144521 | 3300013102 | Bacteria | 1695 |
| 158 | Ga0157371_10150653 | 3300013102 | Bacteria | 1659 |
| 159 | Ga0157371_10766664 | 3300013102 | Bacteria | 725 |
| 160 | Ga0157370_10061947 | 3300013104 | Bacteria | 3550 |
| 161 | Ga0157370_10102251 | 3300013104 | Bacteria | 2683 |
| 162 | Ga0157370_10180649 | 3300013104 | Bacteria | 1961 |
| 163 | Ga0157370_10781280 | 3300013104 | Bacteria | 869 |
| 164 | Ga0157369_10006426 | 3300013105 | Bacteria | 13626 |
| 165 | Ga0157369_10024249 | 3300013105 | Bacteria | 6751 |
| 166 | Ga0157369_10087505 | 3300013105 | Bacteria | 3326 |
| 167 | Ga0157369_10224684 | 3300013105 | Bacteria | 1964 |
| 168 | Ga0157369_10316144 | 3300013105 | Bacteria | 1623 |
| 169 | Ga0157369_10528206 | 3300013105 | Bacteria | 1220 |
| 170 | Ga0157369_11186610 | 3300013105 | Bacteria | 779 |
| 171 | Ga0157374_10432255 | 3300013296 | Bacteria | 1316 |
| 172 | Ga0157374_10444810 | 3300013296 | Unclassified | 1297 |
| 173 | Ga0157374_10636154 | 3300013296 | Bacteria | 1078 |
| 174 | Ga0157374_10814206 | 3300013296 | Bacteria | 950 |
| 175 | Ga0157378_11003784 | 3300013297 | Unclassified | 869 |
| 176 | Ga0157372_10204804 | 3300013307 | Bacteria | 2286 |
| 177 | Ga0157372_10229806 | 3300013307 | Bacteria | 2150 |
| 178 | Ga0157372_10277292 | 3300013307 | Bacteria | 1949 |
| 179 | Ga0157372_10415588 | 3300013307 | Bacteria | 1567 |
| 180 | Ga0157375_10176907 | 3300013308 | Bacteria | 2284 |
| 181 | Ga0163163_10286987 | 3300014325 | Bacteria | 1698 |
| 182 | Ga0163163_10413310 | 3300014325 | Bacteria | 1408 |
| 183 | Ga0182008_10237232 | 3300014497 | Bacteria | 937 |
| 184 | Ga0157377_10226841 | 3300014745 | Unclassified | 1199 |
| 185 | Ga0157379_10115896 | 3300014968 | Bacteria | 2409 |
| 186 | Ga0182007_10146926 | 3300015262 | Unclassified | 800 |
| 187 | Ga0197907_10538464 | 3300020069 | Bacteria | 1763 |
| 188 | Ga0197907_11496924 | 3300020069 | Bacteria | 2721 |
| 189 | Ga0206356_10303150 | 3300020070 | Bacteria | 1575 |
| 190 | Ga0206356_10304786 | 3300020070 | Bacteria | 1654 |
| 191 | Ga0206356_10632632 | 3300020070 | Bacteria | 1667 |
| 192 | Ga0206356_10721937 | 3300020070 | Bacteria | 1826 |
| 193 | Ga0206355_1578225 | 3300020076 | Unclassified | 951 |
| 194 | Ga0206354_11110297 | 3300020081 | Bacteria | 3760 |
| 195 | Ga0206354_11595453 | 3300020081 | Bacteria | 1424 |
| 196 | Ga0206353_10167500 | 3300020082 | Bacteria | 4116 |
| 197 | Ga0206353_11762150 | 3300020082 | Bacteria | 1048 |
| 198 | Ga0224712_10026174 | 3300022467 | Bacteria | 2059 |
| 199 | Ga0224712_10186195 | 3300022467 | Bacteria | 938 |
| 200 | Ga0224712_10267721 | 3300022467 | Bacteria | 793 |
| 201 | Ga0207656_10113340 | 3300025321 | Bacteria | 1255 |
| 202 | Ga0207713_1088725 | 3300025735 | Bacteria | 1092 |
| 203 | Ga0207692_10108651 | 3300025898 | Bacteria | 1535 |
| 204 | Ga0207642_10379491 | 3300025899 | Bacteria | 841 |
| 205 | Ga0207710_10031448 | 3300025900 | Bacteria | 2321 |
| 206 | Ga0207688_10360581 | 3300025901 | Bacteria | 897 |
| 207 | Ga0207680_10174850 | 3300025903 | Bacteria | 1448 |
| 208 | Ga0207647_10211340 | 3300025904 | Bacteria | 1120 |
| 209 | Ga0207699_10083969 | 3300025906 | Bacteria | 1982 |
| 210 | Ga0207699_10458760 | 3300025906 | Bacteria | 915 |
| 211 | Ga0207699_10473924 | 3300025906 | Bacteria | 901 |
| 212 | Ga0207699_10478502 | 3300025906 | Unclassified | 897 |
| 213 | Ga0207643_10030053 | 3300025908 | Bacteria | 3023 |
| 214 | Ga0207705_10134952 | 3300025909 | Bacteria | 1839 |
| 215 | Ga0207705_10137992 | 3300025909 | Bacteria | 1819 |
| 216 | Ga0207705_10497719 | 3300025909 | Bacteria | 946 |
| 217 | Ga0207705_10579585 | 3300025909 | Bacteria | 872 |
| 218 | Ga0207684_10679902 | 3300025910 | Bacteria | 876 |
| 219 | Ga0207654_10797800 | 3300025911 | Bacteria | 682 |
| 220 | Ga0207707_10107584 | 3300025912 | Bacteria | 2438 |
| 221 | Ga0207707_10130255 | 3300025912 | Bacteria | 2200 |
| 222 | Ga0207707_10159957 | 3300025912 | Bacteria | 1969 |
| 223 | Ga0207707_10612667 | 3300025912 | Unclassified | 920 |
| 224 | Ga0207707_10756651 | 3300025912 | Bacteria | 812 |
| 225 | Ga0207695_10099742 | 3300025913 | Bacteria | 2901 |
| 226 | Ga0207695_10119226 | 3300025913 | Bacteria | 2609 |
| 227 | Ga0207695_10381210 | 3300025913 | Bacteria | 1296 |
| 228 | Ga0207671_10480749 | 3300025914 | Bacteria | 990 |
| 229 | Ga0207693_10017254 | 3300025915 | Bacteria | 5757 |
| 230 | Ga0207693_10105996 | 3300025915 | Bacteria | 2204 |
| 231 | Ga0207693_10127319 | 3300025915 | Bacteria | 2002 |
| 232 | Ga0207693_10132306 | 3300025915 | Bacteria | 1961 |
| 233 | Ga0207693_10470329 | 3300025915 | Unclassified | 982 |
| 234 | Ga0207693_10972844 | 3300025915 | Unclassified | 649 |
| 235 | Ga0207663_10546918 | 3300025916 | Bacteria | 905 |
| 236 | Ga0207663_10573060 | 3300025916 | Bacteria | 884 |
| 237 | Ga0207663_10782475 | 3300025916 | Unclassified | 759 |
| 238 | Ga0207660_10030615 | 3300025917 | Bacteria | 3700 |
| 239 | Ga0207660_10288987 | 3300025917 | Bacteria | 1303 |
| 240 | Ga0207660_10303458 | 3300025917 | Bacteria | 1272 |
| 241 | Ga0207660_11146717 | 3300025917 | Bacteria | 633 |
| 242 | Ga0207657_10009333 | 3300025919 | Bacteria | 9874 |
| 243 | Ga0207657_10020324 | 3300025919 | Bacteria | 6277 |
| 244 | Ga0207657_10029814 | 3300025919 | Bacteria | 4960 |
| 245 | Ga0207657_10045506 | 3300025919 | Bacteria | 3851 |
| 246 | Ga0207657_10070674 | 3300025919 | Bacteria | 2958 |
| 247 | Ga0207657_10156439 | 3300025919 | Bacteria | 1853 |
| 248 | Ga0207657_10292244 | 3300025919 | Bacteria | 1292 |
| 249 | Ga0207649_10091705 | 3300025920 | Bacteria | 1991 |
| 250 | Ga0207649_10162335 | 3300025920 | Bacteria | 1549 |
| 251 | Ga0207649_10540561 | 3300025920 | Unclassified | 890 |
| 252 | Ga0207649_10602345 | 3300025920 | Bacteria | 845 |
| 253 | Ga0207652_10052441 | 3300025921 | Bacteria | 3501 |
| 254 | Ga0207652_10308349 | 3300025921 | Bacteria | 1429 |
| 255 | Ga0207652_10706593 | 3300025921 | Bacteria | 899 |
| 256 | Ga0207652_10826978 | 3300025921 | Bacteria | 821 |
| 257 | Ga0207646_10004627 | 3300025922 | Bacteria | 14860 |
| 258 | Ga0207646_10065360 | 3300025922 | Bacteria | 3247 |
| 259 | Ga0207646_10238240 | 3300025922 | Bacteria | 1644 |
| 260 | Ga0207694_10097852 | 3300025924 | Bacteria | 2322 |
| 261 | Ga0207694_10127067 | 3300025924 | Bacteria | 2041 |
| 262 | Ga0207694_10318479 | 3300025924 | Bacteria | 1283 |
| 263 | Ga0207659_10579036 | 3300025926 | Bacteria | 956 |
| 264 | Ga0207687_10127254 | 3300025927 | Bacteria | 1915 |
| 265 | Ga0207687_10334818 | 3300025927 | Unclassified | 1229 |
| 266 | Ga0207687_10592592 | 3300025927 | Bacteria | 934 |
| 267 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 268 | Ga0207700_10174991 | 3300025928 | Bacteria | 1793 |
| 269 | Ga0207700_10472335 | 3300025928 | Bacteria | 1107 |
| 270 | Ga0207664_10016143 | 3300025929 | Bacteria | 5441 |
| 271 | Ga0207664_10038163 | 3300025929 | Bacteria | 3723 |
| 272 | Ga0207664_10126117 | 3300025929 | Bacteria | 2149 |
| 273 | Ga0207664_10162735 | 3300025929 | Bacteria | 1904 |
| 274 | Ga0207664_10789181 | 3300025929 | Bacteria | 854 |
| 275 | Ga0207664_11093649 | 3300025929 | Unclassified | 713 |
| 276 | Ga0207644_10512287 | 3300025931 | Bacteria | 991 |
| 277 | Ga0207690_10034271 | 3300025932 | Bacteria | 3270 |
| 278 | Ga0207690_10058997 | 3300025932 | Bacteria | 2598 |
| 279 | Ga0207690_10059320 | 3300025932 | Bacteria | 2592 |
| 280 | Ga0207690_10417347 | 3300025932 | Bacteria | 1073 |
| 281 | Ga0207690_10666243 | 3300025932 | Bacteria | 854 |
| 282 | Ga0207706_10037879 | 3300025933 | Bacteria | 4279 |
| 283 | Ga0207706_10905280 | 3300025933 | Bacteria | 745 |
| 284 | Ga0207686_10601713 | 3300025934 | Unclassified | 865 |
| 285 | Ga0207670_10882086 | 3300025936 | Bacteria | 748 |
| 286 | Ga0207669_10205359 | 3300025937 | Bacteria | 1434 |
| 287 | Ga0207665_10001956 | 3300025939 | Bacteria | 13858 |
| 288 | Ga0207665_10094519 | 3300025939 | Bacteria | 2076 |
| 289 | Ga0207665_10718184 | 3300025939 | Bacteria | 786 |
| 290 | Ga0207691_10076258 | 3300025940 | Bacteria | 3022 |
| 291 | Ga0207711_10100821 | 3300025941 | Bacteria | 2554 |
| 292 | Ga0207689_10004793 | 3300025942 | Bacteria | 12197 |
| 293 | Ga0207661_10047724 | 3300025944 | Bacteria | 3401 |
| 294 | Ga0207661_10084904 | 3300025944 | Bacteria | 2624 |
| 295 | Ga0207661_10332319 | 3300025944 | Bacteria | 1368 |
| 296 | Ga0207661_10540088 | 3300025944 | Bacteria | 1067 |
| 297 | Ga0207661_10888989 | 3300025944 | Bacteria | 820 |
| 298 | Ga0207679_11564442 | 3300025945 | Bacteria | 604 |
| 299 | Ga0207667_10083868 | 3300025949 | Bacteria | 3299 |
| 300 | Ga0207667_10150305 | 3300025949 | Bacteria | 2397 |
| 301 | Ga0207667_10341469 | 3300025949 | Bacteria | 1528 |
| 302 | Ga0207667_10345634 | 3300025949 | Bacteria | 1517 |
| 303 | Ga0207667_10558465 | 3300025949 | Unclassified | 1157 |
| 304 | Ga0207667_10935902 | 3300025949 | Bacteria | 857 |
| 305 | Ga0207667_11040833 | 3300025949 | Bacteria | 804 |
| 306 | Ga0207640_11204782 | 3300025981 | Bacteria | 673 |
| 307 | Ga0207658_10226996 | 3300025986 | Bacteria | 1574 |
| 308 | Ga0207677_11290247 | 3300026023 | Bacteria | 670 |
| 309 | Ga0207678_10001425 | 3300026067 | Bacteria | 21927 |
| 310 | Ga0207678_10585943 | 3300026067 | Unclassified | 977 |
| 311 | Ga0207702_10034848 | 3300026078 | Bacteria | 4210 |
| 312 | Ga0207702_10111759 | 3300026078 | Bacteria | 2430 |
| 313 | Ga0207702_10340712 | 3300026078 | Bacteria | 1432 |
| 314 | Ga0207702_11203465 | 3300026078 | Bacteria | 752 |
| 315 | Ga0207674_10009796 | 3300026116 | Bacteria | 10912 |
| 316 | Ga0207674_10023944 | 3300026116 | Bacteria | 6530 |
| 317 | Ga0207674_10119230 | 3300026116 | Bacteria | 2608 |
| 318 | Ga0207674_11330557 | 3300026116 | Bacteria | 688 |
| 319 | Ga0207675_100061420 | 3300026118 | Bacteria | 3507 |
| 320 | Ga0207675_100550253 | 3300026118 | Bacteria | 1153 |
| 321 | Ga0207683_10018853 | 3300026121 | Bacteria | 5886 |
| 322 | Ga0207683_10179137 | 3300026121 | Bacteria | 1921 |
| 323 | Ga0207698_10253885 | 3300026142 | Bacteria | 1611 |
| 324 | Ga0207698_11441627 | 3300026142 | Bacteria | 704 |
| 325 | Ga0207428_10008222 | 3300027907 | Bacteria | 9434 |
| 326 | Ga0268265_10058741 | 3300028380 | Bacteria | 2939 |
| 327 | Ga0265337_1000303 | 3300028556 | Bacteria | 26144 |
| 328 | Ga0265338_10098997 | 3300028800 | Unclassified | 2383 |
| 329 | Ga0265338_10343089 | 3300028800 | Unclassified | 1076 |
| 330 | Ga0265320_10036127 | 3300031240 | Bacteria | 2499 |
| 331 | Ga0265340_10108985 | 3300031247 | Bacteria | 1281 |
| 332 | Ga0265314_10252875 | 3300031711 | Bacteria | 1011 |
| 333 | Ga0316583_10009479 | 3300032133 | Bacteria | 3506 |
| 334 | Ga0373938_0023505 | 3300034957 | Bacteria | 1268 |
| 335 | Ga0373926_0078253 | 3300035083 | Unclassified | 1220 |
| 336 | Ga0373928_0038845 | 3300035084 | Bacteria | 1085 |
| 337 | Ga0373949_0073862 | 3300035090 | Bacteria | 898 |
| 338 | Ga0373923_0399868 | 3300035111 | Unclassified | 661 |
| 339 | Ga0373936_0437579 | 3300035113 | Unclassified | 603 |
| 340 | Ga0373941_0008720 | 3300035115 | Bacteria | 2530 |
| 341 | Ga0373945_0026849 | 3300035116 | Bacteria | 2008 |
| 342 | Ga0373954_0392687 | 3300035118 | Unclassified | 686 |
| 343 | Ga0373956_0343812 | 3300035119 | Unclassified | 711 |
| 344 | Ga0373960_0017725 | 3300035121 | Bacteria | 1848 |
| 345 | Ga0373943_0262180 | 3300035170 | Bacteria | 973 |
| 346 | Ga0373943_0592649 | 3300035170 | Bacteria | 652 |
| 347 | Ga0373946_0078444 | 3300035171 | Unclassified | 1441 |
| 348 | Ga0373942_0079554 | 3300035207 | Bacteria | 971 |
| 349 | Ga0373961_0354944 | 3300035241 | Unclassified | 554 |
| 350 | Ga0373962_0035193 | 3300035242 | Bacteria | 1390 |
| 351 | Ga0373935_0215122 | 3300035692 | Unclassified | 1333 |
| 352 | Ga0373935_0644443 | 3300035692 | Bacteria | 777 |
| 353 | Ga0373935_1163580 | 3300035692 | Unclassified | 575 |
| 354 | Ga0373927_0295580 | 3300035695 | Bacteria | 1066 |
| 355 | Ga0373927_0377192 | 3300035695 | Bacteria | 935 |
| 356 | Ga0373933_0055382 | 3300035724 | Bacteria | 2379 |
| 357 | Ga0373947_0004671 | 3300035725 | Bacteria | 8028 |
| 358 | Ga0373947_0558372 | 3300035725 | Bacteria | 779 |
| 359 | Ga0373937_0027040 | 3300036401 | Bacteria | 5185 |
| 360 | Ga0373937_0056510 | 3300036401 | Bacteria | 3604 |
| 361 | Ga0373937_0386084 | 3300036401 | Unclassified | 1328 |
| 362 | Ga0373925_0221508 | 3300037068 | Bacteria | 1510 |
| 363 | Ga0373925_0527720 | 3300037068 | Bacteria | 970 |
| 364 | Ga0395899_0003070 | 3300037312 | Bacteria | 13307 |
| 365 | Ga0395899_0050833 | 3300037312 | Bacteria | 3076 |
| 366 | Ga0395899_0181197 | 3300037312 | Bacteria | 1479 |
| 367 | Ga0395899_0283790 | 3300037312 | Bacteria | 1125 |
| 368 | Ga0395899_0393235 | 3300037312 | Unclassified | 919 |
| 369 | Ga0395900_0004291 | 3300037418 | Bacteria | 15114 |
| 370 | Ga0395900_0053991 | 3300037418 | Bacteria | 4136 |
| 371 | Ga0395900_0084043 | 3300037418 | Bacteria | 3270 |
| 372 | Ga0395900_0198048 | 3300037418 | Bacteria | 2034 |
| 373 | Ga0395900_0243452 | 3300037418 | Bacteria | 1803 |
| 374 | Ga0395900_0353317 | 3300037418 | Bacteria | 1443 |
| 375 | Ga0395900_0361595 | 3300037418 | Bacteria | 1423 |
| 376 | Ga0395900_0867547 | 3300037418 | Bacteria | 827 |
| 377 | Ga0395898_0005687 | 3300037466 | Bacteria | 13435 |
| 378 | Ga0395898_0018637 | 3300037466 | Bacteria | 7076 |
| 379 | Ga0395898_0199520 | 3300037466 | Bacteria | 1910 |
| 380 | Ga0395898_0245690 | 3300037466 | Bacteria | 1707 |
| 381 | Ga0395898_0264307 | 3300037466 | Unclassified | 1641 |
| 382 | Ga0395898_0436959 | 3300037466 | Bacteria | 1247 |
| 383 | Ga0395898_0567727 | 3300037466 | Bacteria | 1077 |
| 384 | Ga0395898_0764508 | 3300037466 | Bacteria | 907 |
| 385 | Ga0395898_1068883 | 3300037466 | Bacteria | 741 |
| 386 | Ga0395898_1248621 | 3300037466 | Bacteria | 673 |
| 387 | Ga0395905_0007602 | 3300037471 | Bacteria | 10761 |
| 388 | Ga0395905_0025852 | 3300037471 | Bacteria | 5533 |
| 389 | Ga0395905_0027590 | 3300037471 | Bacteria | 5354 |
| 390 | Ga0395905_0039342 | 3300037471 | Bacteria | 4436 |
| 391 | Ga0395905_0201346 | 3300037471 | Bacteria | 1866 |
| 392 | Ga0395905_0509649 | 3300037471 | Bacteria | 1103 |
| 393 | Ga0395901_0001204 | 3300038443 | Bacteria | 27493 |
| 394 | Ga0395901_0006114 | 3300038443 | Bacteria | 12198 |
| 395 | Ga0395901_0020367 | 3300038443 | Bacteria | 6790 |
| 396 | Ga0395901_0041442 | 3300038443 | Bacteria | 4772 |
| 397 | Ga0395901_0059617 | 3300038443 | Bacteria | 3971 |
| 398 | Ga0395901_0094232 | 3300038443 | Bacteria | 3136 |
| 399 | Ga0395901_0212678 | 3300038443 | Bacteria | 2023 |
| 400 | Ga0395901_0335026 | 3300038443 | Bacteria | 1563 |
| 401 | Ga0395901_0469871 | 3300038443 | Bacteria | 1284 |
| 402 | Ga0395901_0563954 | 3300038443 | Bacteria | 1153 |
| 403 | Ga0395901_0693898 | 3300038443 | Unclassified | 1016 |
| 404 | Ga0395901_0728276 | 3300038443 | Bacteria | 987 |
| 405 | Ga0395901_0745601 | 3300038443 | Bacteria | 973 |
| 406 | Ga0395901_0855920 | 3300038443 | Bacteria | 894 |
| 407 | Ga0395901_0923616 | 3300038443 | Bacteria | 853 |
| 408 | Ga0395901_1349372 | 3300038443 | Bacteria | 673 |
| 409 | Ga0242419_003968 | 3300038698 | Bacteria | 1018 |
| 410 | Ga0242420_018167 | 3300038996 | Bacteria | 1236 |
| 411 | Ga0436365_0119942 | 3300039437 | Unclassified | 1027 |
| 412 | Ga0436365_1657328 | 3300039437 | Bacteria | 1875 |
| 413 | Ga0436363_0411511 | 3300039450 | Bacteria | 2317 |
| 414 | Ga0436362_0632253 | 3300039453 | Unclassified | 942 |
| 415 | Ga0451793_0774295 | 3300041452 | Bacteria | 790 |
| 416 | Ga0451800_1315738 | 3300041459 | Bacteria | 1160 |
| 417 | Ga0451833_0229488 | 3300041491 | Bacteria | 654 |
| 418 | Ga0451849_0298821 | 3300041505 | Bacteria | 1542 |
| 419 | Ga0451853_1363423 | 3300041512 | Bacteria | 951 |
| 420 | Ga0451853_1693471 | 3300041512 | Bacteria | 2572 |
| 421 | Ga0466969_0000416 | 3300044656 | Bacteria | 23320 |
| 422 | Ga0466969_0034554 | 3300044656 | Bacteria | 2561 |
| 423 | Ga0466969_0062079 | 3300044656 | Bacteria | 1814 |
| 424 | Ga0466969_0152573 | 3300044656 | Bacteria | 1064 |
| 425 | Ga0466965_0165586 | 3300044683 | Bacteria | 1161 |
| 426 | Ga0466965_0301032 | 3300044683 | Unclassified | 870 |
| 427 | Ga0466965_0360824 | 3300044683 | Unclassified | 797 |
| 428 | Ga0466965_0377848 | 3300044683 | Bacteria | 780 |
| 429 | Ga0466966_0026940 | 3300044684 | Bacteria | 3748 |
| 430 | Ga0466966_0105133 | 3300044684 | Bacteria | 1743 |
| 431 | Ga0466966_0289169 | 3300044684 | Bacteria | 985 |
| 432 | Ga0466966_0305803 | 3300044684 | Bacteria | 955 |
| 433 | Ga0466961_0032654 | 3300044693 | Bacteria | 3345 |
| 434 | Ga0466961_0041061 | 3300044693 | Bacteria | 2965 |
| 435 | Ga0466961_0043803 | 3300044693 | Bacteria | 2865 |
| 436 | Ga0466961_0044333 | 3300044693 | Bacteria | 2846 |
| 437 | Ga0466961_0356966 | 3300044693 | Bacteria | 889 |
| 438 | Ga0466961_0370186 | 3300044693 | Bacteria | 871 |
| 439 | Ga0466963_0000055 | 3300044694 | Bacteria | 37968 |
| 440 | Ga0466963_0004990 | 3300044694 | Bacteria | 7747 |
| 441 | Ga0466963_0006939 | 3300044694 | Bacteria | 6738 |
| 442 | Ga0466963_0033564 | 3300044694 | Bacteria | 3333 |
| 443 | Ga0466963_0078327 | 3300044694 | Bacteria | 2234 |
| 444 | Ga0466963_0109706 | 3300044694 | Bacteria | 1893 |
| 445 | Ga0466963_0118080 | 3300044694 | Bacteria | 1824 |
| 446 | Ga0466963_0173418 | 3300044694 | Bacteria | 1504 |
| 447 | Ga0466963_0233012 | 3300044694 | Bacteria | 1290 |
| 448 | Ga0466963_0308312 | 3300044694 | Bacteria | 1113 |
| 449 | Ga0466963_0315925 | 3300044694 | Bacteria | 1099 |
| 450 | Ga0466963_0705705 | 3300044694 | Archaea | 712 |
| 451 | Ga0466964_0037854 | 3300044706 | Unclassified | 1938 |
| 452 | Ga0466964_0078069 | 3300044706 | Bacteria | 1415 |
| 453 | Ga0466964_0113272 | 3300044706 | Bacteria | 1213 |
| 454 | Ga0466964_0843875 | 3300044706 | Unclassified | 520 |
| 455 | Ga0466971_0001289 | 3300044719 | Bacteria | 10464 |
| 456 | Ga0466971_0001665 | 3300044719 | Bacteria | 9393 |
| 457 | Ga0466971_0028337 | 3300044719 | Bacteria | 2506 |
| 458 | Ga0466971_0036589 | 3300044719 | Bacteria | 2201 |
| 459 | Ga0466971_0040227 | 3300044719 | Bacteria | 2100 |
| 460 | Ga0466968_0006553 | 3300044735 | Bacteria | 4394 |
| 461 | Ga0466968_0024813 | 3300044735 | Bacteria | 2452 |
| 462 | Ga0466968_0073683 | 3300044735 | Bacteria | 1490 |
| 463 | Ga0466968_0306962 | 3300044735 | Bacteria | 764 |
| 464 | Ga0466968_0588345 | 3300044735 | Unclassified | 561 |
| 465 | Ga0466970_0059057 | 3300044765 | Bacteria | 2054 |
| 466 | Ga0466970_0314081 | 3300044765 | Bacteria | 885 |
| 467 | Ga0466970_0541138 | 3300044765 | Bacteria | 672 |
| 468 | Ga0466957_0000919 | 3300044842 | Bacteria | 15079 |
| 469 | Ga0466957_0016592 | 3300044842 | Bacteria | 4307 |
| 470 | Ga0466957_0016687 | 3300044842 | Bacteria | 4295 |
| 471 | Ga0466957_0024670 | 3300044842 | Bacteria | 3560 |
| 472 | Ga0466957_0305382 | 3300044842 | Bacteria | 1070 |
| 473 | Ga0466957_0319994 | 3300044842 | Bacteria | 1046 |
| 474 | Ga0466957_1070901 | 3300044842 | Archaea | 581 |
| 475 | Ga0466959_0000761 | 3300045049 | Bacteria | 18843 |
| 476 | Ga0466959_0037704 | 3300045049 | Bacteria | 3572 |
| 477 | Ga0466959_0098996 | 3300045049 | Bacteria | 2088 |
| 478 | Ga0466959_0159447 | 3300045049 | Bacteria | 1586 |
| 479 | Ga0466959_0495459 | 3300045049 | Bacteria | 826 |
| 480 | Ga0451576_0460799 | 3300045051 | Bacteria | 1335 |
| 481 | Ga0466958_0000980 | 3300045836 | Bacteria | 12902 |
| 482 | Ga0466958_0003538 | 3300045836 | Bacteria | 8123 |
| 483 | Ga0466958_0011776 | 3300045836 | Bacteria | 4937 |
| 484 | Ga0466958_0036545 | 3300045836 | Bacteria | 2941 |
| 485 | Ga0466958_0264396 | 3300045836 | Bacteria | 1101 |
| 486 | Ga0466967_0006265 | 3300045976 | Bacteria | 8391 |
| 487 | Ga0466967_0008256 | 3300045976 | Bacteria | 7605 |
| 488 | Ga0466967_0009834 | 3300045976 | Bacteria | 7132 |
| 489 | Ga0466967_0034604 | 3300045976 | Bacteria | 4290 |
| 490 | Ga0466967_0053233 | 3300045976 | Bacteria | 3556 |
| 491 | Ga0466967_0076844 | 3300045976 | Bacteria | 3004 |
| 492 | Ga0466967_0078859 | 3300045976 | Bacteria | 2967 |
| 493 | Ga0466967_0081344 | 3300045976 | Bacteria | 2925 |
| 494 | Ga0466967_0099988 | 3300045976 | Bacteria | 2649 |
| 495 | Ga0466967_0118146 | 3300045976 | Bacteria | 2445 |
| 496 | Ga0466967_0129801 | 3300045976 | Bacteria | 2338 |
| 497 | Ga0466967_0234686 | 3300045976 | Bacteria | 1747 |
| 498 | Ga0466967_0235994 | 3300045976 | Bacteria | 1743 |
| 499 | Ga0466967_0238028 | 3300045976 | Bacteria | 1735 |
| 500 | Ga0466967_0312156 | 3300045976 | Bacteria | 1515 |
| 501 | Ga0466967_0441058 | 3300045976 | Bacteria | 1271 |
| 502 | Ga0466967_0719415 | 3300045976 | Bacteria | 989 |
| 503 | Ga0466967_0811490 | 3300045976 | Bacteria | 929 |
| 504 | Ga0466967_1325334 | 3300045976 | Bacteria | 717 |
| 505 | Ga0466967_1327450 | 3300045976 | Bacteria | 716 |
| 506 | Ga0466967_1443316 | 3300045976 | Bacteria | 685 |
| 507 | Ga0495592_0114740 | 3300046454 | Unclassified | 1902 |
| 508 | Ga0495592_0180740 | 3300046454 | Bacteria | 1437 |
| 509 | Ga0495629_0032484 | 3300046459 | Bacteria | 3695 |
| 510 | Ga0495629_0077562 | 3300046459 | Bacteria | 2319 |
| 511 | Ga0495629_0398343 | 3300046459 | Unclassified | 936 |
| 512 | Ga0495641_0099560 | 3300046461 | Unclassified | 1297 |
| 513 | Ga0495641_0248756 | 3300046461 | Bacteria | 799 |
| 514 | Ga0495641_0341600 | 3300046461 | Bacteria | 676 |
| 515 | Ga0495641_0408121 | 3300046461 | Bacteria | 616 |
| 516 | Ga0495641_0434110 | 3300046461 | Bacteria | 597 |
| 517 | Ga0495651_0041099 | 3300046462 | Bacteria | 3592 |
| 518 | Ga0495651_0080743 | 3300046462 | Bacteria | 2456 |
| 519 | Ga0495651_0098007 | 3300046462 | Bacteria | 2188 |
| 520 | Ga0495651_0706982 | 3300046462 | Unclassified | 628 |
| 521 | Ga0495653_0039247 | 3300046463 | Bacteria | 3710 |
| 522 | Ga0495653_0193343 | 3300046463 | Bacteria | 1386 |
| 523 | Ga0495653_0456477 | 3300046463 | Bacteria | 803 |
| 524 | Ga0495580_0296459 | 3300046472 | Bacteria | 1102 |
| 525 | Ga0495582_0014320 | 3300046473 | Bacteria | 4361 |
| 526 | Ga0495582_0665604 | 3300046473 | Bacteria | 602 |
| 527 | Ga0495662_0522440 | 3300046476 | Unclassified | 582 |
| 528 | Ga0495664_0218540 | 3300046477 | Bacteria | 1154 |
| 529 | Ga0495608_0018480 | 3300046511 | Bacteria | 4808 |
| 530 | Ga0495608_0040218 | 3300046511 | Bacteria | 3133 |
| 531 | Ga0495608_0466167 | 3300046511 | Bacteria | 767 |
| 532 | Ga0495628_0135048 | 3300046516 | Bacteria | 1886 |
| 533 | Ga0495628_0628707 | 3300046516 | Unclassified | 764 |
| 534 | Ga0495630_0055067 | 3300046517 | Bacteria | 2980 |
| 535 | Ga0495630_0692814 | 3300046517 | Unclassified | 780 |
| 536 | Ga0495644_0249087 | 3300046523 | Bacteria | 690 |
| 537 | Ga0495652_0053666 | 3300046529 | Bacteria | 3435 |
| 538 | Ga0495652_0129750 | 3300046529 | Unclassified | 1997 |
| 539 | Ga0495640_0233498 | 3300046533 | Bacteria | 1156 |
| 540 | Ga0495586_0000744 | 3300046535 | Bacteria | 18696 |
| 541 | Ga0495587_0021953 | 3300046536 | Bacteria | 3934 |
| 542 | Ga0495587_0121202 | 3300046536 | Bacteria | 1498 |
| 543 | Ga0495645_0110485 | 3300046543 | Unclassified | 1946 |
| 544 | Ga0495667_0012097 | 3300046559 | Bacteria | 5845 |
| 545 | Ga0495667_0038099 | 3300046559 | Bacteria | 3202 |
| 546 | Ga0495656_0080125 | 3300046615 | Bacteria | 1472 |
| 547 | Ga0495634_0372424 | 3300046642 | Bacteria | 852 |
| 548 | Ga0495635_0076743 | 3300046663 | Bacteria | 2290 |
| 549 | Ga0495635_0872184 | 3300046663 | Bacteria | 577 |
| 550 | Ga0495659_0225878 | 3300046664 | Bacteria | 774 |
| 551 | Ga0495657_0028235 | 3300046675 | Bacteria | 3949 |
| 552 | Ga0495657_0225831 | 3300046675 | Unclassified | 1134 |
| 553 | Ga0495657_0535788 | 3300046675 | Bacteria | 681 |
| 554 | Ga0495657_0711969 | 3300046675 | Bacteria | 577 |
| 555 | Ga0495599_0069761 | 3300046678 | Unclassified | 2193 |
| 556 | Ga0495599_0229307 | 3300046678 | Bacteria | 1134 |
| 557 | Ga0495623_0012946 | 3300046679 | Bacteria | 5399 |
| 558 | Ga0495646_0124958 | 3300046680 | Bacteria | 1453 |
| 559 | Ga0495658_0038255 | 3300046683 | Bacteria | 2656 |
| 560 | Ga0495658_0243364 | 3300046683 | Bacteria | 1130 |
| 561 | Ga0495658_0636222 | 3300046683 | Bacteria | 683 |
| 562 | Ga0495613_0048918 | 3300046689 | Bacteria | 3121 |
| 563 | Ga0495613_0064480 | 3300046689 | Bacteria | 2679 |
| 564 | Ga0495613_0143356 | 3300046689 | Bacteria | 1706 |
| 565 | Ga0495613_0777328 | 3300046689 | Bacteria | 626 |
| 566 | Ga0495624_0071704 | 3300046690 | Bacteria | 2155 |
| 567 | Ga0495624_0248320 | 3300046690 | Bacteria | 1076 |
| 568 | Ga0495589_0017212 | 3300046794 | Bacteria | 3712 |
| 569 | Ga0495600_0087754 | 3300046809 | Bacteria | 2029 |
| 570 | Ga0495600_0102764 | 3300046809 | Bacteria | 1863 |
| 571 | Ga0495581_0398263 | 3300047315 | Bacteria | 803 |
| 572 | Ga0495604_0104955 | 3300047317 | Bacteria | 2069 |
| 573 | Ga0495674_0057067 | 3300047319 | Bacteria | 3418 |
| 574 | Ga0495674_0162618 | 3300047319 | Bacteria | 1867 |
| 575 | Ga0495674_0298703 | 3300047319 | Bacteria | 1316 |
| 576 | Ga0495676_0154887 | 3300047321 | Bacteria | 1627 |
| 577 | Ga0495676_0822226 | 3300047321 | Unclassified | 597 |
| 578 | Ga0495680_0006379 | 3300047322 | Bacteria | 10973 |
| 579 | Ga0495680_0021203 | 3300047322 | Bacteria | 5444 |
| 580 | Ga0495680_0097937 | 3300047322 | Bacteria | 2189 |
| 581 | Ga0495680_0757873 | 3300047322 | Bacteria | 637 |
| 582 | Ga0495675_0117686 | 3300047444 | Unclassified | 1656 |
| 583 | Ga0495675_0140872 | 3300047444 | Bacteria | 1495 |
| 584 | Ga0495684_0016275 | 3300047471 | Bacteria | 5726 |
| 585 | Ga0495684_0030774 | 3300047471 | Bacteria | 4121 |
| 586 | Ga0495684_0083757 | 3300047471 | Bacteria | 2419 |
| 587 | Ga0495593_0330626 | 3300047673 | Bacteria | 762 |
| 588 | Ga0495602_0049222 | 3300048088 | Bacteria | 3777 |
| 589 | Ga0495602_0293627 | 3300048088 | Unclassified | 1192 |
| 590 | Ga0496100_0038887 | 3300048903 | Bacteria | 3017 |
| 591 | Ga0496100_0083926 | 3300048903 | Bacteria | 2158 |
| 592 | Ga0496101_0005743 | 3300048904 | Bacteria | 7927 |
| 593 | Ga0496101_0008872 | 3300048904 | Bacteria | 6583 |
| 594 | Ga0496101_0385215 | 3300048904 | Bacteria | 1103 |
| 595 | Ga0496101_0567058 | 3300048904 | Unclassified | 898 |
| 596 | Ga0496101_0880783 | 3300048904 | Bacteria | 705 |
| 597 | Ga0496102_0041444 | 3300048905 | Bacteria | 4169 |
| 598 | Ga0496102_0097386 | 3300048905 | Bacteria | 2728 |
| 599 | Ga0496102_0355371 | 3300048905 | Bacteria | 1379 |
| 600 | Ga0496102_0425739 | 3300048905 | Bacteria | 1247 |
| 601 | Ga0496102_1223115 | 3300048905 | Bacteria | 671 |
| 602 | Ga0496102_1462254 | 3300048905 | Archaea | 602 |
| 603 | Ga0496103_0243264 | 3300048906 | Bacteria | 1158 |
| 604 | Ga0496104_0042593 | 3300048907 | Bacteria | 4261 |
| 605 | Ga0496104_0077385 | 3300048907 | Bacteria | 3170 |
| 606 | Ga0496104_0108399 | 3300048907 | Bacteria | 2662 |
| 607 | Ga0496104_0589440 | 3300048907 | Bacteria | 1022 |
| 608 | Ga0496104_1224448 | 3300048907 | Bacteria | 654 |
| 609 | Ga0496104_1278849 | 3300048907 | Bacteria | 637 |
| 610 | Ga0496105_0001009 | 3300048908 | Bacteria | 19456 |
| 611 | Ga0496105_0051839 | 3300048908 | Bacteria | 3388 |
| 612 | Ga0496105_0059383 | 3300048908 | Bacteria | 3156 |
| 613 | Ga0496106_0048960 | 3300048909 | Bacteria | 3183 |
| 614 | Ga0496106_0204971 | 3300048909 | Bacteria | 1570 |
| 615 | Ga0496106_0530183 | 3300048909 | Bacteria | 945 |
| 616 | Ga0496107_0118830 | 3300048910 | Bacteria | 1946 |
| 617 | Ga0496107_0238463 | 3300048910 | Bacteria | 1353 |
| 618 | Ga0496107_0989581 | 3300048910 | Unclassified | 610 |
| 619 | Ga0496108_0062726 | 3300048911 | Bacteria | 3129 |
| 620 | Ga0496108_0065980 | 3300048911 | Bacteria | 3052 |
| 621 | Ga0496108_0152179 | 3300048911 | Bacteria | 1996 |
| 622 | Ga0496108_0337900 | 3300048911 | Bacteria | 1314 |
| 623 | Ga0496108_0484336 | 3300048911 | Bacteria | 1081 |
| 624 | Ga0496109_0001990 | 3300048912 | Bacteria | 16940 |
| 625 | Ga0496109_0089325 | 3300048912 | Bacteria | 2848 |
| 626 | Ga0496109_0159628 | 3300048912 | Bacteria | 2112 |
| 627 | Ga0496109_0266127 | 3300048912 | Bacteria | 1615 |
| 628 | Ga0496109_0282493 | 3300048912 | Bacteria | 1564 |
| 629 | Ga0496109_0520902 | 3300048912 | Bacteria | 1122 |
| 630 | Ga0496110_0014624 | 3300048913 | Bacteria | 6520 |
| 631 | Ga0496110_0026581 | 3300048913 | Bacteria | 4955 |
| 632 | Ga0496110_0038192 | 3300048913 | Bacteria | 4176 |
| 633 | Ga0496110_0055427 | 3300048913 | Bacteria | 3488 |
| 634 | Ga0496110_0139427 | 3300048913 | Bacteria | 2192 |
| 635 | Ga0496110_0258881 | 3300048913 | Bacteria | 1584 |
| 636 | Ga0496110_0438408 | 3300048913 | Bacteria | 1191 |
| 637 | Ga0496110_0801814 | 3300048913 | Bacteria | 846 |
| 638 | Ga0496110_1543378 | 3300048913 | Bacteria | 574 |
| 639 | Ga0496111_0017069 | 3300048914 | Bacteria | 5011 |
| 640 | Ga0496111_0061242 | 3300048914 | Bacteria | 2728 |
| 641 | Ga0496111_0241543 | 3300048914 | Bacteria | 1341 |
| 642 | Ga0496111_0309581 | 3300048914 | Bacteria | 1170 |
| 643 | Ga0496111_0382394 | 3300048914 | Bacteria | 1041 |
| 644 | Ga0496112_0008753 | 3300048915 | Bacteria | 9080 |
| 645 | Ga0496112_0016684 | 3300048915 | Bacteria | 6885 |
| 646 | Ga0496112_0048149 | 3300048915 | Bacteria | 4180 |
| 647 | Ga0496112_0132384 | 3300048915 | Bacteria | 2464 |
| 648 | Ga0496112_0336711 | 3300048915 | Bacteria | 1452 |
| 649 | Ga0496112_0346109 | 3300048915 | Bacteria | 1429 |
| 650 | Ga0496112_0350679 | 3300048915 | Bacteria | 1418 |
| 651 | Ga0496112_0531893 | 3300048915 | Bacteria | 1110 |
| 652 | Ga0496112_0534120 | 3300048915 | Bacteria | 1107 |
| 653 | Ga0496112_1722560 | 3300048915 | Bacteria | 539 |
| 654 | Ga0496113_0043876 | 3300048916 | Bacteria | 3310 |
| 655 | Ga0496113_0048764 | 3300048916 | Bacteria | 3152 |
| 656 | Ga0496113_0084245 | 3300048916 | Bacteria | 2440 |
| 657 | Ga0496113_0663475 | 3300048916 | Bacteria | 834 |
| 658 | Ga0496114_0049876 | 3300048917 | Bacteria | 3483 |
| 659 | Ga0496114_0097329 | 3300048917 | Bacteria | 2506 |
| 660 | Ga0496114_0191951 | 3300048917 | Bacteria | 1787 |
| 661 | Ga0496114_0472871 | 3300048917 | Bacteria | 1109 |
| 662 | Ga0496115_0059418 | 3300048918 | Bacteria | 3079 |
| 663 | Ga0496115_0180289 | 3300048918 | Bacteria | 1746 |
| 664 | Ga0501034_0676801 | 3300049571 | Bacteria | 932 |
| 665 | Ga0501047_0059298 | 3300049581 | Bacteria | 3695 |
| 666 | Ga0501047_0671412 | 3300049581 | Bacteria | 855 |
| 667 | Ga0501067_0003763 | 3300049583 | Bacteria | 8362 |
| 668 | Ga0501067_0192541 | 3300049583 | Bacteria | 1136 |
| 669 | Ga0501069_0002252 | 3300049585 | Bacteria | 9730 |
| 670 | Ga0501069_0033384 | 3300049585 | Bacteria | 2835 |
| 671 | Ga0501069_0232927 | 3300049585 | Bacteria | 1072 |
| 672 | Ga0501070_0008023 | 3300049586 | Bacteria | 8941 |
| 673 | Ga0501070_0069654 | 3300049586 | Bacteria | 2912 |
| 674 | Ga0501070_0348497 | 3300049586 | Bacteria | 1202 |
| 675 | Ga0501070_0402145 | 3300049586 | Unclassified | 1107 |
| 676 | Ga0501073_0226210 | 3300049589 | Bacteria | 1292 |
| 677 | Ga0501074_0300206 | 3300049590 | Bacteria | 1141 |
| 678 | Ga0501077_0922745 | 3300049593 | Bacteria | 562 |
| 679 | Ga0501080_0275235 | 3300049742 | Bacteria | 1531 |
| 680 | nmdc:mga0yw44_64454_c1 | 3300050492 | Bacteria | 2255 |
| 681 | nmdc:mga05p37_189678_c1 | 3300050507 | Bacteria | 2497 |
| 682 | nmdc:mga05p37_79810_c1 | 3300050507 | Bacteria | 4030 |
| 683 | nmdc:mga06r32_292232_c1 | 3300050510 | Bacteria | 1616 |
| 684 | nmdc:mga06r32_87547_c1 | 3300050510 | Bacteria | 3039 |
| 685 | nmdc:mga08y16_40411_c1 | 3300050511 | Bacteria | 4890 |
| 686 | nmdc:mga0n895_108484_c1 | 3300050512 | Bacteria | 2791 |
| 687 | nmdc:mga0n895_147591_c1 | 3300050512 | Bacteria | 2381 |
| 688 | nmdc:mga0n895_239718_c1 | 3300050512 | Bacteria | 1840 |
| 689 | nmdc:mga0n895_329642_c1 | 3300050512 | Bacteria | 1547 |
| 690 | nmdc:mga0rr50_204876_c1 | 3300050513 | Bacteria | 1623 |
| 691 | nmdc:mga0rr50_26778_c1 | 3300050513 | Bacteria | 4030 |
| 692 | nmdc:mga0a205_298857_c1 | 3300050515 | Bacteria | 1483 |
| 693 | nmdc:mga0a205_459034_c1 | 3300050515 | Bacteria | 1133 |
| 694 | nmdc:mga0a205_65807_c1 | 3300050515 | Bacteria | 3503 |
| 695 | Ga0495612_0036382 | 3300053078 | Bacteria | 1998 |
| 696 | Ga0495612_0170506 | 3300053078 | Unclassified | 953 |
| 697 | Ga0495655_0003040 | 3300053083 | Bacteria | 2723 |
| 698 | Ga0495595_0010440 | 3300053084 | Bacteria | 3858 |
| 699 | Ga0495595_0107568 | 3300053084 | Bacteria | 1350 |
| 700 | Ga0495595_0203565 | 3300053084 | Bacteria | 986 |
| 701 | Ga0495595_0371250 | 3300053084 | Bacteria | 723 |
| 702 | Ga0495619_0013521 | 3300053085 | Bacteria | 5142 |
| 703 | Ga0495619_0134191 | 3300053085 | Bacteria | 1702 |
| 704 | Ga0501084_0435919 | 3300054114 | Unclassified | 1108 |
| 705 | Ga0587088_052178 | 3300059508 | Bacteria | 804 |
| 706 | Ga0587115_040399 | 3300059626 | Bacteria | 727 |
| 707 | Ga0587079_069933 | 3300059647 | Bacteria | 781 |
| 708 | Ga0587114_022586 | 3300059655 | Bacteria | 901 |
| 709 | Ga0466962_0001098 | 3300061719 | Bacteria | 12452 |
| 710 | Ga0466962_0003534 | 3300061719 | Bacteria | 7448 |
| 711 | Ga0466962_0013237 | 3300061719 | Bacteria | 3966 |
| 712 | Ga0466962_0091742 | 3300061719 | Bacteria | 1456 |
| 713 | Ga0530510_0024659 | 3300061734 | Bacteria | 4295 |
| 714 | Ga0530510_0156658 | 3300061734 | Bacteria | 1684 |
| 715 | Ga0070710_10144180 | |||
| 716 | rootH1_10097624 | |||
| 717 | Ga0070658_10178738 | |||
| 718 | Ga0070683_100113355 | |||
| 719 | Ga0070683_100232102 | |||
| 720 | Ga0070690_100372650 | |||
| 721 | Ga0068869_100162038 | |||
| 722 | Ga0070666_10361841 | |||
| 723 | Ga0070680_100018745 | |||
| 724 | Ga0070680_100152938 | |||
| 725 | Ga0070680_100412642 | |||
| 726 | Ga0070680_100523180 | |||
| 727 | Ga0070680_100797753 | |||
| 728 | Ga0068868_100782135 | |||
| 729 | Ga0070660_100008860 | |||
| 730 | Ga0070660_100530554 | |||
| 731 | Ga0070689_100092808 | |||
| 732 | Ga0070687_100323514 | |||
| 733 | Ga0070661_100072329 | |||
| 734 | Ga0070661_100192854 | |||
| 735 | Ga0070661_100449942 | |||
| 736 | Ga0070675_101328879 | |||
| 737 | Ga0070671_100385812 | |||
| 738 | Ga0070674_101314313 | |||
| 739 | Ga0070659_100143605 | |||
| 740 | Ga0070659_100880917 | |||
| 741 | Ga0070667_100310441 | |||
| 742 | Ga0070709_10067776 | |||
| 743 | Ga0070714_100018943 | |||
| 744 | Ga0070714_100256785 | |||
| 745 | Ga0070714_100310941 | |||
| 746 | Ga0070713_100002039 | |||
| 747 | Ga0070713_100341833 | |||
| 748 | Ga0070713_100588793 | |||
| 749 | Ga0070710_10299952 | |||
| 750 | Ga0070710_10580539 | |||
| 751 | Ga0070701_10486376 | |||
| 752 | Ga0070711_100027002 | |||
| 753 | Ga0070705_100024164 | |||
| 754 | Ga0070708_100013353 | |||
| 755 | Ga0070708_100414941 | |||
| 756 | Ga0070663_100496596 | |||
| 757 | Ga0070678_100273120 | |||
| 758 | Ga0070678_100345293 | |||
| 759 | Ga0070662_100332327 | |||
| 760 | Ga0070662_101389575 | |||
| 761 | Ga0070681_10094788 | |||
| 762 | Ga0070681_10124950 | |||
| 763 | Ga0070681_10205944 | |||
| 764 | Ga0070681_10225546 | |||
| 765 | Ga0070681_10508081 | |||
| 766 | Ga0068867_100494196 | |||
| 767 | Ga0070706_100133081 | |||
| 768 | Ga0070706_100689028 | |||
| 769 | Ga0070707_100054143 | |||
| 770 | Ga0070707_100285116 | |||
| 771 | Ga0070707_100313315 | |||
| 772 | Ga0070698_100613353 | |||
| 773 | Ga0070679_100013515 | |||
| 774 | Ga0070679_100051491 | |||
| 775 | Ga0070679_100057486 | |||
| 776 | Ga0070679_100334964 | |||
| 777 | Ga0070679_100364856 | |||
| 778 | Ga0070679_100471492 | |||
| 779 | Ga0070679_100728507 | |||
| 780 | Ga0070684_100060538 | |||
| 781 | Ga0070684_100429147 | |||
| 782 | Ga0070684_101149225 | |||
| 783 | Ga0068853_100377359 | |||
| 784 | Ga0068853_101658063 | |||
| 785 | Ga0070672_100789092 | |||
| 786 | Ga0070695_100148698 | |||
| 787 | Ga0070696_100011492 | |||
| 788 | Ga0070693_100021282 | |||
| 789 | Ga0070665_100068379 | |||
| 790 | Ga0068855_100132521 | |||
| 791 | Ga0068855_100182549 | |||
| 792 | Ga0068855_100289158 | |||
| 793 | Ga0068855_100436286 | |||
| 794 | Ga0068855_100569481 | |||
| 795 | Ga0068855_100675738 | |||
| 796 | Ga0068855_101564365 | |||
| 797 | Ga0070664_100104647 | |||
| 798 | Ga0070664_100320258 | |||
| 799 | Ga0070664_101429094 | |||
| 800 | Ga0068857_100078809 | |||
| 801 | Ga0068857_100098335 | |||
| 802 | Ga0068854_100905422 | |||
| 803 | Ga0068856_100336563 | |||
| 804 | Ga0068856_100438607 | |||
| 805 | Ga0068856_101002195 | |||
| 806 | Ga0070702_100295300 | |||
| 807 | Ga0070702_101068196 | |||
| 808 | Ga0068852_100214527 | |||
| 809 | Ga0068852_100219032 | |||
| 810 | Ga0068852_100316084 | |||
| 811 | Ga0068852_101630464 | |||
| 812 | Ga0068859_100150049 | |||
| 813 | Ga0068861_100160179 | |||
| 814 | Ga0068851_10618153 | |||
| 815 | Ga0068870_10044406 | |||
| 816 | Ga0068863_100156823 | |||
| 817 | Ga0068858_101147058 | |||
| 818 | Ga0081455_10124991 | |||
| 819 | Ga0081455_10176656 | |||
| 820 | Ga0081539_10004001 | |||
| 821 | Ga0070717_10162053 | |||
| 822 | Ga0070717_10180328 | |||
| 823 | Ga0070715_10183670 | |||
| 824 | Ga0070716_100057879 | |||
| 825 | Ga0070716_100487369 | |||
| 826 | Ga0070712_100096902 | |||
| 827 | Ga0070712_100116288 | |||
| 828 | Ga0070712_100510539 | |||
| 829 | Ga0070712_101938247 | |||
| 830 | Ga0097621_101318524 | |||
| 831 | Ga0068871_100206101 | |||
| 832 | Ga0075431_100335600 | |||
| 833 | Ga0075433_10155826 | |||
| 834 | Ga0075433_10497676 | |||
| 835 | Ga0075433_10716899 | |||
| 836 | Ga0075434_100110909 | |||
| 837 | Ga0075434_100371983 | |||
| 838 | Ga0075434_101274595 | |||
| 839 | Ga0097620_100150059 | |||
| 840 | Ga0105251_10027162 | |||
| 841 | Ga0105240_10078072 | |||
| 842 | Ga0105240_10168570 | |||
| 843 | Ga0105240_11456748 | |||
| 844 | Ga0111539_10266606 | |||
| 845 | Ga0111539_10470683 | |||
| 846 | Ga0105245_10171557 | |||
| 847 | Ga0105245_10308762 | |||
| 848 | Ga0114129_10066241 | |||
| 849 | Ga0114129_10087539 | |||
| 850 | Ga0114129_11780724 | |||
| 851 | Ga0105243_10267170 | |||
| 852 | Ga0105243_10819421 | |||
| 853 | Ga0105243_11981966 | |||
| 854 | Ga0105241_10262328 | |||
| 855 | Ga0105241_10416956 | |||
| 856 | Ga0105241_10945988 | |||
| 857 | Ga0105242_10027312 | |||
| 858 | Ga0105242_10528525 | |||
| 859 | Ga0105237_10058856 | |||
| 860 | Ga0105237_10475436 | |||
| 861 | Ga0105237_12416132 | |||
| 862 | Ga0105238_10180038 | |||
| 863 | Ga0105238_10340795 | |||
| 864 | Ga0105238_11318791 | |||
| 865 | Ga0105249_10615477 | |||
| 866 | Ga0105239_10013170 | |||
| 867 | Ga0105239_10675439 | |||
| 868 | Ga0105239_12049553 | |||
| 869 | Ga0157373_10116855 | |||
| 870 | Ga0157373_10134866 | |||
| 871 | Ga0157371_10144521 | |||
| 872 | Ga0157371_10150653 | |||
| 873 | Ga0157371_10766664 | |||
| 874 | Ga0157370_10061947 | |||
| 875 | Ga0157370_10102251 | |||
| 876 | Ga0157370_10180649 | |||
| 877 | Ga0157370_10781280 | |||
| 878 | Ga0157369_10006426 | |||
| 879 | Ga0157369_10024249 | |||
| 880 | Ga0157369_10087505 | |||
| 881 | Ga0157369_10224684 | |||
| 882 | Ga0157369_10316144 | |||
| 883 | Ga0157369_10528206 | |||
| 884 | Ga0157369_11186610 | |||
| 885 | Ga0157374_10432255 | |||
| 886 | Ga0157374_10444810 | |||
| 887 | Ga0157374_10636154 | |||
| 888 | Ga0157374_10814206 | |||
| 889 | Ga0157378_11003784 | |||
| 890 | Ga0157372_10204804 | |||
| 891 | Ga0157372_10229806 | |||
| 892 | Ga0157372_10277292 | |||
| 893 | Ga0157372_10415588 | |||
| 894 | Ga0157375_10176907 | |||
| 895 | Ga0163163_10286987 | |||
| 896 | Ga0163163_10413310 | |||
| 897 | Ga0182008_10237232 | |||
| 898 | Ga0157377_10226841 | |||
| 899 | Ga0157379_10115896 | |||
| 900 | Ga0182007_10146926 | |||
| 901 | Ga0197907_10538464 | |||
| 902 | Ga0197907_11496924 | |||
| 903 | Ga0206356_10303150 | |||
| 904 | Ga0206356_10304786 | |||
| 905 | Ga0206356_10632632 | |||
| 906 | Ga0206356_10721937 | |||
| 907 | Ga0206355_1578225 | |||
| 908 | Ga0206354_11110297 | |||
| 909 | Ga0206354_11595453 | |||
| 910 | Ga0206353_10167500 | |||
| 911 | Ga0206353_11762150 | |||
| 912 | Ga0224712_10026174 | |||
| 913 | Ga0224712_10186195 | |||
| 914 | Ga0224712_10267721 | |||
| 915 | Ga0207656_10113340 | |||
| 916 | Ga0207713_1088725 | |||
| 917 | Ga0207692_10108651 | |||
| 918 | Ga0207642_10379491 | |||
| 919 | Ga0207710_10031448 | |||
| 920 | Ga0207688_10360581 | |||
| 921 | Ga0207680_10174850 | |||
| 922 | Ga0207647_10211340 | |||
| 923 | Ga0207699_10083969 | |||
| 924 | Ga0207699_10458760 | |||
| 925 | Ga0207699_10473924 | |||
| 926 | Ga0207699_10478502 | |||
| 927 | Ga0207643_10030053 | |||
| 928 | Ga0207705_10134952 | |||
| 929 | Ga0207705_10137992 | |||
| 930 | Ga0207705_10497719 | |||
| 931 | Ga0207705_10579585 | |||
| 932 | Ga0207684_10679902 | |||
| 933 | Ga0207654_10797800 | |||
| 934 | Ga0207707_10107584 | |||
| 935 | Ga0207707_10130255 | |||
| 936 | Ga0207707_10159957 | |||
| 937 | Ga0207707_10612667 | |||
| 938 | Ga0207707_10756651 | |||
| 939 | Ga0207695_10099742 | |||
| 940 | Ga0207695_10119226 | |||
| 941 | Ga0207695_10381210 | |||
| 942 | Ga0207671_10480749 | |||
| 943 | Ga0207693_10017254 | |||
| 944 | Ga0207693_10105996 | |||
| 945 | Ga0207693_10127319 | |||
| 946 | Ga0207693_10132306 | |||
| 947 | Ga0207693_10470329 | |||
| 948 | Ga0207693_10972844 | |||
| 949 | Ga0207663_10546918 | |||
| 950 | Ga0207663_10573060 | |||
| 951 | Ga0207663_10782475 | |||
| 952 | Ga0207660_10030615 | |||
| 953 | Ga0207660_10288987 | |||
| 954 | Ga0207660_10303458 | |||
| 955 | Ga0207660_11146717 | |||
| 956 | Ga0207657_10009333 | |||
| 957 | Ga0207657_10020324 | |||
| 958 | Ga0207657_10029814 | |||
| 959 | Ga0207657_10045506 | |||
| 960 | Ga0207657_10070674 | |||
| 961 | Ga0207657_10156439 | |||
| 962 | Ga0207657_10292244 | |||
| 963 | Ga0207649_10091705 | |||
| 964 | Ga0207649_10162335 | |||
| 965 | Ga0207649_10540561 | |||
| 966 | Ga0207649_10602345 | |||
| 967 | Ga0207652_10052441 | |||
| 968 | Ga0207652_10308349 | |||
| 969 | Ga0207652_10706593 | |||
| 970 | Ga0207652_10826978 | |||
| 971 | Ga0207646_10004627 | |||
| 972 | Ga0207646_10065360 | |||
| 973 | Ga0207646_10238240 | |||
| 974 | Ga0207694_10097852 | |||
| 975 | Ga0207694_10127067 | |||
| 976 | Ga0207694_10318479 | |||
| 977 | Ga0207659_10579036 | |||
| 978 | Ga0207687_10127254 | |||
| 979 | Ga0207687_10334818 | |||
| 980 | Ga0207687_10592592 | |||
| 981 | Ga0207700_10000001 | |||
| 982 | Ga0207700_10174991 | |||
| 983 | Ga0207700_10472335 | |||
| 984 | Ga0207664_10016143 | |||
| 985 | Ga0207664_10038163 | |||
| 986 | Ga0207664_10126117 | |||
| 987 | Ga0207664_10162735 | |||
| 988 | Ga0207664_10789181 | |||
| 989 | Ga0207664_11093649 | |||
| 990 | Ga0207644_10512287 | |||
| 991 | Ga0207690_10034271 | |||
| 992 | Ga0207690_10058997 | |||
| 993 | Ga0207690_10059320 | |||
| 994 | Ga0207690_10417347 | |||
| 995 | Ga0207690_10666243 | |||
| 996 | Ga0207706_10037879 | |||
| 997 | Ga0207706_10905280 | |||
| 998 | Ga0207686_10601713 | |||
| 999 | Ga0207670_10882086 | |||
| 1000 | Ga0207669_10205359 | |||
| 1001 | Ga0207665_10001956 | |||
| 1002 | Ga0207665_10094519 | |||
| 1003 | Ga0207665_10718184 | |||
| 1004 | Ga0207691_10076258 | |||
| 1005 | Ga0207711_10100821 | |||
| 1006 | Ga0207689_10004793 | |||
| 1007 | Ga0207661_10047724 | |||
| 1008 | Ga0207661_10084904 | |||
| 1009 | Ga0207661_10332319 | |||
| 1010 | Ga0207661_10540088 | |||
| 1011 | Ga0207661_10888989 | |||
| 1012 | Ga0207679_11564442 | |||
| 1013 | Ga0207667_10083868 | |||
| 1014 | Ga0207667_10150305 | |||
| 1015 | Ga0207667_10341469 | |||
| 1016 | Ga0207667_10345634 | |||
| 1017 | Ga0207667_10558465 | |||
| 1018 | Ga0207667_10935902 | |||
| 1019 | Ga0207667_11040833 | |||
| 1020 | Ga0207640_11204782 | |||
| 1021 | Ga0207658_10226996 | |||
| 1022 | Ga0207677_11290247 | |||
| 1023 | Ga0207678_10001425 | |||
| 1024 | Ga0207678_10585943 | |||
| 1025 | Ga0207702_10034848 | |||
| 1026 | Ga0207702_10111759 | |||
| 1027 | Ga0207702_10340712 | |||
| 1028 | Ga0207702_11203465 | |||
| 1029 | Ga0207674_10009796 | |||
| 1030 | Ga0207674_10023944 | |||
| 1031 | Ga0207674_10119230 | |||
| 1032 | Ga0207674_11330557 | |||
| 1033 | Ga0207675_100061420 | |||
| 1034 | Ga0207675_100550253 | |||
| 1035 | Ga0207683_10018853 | |||
| 1036 | Ga0207683_10179137 | |||
| 1037 | Ga0207698_10253885 | |||
| 1038 | Ga0207698_11441627 | |||
| 1039 | Ga0207428_10008222 | |||
| 1040 | Ga0268265_10058741 | |||
| 1041 | Ga0265337_1000303 | |||
| 1042 | Ga0265338_10098997 | |||
| 1043 | Ga0265338_10343089 | |||
| 1044 | Ga0265320_10036127 | |||
| 1045 | Ga0265340_10108985 | |||
| 1046 | Ga0265314_10252875 | |||
| 1047 | Ga0316583_10009479 | |||
| 1048 | Ga0373938_0023505 | |||
| 1049 | Ga0373926_0078253 | |||
| 1050 | Ga0373928_0038845 | |||
| 1051 | Ga0373949_0073862 | |||
| 1052 | Ga0373923_0399868 | |||
| 1053 | Ga0373936_0437579 | |||
| 1054 | Ga0373941_0008720 | |||
| 1055 | Ga0373945_0026849 | |||
| 1056 | Ga0373954_0392687 | |||
| 1057 | Ga0373956_0343812 | |||
| 1058 | Ga0373960_0017725 | |||
| 1059 | Ga0373943_0262180 | |||
| 1060 | Ga0373943_0592649 | |||
| 1061 | Ga0373946_0078444 | |||
| 1062 | Ga0373942_0079554 | |||
| 1063 | Ga0373961_0354944 | |||
| 1064 | Ga0373962_0035193 | |||
| 1065 | Ga0373935_0215122 | |||
| 1066 | Ga0373935_0644443 | |||
| 1067 | Ga0373935_1163580 | |||
| 1068 | Ga0373927_0295580 | |||
| 1069 | Ga0373927_0377192 | |||
| 1070 | Ga0373933_0055382 | |||
| 1071 | Ga0373947_0004671 | |||
| 1072 | Ga0373947_0558372 | |||
| 1073 | Ga0373937_0027040 | |||
| 1074 | Ga0373937_0056510 | |||
| 1075 | Ga0373937_0386084 | |||
| 1076 | Ga0373925_0221508 | |||
| 1077 | Ga0373925_0527720 | |||
| 1078 | Ga0395899_0003070 | |||
| 1079 | Ga0395899_0050833 | |||
| 1080 | Ga0395899_0181197 | |||
| 1081 | Ga0395899_0283790 | |||
| 1082 | Ga0395899_0393235 | |||
| 1083 | Ga0395900_0004291 | |||
| 1084 | Ga0395900_0053991 | |||
| 1085 | Ga0395900_0084043 | |||
| 1086 | Ga0395900_0198048 | |||
| 1087 | Ga0395900_0243452 | |||
| 1088 | Ga0395900_0353317 | |||
| 1089 | Ga0395900_0361595 | |||
| 1090 | Ga0395900_0867547 | |||
| 1091 | Ga0395898_0005687 | |||
| 1092 | Ga0395898_0018637 | |||
| 1093 | Ga0395898_0199520 | |||
| 1094 | Ga0395898_0245690 | |||
| 1095 | Ga0395898_0264307 | |||
| 1096 | Ga0395898_0436959 | |||
| 1097 | Ga0395898_0567727 | |||
| 1098 | Ga0395898_0764508 | |||
| 1099 | Ga0395898_1068883 | |||
| 1100 | Ga0395898_1248621 | |||
| 1101 | Ga0395905_0007602 | |||
| 1102 | Ga0395905_0025852 | |||
| 1103 | Ga0395905_0027590 | |||
| 1104 | Ga0395905_0039342 | |||
| 1105 | Ga0395905_0201346 | |||
| 1106 | Ga0395905_0509649 | |||
| 1107 | Ga0395901_0001204 | |||
| 1108 | Ga0395901_0006114 | |||
| 1109 | Ga0395901_0020367 | |||
| 1110 | Ga0395901_0041442 | |||
| 1111 | Ga0395901_0059617 | |||
| 1112 | Ga0395901_0094232 | |||
| 1113 | Ga0395901_0212678 | |||
| 1114 | Ga0395901_0335026 | |||
| 1115 | Ga0395901_0469871 | |||
| 1116 | Ga0395901_0563954 | |||
| 1117 | Ga0395901_0693898 | |||
| 1118 | Ga0395901_0728276 | |||
| 1119 | Ga0395901_0745601 | |||
| 1120 | Ga0395901_0855920 | |||
| 1121 | Ga0395901_0923616 | |||
| 1122 | Ga0395901_1349372 | |||
| 1123 | Ga0242419_003968 | |||
| 1124 | Ga0242420_018167 | |||
| 1125 | Ga0436365_0119942 | |||
| 1126 | Ga0436365_1657328 | |||
| 1127 | Ga0436363_0411511 | |||
| 1128 | Ga0436362_0632253 | |||
| 1129 | Ga0451793_0774295 | |||
| 1130 | Ga0451800_1315738 | |||
| 1131 | Ga0451833_0229488 | |||
| 1132 | Ga0451849_0298821 | |||
| 1133 | Ga0451853_1363423 | |||
| 1134 | Ga0451853_1693471 | |||
| 1135 | Ga0466969_0000416 | |||
| 1136 | Ga0466969_0034554 | |||
| 1137 | Ga0466969_0062079 | |||
| 1138 | Ga0466969_0152573 | |||
| 1139 | Ga0466965_0165586 | |||
| 1140 | Ga0466965_0301032 | |||
| 1141 | Ga0466965_0360824 | |||
| 1142 | Ga0466965_0377848 | |||
| 1143 | Ga0466966_0026940 | |||
| 1144 | Ga0466966_0105133 | |||
| 1145 | Ga0466966_0289169 | |||
| 1146 | Ga0466966_0305803 | |||
| 1147 | Ga0466961_0032654 | |||
| 1148 | Ga0466961_0041061 | |||
| 1149 | Ga0466961_0043803 | |||
| 1150 | Ga0466961_0044333 | |||
| 1151 | Ga0466961_0356966 | |||
| 1152 | Ga0466961_0370186 | |||
| 1153 | Ga0466963_0000055 | |||
| 1154 | Ga0466963_0004990 | |||
| 1155 | Ga0466963_0006939 | |||
| 1156 | Ga0466963_0033564 | |||
| 1157 | Ga0466963_0078327 | |||
| 1158 | Ga0466963_0109706 | |||
| 1159 | Ga0466963_0118080 | |||
| 1160 | Ga0466963_0173418 | |||
| 1161 | Ga0466963_0233012 | |||
| 1162 | Ga0466963_0308312 | |||
| 1163 | Ga0466963_0315925 | |||
| 1164 | Ga0466963_0705705 | |||
| 1165 | Ga0466964_0037854 | |||
| 1166 | Ga0466964_0078069 | |||
| 1167 | Ga0466964_0113272 | |||
| 1168 | Ga0466964_0843875 | |||
| 1169 | Ga0466971_0001289 | |||
| 1170 | Ga0466971_0001665 | |||
| 1171 | Ga0466971_0028337 | |||
| 1172 | Ga0466971_0036589 | |||
| 1173 | Ga0466971_0040227 | |||
| 1174 | Ga0466968_0006553 | |||
| 1175 | Ga0466968_0024813 | |||
| 1176 | Ga0466968_0073683 | |||
| 1177 | Ga0466968_0306962 | |||
| 1178 | Ga0466968_0588345 | |||
| 1179 | Ga0466970_0059057 | |||
| 1180 | Ga0466970_0314081 | |||
| 1181 | Ga0466970_0541138 | |||
| 1182 | Ga0466957_0000919 | |||
| 1183 | Ga0466957_0016592 | |||
| 1184 | Ga0466957_0016687 | |||
| 1185 | Ga0466957_0024670 | |||
| 1186 | Ga0466957_0305382 | |||
| 1187 | Ga0466957_0319994 | |||
| 1188 | Ga0466957_1070901 | |||
| 1189 | Ga0466959_0000761 | |||
| 1190 | Ga0466959_0037704 | |||
| 1191 | Ga0466959_0098996 | |||
| 1192 | Ga0466959_0159447 | |||
| 1193 | Ga0466959_0495459 | |||
| 1194 | Ga0451576_0460799 | |||
| 1195 | Ga0466958_0000980 | |||
| 1196 | Ga0466958_0003538 | |||
| 1197 | Ga0466958_0011776 | |||
| 1198 | Ga0466958_0036545 | |||
| 1199 | Ga0466958_0264396 | |||
| 1200 | Ga0466967_0006265 | |||
| 1201 | Ga0466967_0008256 | |||
| 1202 | Ga0466967_0009834 | |||
| 1203 | Ga0466967_0034604 | |||
| 1204 | Ga0466967_0053233 | |||
| 1205 | Ga0466967_0076844 | |||
| 1206 | Ga0466967_0078859 | |||
| 1207 | Ga0466967_0081344 | |||
| 1208 | Ga0466967_0099988 | |||
| 1209 | Ga0466967_0118146 | |||
| 1210 | Ga0466967_0129801 | |||
| 1211 | Ga0466967_0234686 | |||
| 1212 | Ga0466967_0235994 | |||
| 1213 | Ga0466967_0238028 | |||
| 1214 | Ga0466967_0312156 | |||
| 1215 | Ga0466967_0441058 | |||
| 1216 | Ga0466967_0719415 | |||
| 1217 | Ga0466967_0811490 | |||
| 1218 | Ga0466967_1325334 | |||
| 1219 | Ga0466967_1327450 | |||
| 1220 | Ga0466967_1443316 | |||
| 1221 | Ga0495592_0114740 | |||
| 1222 | Ga0495592_0180740 | |||
| 1223 | Ga0495629_0032484 | |||
| 1224 | Ga0495629_0077562 | |||
| 1225 | Ga0495629_0398343 | |||
| 1226 | Ga0495641_0099560 | |||
| 1227 | Ga0495641_0248756 | |||
| 1228 | Ga0495641_0341600 | |||
| 1229 | Ga0495641_0408121 | |||
| 1230 | Ga0495641_0434110 | |||
| 1231 | Ga0495651_0041099 | |||
| 1232 | Ga0495651_0080743 | |||
| 1233 | Ga0495651_0098007 | |||
| 1234 | Ga0495651_0706982 | |||
| 1235 | Ga0495653_0039247 | |||
| 1236 | Ga0495653_0193343 | |||
| 1237 | Ga0495653_0456477 | |||
| 1238 | Ga0495580_0296459 | |||
| 1239 | Ga0495582_0014320 | |||
| 1240 | Ga0495582_0665604 | |||
| 1241 | Ga0495662_0522440 | |||
| 1242 | Ga0495664_0218540 | |||
| 1243 | Ga0495608_0018480 | |||
| 1244 | Ga0495608_0040218 | |||
| 1245 | Ga0495608_0466167 | |||
| 1246 | Ga0495628_0135048 | |||
| 1247 | Ga0495628_0628707 | |||
| 1248 | Ga0495630_0055067 | |||
| 1249 | Ga0495630_0692814 | |||
| 1250 | Ga0495644_0249087 | |||
| 1251 | Ga0495652_0053666 | |||
| 1252 | Ga0495652_0129750 | |||
| 1253 | Ga0495640_0233498 | |||
| 1254 | Ga0495586_0000744 | |||
| 1255 | Ga0495587_0021953 | |||
| 1256 | Ga0495587_0121202 | |||
| 1257 | Ga0495645_0110485 | |||
| 1258 | Ga0495667_0012097 | |||
| 1259 | Ga0495667_0038099 | |||
| 1260 | Ga0495656_0080125 | |||
| 1261 | Ga0495634_0372424 | |||
| 1262 | Ga0495635_0076743 | |||
| 1263 | Ga0495635_0872184 | |||
| 1264 | Ga0495659_0225878 | |||
| 1265 | Ga0495657_0028235 | |||
| 1266 | Ga0495657_0225831 | |||
| 1267 | Ga0495657_0535788 | |||
| 1268 | Ga0495657_0711969 | |||
| 1269 | Ga0495599_0069761 | |||
| 1270 | Ga0495599_0229307 | |||
| 1271 | Ga0495623_0012946 | |||
| 1272 | Ga0495646_0124958 | |||
| 1273 | Ga0495658_0038255 | |||
| 1274 | Ga0495658_0243364 | |||
| 1275 | Ga0495658_0636222 | |||
| 1276 | Ga0495613_0048918 | |||
| 1277 | Ga0495613_0064480 | |||
| 1278 | Ga0495613_0143356 | |||
| 1279 | Ga0495613_0777328 | |||
| 1280 | Ga0495624_0071704 | |||
| 1281 | Ga0495624_0248320 | |||
| 1282 | Ga0495589_0017212 | |||
| 1283 | Ga0495600_0087754 | |||
| 1284 | Ga0495600_0102764 | |||
| 1285 | Ga0495581_0398263 | |||
| 1286 | Ga0495604_0104955 | |||
| 1287 | Ga0495674_0057067 | |||
| 1288 | Ga0495674_0162618 | |||
| 1289 | Ga0495674_0298703 | |||
| 1290 | Ga0495676_0154887 | |||
| 1291 | Ga0495676_0822226 | |||
| 1292 | Ga0495680_0006379 | |||
| 1293 | Ga0495680_0021203 | |||
| 1294 | Ga0495680_0097937 | |||
| 1295 | Ga0495680_0757873 | |||
| 1296 | Ga0495675_0117686 | |||
| 1297 | Ga0495675_0140872 | |||
| 1298 | Ga0495684_0016275 | |||
| 1299 | Ga0495684_0030774 | |||
| 1300 | Ga0495684_0083757 | |||
| 1301 | Ga0495593_0330626 | |||
| 1302 | Ga0495602_0049222 | |||
| 1303 | Ga0495602_0293627 | |||
| 1304 | Ga0496100_0038887 | |||
| 1305 | Ga0496100_0083926 | |||
| 1306 | Ga0496101_0005743 | |||
| 1307 | Ga0496101_0008872 | |||
| 1308 | Ga0496101_0385215 | |||
| 1309 | Ga0496101_0567058 | |||
| 1310 | Ga0496101_0880783 | |||
| 1311 | Ga0496102_0041444 | |||
| 1312 | Ga0496102_0097386 | |||
| 1313 | Ga0496102_0355371 | |||
| 1314 | Ga0496102_0425739 | |||
| 1315 | Ga0496102_1223115 | |||
| 1316 | Ga0496102_1462254 | |||
| 1317 | Ga0496103_0243264 | |||
| 1318 | Ga0496104_0042593 | |||
| 1319 | Ga0496104_0077385 | |||
| 1320 | Ga0496104_0108399 | |||
| 1321 | Ga0496104_0589440 | |||
| 1322 | Ga0496104_1224448 | |||
| 1323 | Ga0496104_1278849 | |||
| 1324 | Ga0496105_0001009 | |||
| 1325 | Ga0496105_0051839 | |||
| 1326 | Ga0496105_0059383 | |||
| 1327 | Ga0496106_0048960 | |||
| 1328 | Ga0496106_0204971 | |||
| 1329 | Ga0496106_0530183 | |||
| 1330 | Ga0496107_0118830 | |||
| 1331 | Ga0496107_0238463 | |||
| 1332 | Ga0496107_0989581 | |||
| 1333 | Ga0496108_0062726 | |||
| 1334 | Ga0496108_0065980 | |||
| 1335 | Ga0496108_0152179 | |||
| 1336 | Ga0496108_0337900 | |||
| 1337 | Ga0496108_0484336 | |||
| 1338 | Ga0496109_0001990 | |||
| 1339 | Ga0496109_0089325 | |||
| 1340 | Ga0496109_0159628 | |||
| 1341 | Ga0496109_0266127 | |||
| 1342 | Ga0496109_0282493 | |||
| 1343 | Ga0496109_0520902 | |||
| 1344 | Ga0496110_0014624 | |||
| 1345 | Ga0496110_0026581 | |||
| 1346 | Ga0496110_0038192 | |||
| 1347 | Ga0496110_0055427 | |||
| 1348 | Ga0496110_0139427 | |||
| 1349 | Ga0496110_0258881 | |||
| 1350 | Ga0496110_0438408 | |||
| 1351 | Ga0496110_0801814 | |||
| 1352 | Ga0496110_1543378 | |||
| 1353 | Ga0496111_0017069 | |||
| 1354 | Ga0496111_0061242 | |||
| 1355 | Ga0496111_0241543 | |||
| 1356 | Ga0496111_0309581 | |||
| 1357 | Ga0496111_0382394 | |||
| 1358 | Ga0496112_0008753 | |||
| 1359 | Ga0496112_0016684 | |||
| 1360 | Ga0496112_0048149 | |||
| 1361 | Ga0496112_0132384 | |||
| 1362 | Ga0496112_0336711 | |||
| 1363 | Ga0496112_0346109 | |||
| 1364 | Ga0496112_0350679 | |||
| 1365 | Ga0496112_0531893 | |||
| 1366 | Ga0496112_0534120 | |||
| 1367 | Ga0496112_1722560 | |||
| 1368 | Ga0496113_0043876 | |||
| 1369 | Ga0496113_0048764 | |||
| 1370 | Ga0496113_0084245 | |||
| 1371 | Ga0496113_0663475 | |||
| 1372 | Ga0496114_0049876 | |||
| 1373 | Ga0496114_0097329 | |||
| 1374 | Ga0496114_0191951 | |||
| 1375 | Ga0496114_0472871 | |||
| 1376 | Ga0496115_0059418 | |||
| 1377 | Ga0496115_0180289 | |||
| 1378 | Ga0501034_0676801 | |||
| 1379 | Ga0501047_0059298 | |||
| 1380 | Ga0501047_0671412 | |||
| 1381 | Ga0501067_0003763 | |||
| 1382 | Ga0501067_0192541 | |||
| 1383 | Ga0501069_0002252 | |||
| 1384 | Ga0501069_0033384 | |||
| 1385 | Ga0501069_0232927 | |||
| 1386 | Ga0501070_0008023 | |||
| 1387 | Ga0501070_0069654 | |||
| 1388 | Ga0501070_0348497 | |||
| 1389 | Ga0501070_0402145 | |||
| 1390 | Ga0501073_0226210 | |||
| 1391 | Ga0501074_0300206 | |||
| 1392 | Ga0501077_0922745 | |||
| 1393 | Ga0501080_0275235 | |||
| 1394 | nmdc:mga0yw44_64454_c1 | |||
| 1395 | nmdc:mga05p37_189678_c1 | |||
| 1396 | nmdc:mga05p37_79810_c1 | |||
| 1397 | nmdc:mga06r32_292232_c1 | |||
| 1398 | nmdc:mga06r32_87547_c1 | |||
| 1399 | nmdc:mga08y16_40411_c1 | |||
| 1400 | nmdc:mga0n895_108484_c1 | |||
| 1401 | nmdc:mga0n895_147591_c1 | |||
| 1402 | nmdc:mga0n895_239718_c1 | |||
| 1403 | nmdc:mga0n895_329642_c1 | |||
| 1404 | nmdc:mga0rr50_204876_c1 | |||
| 1405 | nmdc:mga0rr50_26778_c1 | |||
| 1406 | nmdc:mga0a205_298857_c1 | |||
| 1407 | nmdc:mga0a205_459034_c1 | |||
| 1408 | nmdc:mga0a205_65807_c1 | |||
| 1409 | Ga0495612_0036382 | |||
| 1410 | Ga0495612_0170506 | |||
| 1411 | Ga0495655_0003040 | |||
| 1412 | Ga0495595_0010440 | |||
| 1413 | Ga0495595_0107568 | |||
| 1414 | Ga0495595_0203565 | |||
| 1415 | Ga0495595_0371250 | |||
| 1416 | Ga0495619_0013521 | |||
| 1417 | Ga0495619_0134191 | |||
| 1418 | Ga0501084_0435919 | |||
| 1419 | Ga0587088_052178 | |||
| 1420 | Ga0587115_040399 | |||
| 1421 | Ga0587079_069933 | |||
| 1422 | Ga0587114_022586 | |||
| 1423 | Ga0466962_0001098 | |||
| 1424 | Ga0466962_0003534 | |||
| 1425 | Ga0466962_0013237 | |||
| 1426 | Ga0466962_0091742 | |||
| 1427 | Ga0530510_0024659 | |||
| 1428 | Ga0530510_0156658 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.7889 | 12 | 157 |
| 6iu4-assembly1.cif.gz_A | crystal structure of iron transporter vit1 with cobalt ion | 0.7297 | 12 | 157 |
| 7zq9-assembly1.cif.gz_L2 | dimeric psi of chlamydomonas reinhardtii at 2.74 a resolution (symmetry expanded) | 0.5422 | 12 | 111 |
| 3whn-assembly2.cif.gz_B | hemerythrin-like domain of dcrh i119h mutant (met) | 0.5379 | 20 | 114 |
| 7zqd-assembly1.cif.gz_L | dimeric psi of chlamydomonas reinhardtii at 2.97 a resolution | 0.5037 | 12 | 112 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7MU65_40_256_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8792 | 13 | 155 | 1.20.1260.10 |
| af_I1K5I4_32_243_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8683 | 12 | 155 | 1.20.1260.10 |
| af_Q54H42_48_275_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8652 | 13 | 155 | 1.20.1260.10 |
| af_K7MU65_40_256_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7948 | 13 | 155 | 1.20.1260.10 |
| af_I1K5I4_32_243_1.20.1260.10 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.7904 | 12 | 155 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A856NMQ2-F1-model_v4 | deleted | 0.9875 | 4 | 158 |
|
| AF-A0A538GHW0-F1-model_v4 | VIT family protein | 0.9863 | 4 | 156 |
GO:0016020
|
| AF-A0A087C1I6-F1-model_v4 | Rubrerythrin | 0.9852 | 4 | 156 |
GO:0016020
|
| AF-A0A538KVX8-F1-model_v4 | VIT family protein | 0.985 | 4 | 158 |
GO:0016020
|
| AF-A0A7W1N482-F1-model_v4 | VIT family protein | 0.985 | 1 | 158 |
GO:0016020
|