F476919

General Info

Members Datasets Scaffolds Average Seq Length
714 410 628 253

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10005224|rootH1_100052241
Length 249
Sequence MTCDEARIMLHALLDGELDAGHAREVEAHIAGCADCAAEFAAQRQMQRVLADTNLRYAAPASLRNKIEASLPKAQPQPSRRSVLRGFAMGSAVSALAATGIVAVVLRQDDQQRILSEVVSAHLRSLQAGHLIDVVSTDXWFNGKLDVAPPVIDLTAQGFTLVGGRLDYIDARAIGAVVYKRRQHVINLFVAQTSSTEHRAPKTQTMQGFNCRRWGERGLNFWAVSDIGADELAEFVDKFEAAMKANVEG

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
16 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
17 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
18 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
19 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
20 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
21 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
22 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
23 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
24 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
25 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
26 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
27 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
28 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
29 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
30 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
31 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
32 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
33 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
34 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
35 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
36 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
37 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
38 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
39 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
40 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
41 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
42 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
43 2904699407
44 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
45 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
46 2906610324
47 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
48 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
49 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
50 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
51 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
52 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
53 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
54 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
55 2922425934
56 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
57 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
58 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
59 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
60 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
61 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
62 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
63 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
64 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
65 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
66 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
67 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
68 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
69 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
70 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
71 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
72 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
73 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
74 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
75 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
76 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
77 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
78 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
79 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
80 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
81 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
84 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
85 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
89 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
90 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
91 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
96 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
122 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
123 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
124 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
128 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
130 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
137 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
138 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
139 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
140 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
141 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
142 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
143 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
144 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
145 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
146 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
147 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
148 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
200 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
214 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
258 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
275 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
276 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
277 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
288 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
297 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
324 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
325 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
326 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
327 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
328 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
329 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
333 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
352 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
374 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
375 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
376 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
377 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
378 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
379 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
382 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
383 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
392 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
393 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
394 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
399 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
400 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
403 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
404 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
405 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
406 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
407 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
408 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
409 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
410 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 0.28
Isolates 11.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.8
Nodule 9.24
Rhizoplane 6.3
Rhizosphere 62.46
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10003323 3300003215 Bacteria 9041
2 JGI25153J46596_10015142 3300003215 Bacteria 3161
3 rootH1_10005224 3300003316 Bacteria 2924
4 rootH1_10005224 3300003323 Bacteria 1116
5 Ga0070683_100002101 3300005329 Bacteria 15736
6 Ga0070683_100003746 3300005329 Bacteria 12404
7 Ga0068869_100181402 3300005334 Bacteria 1650
8 Ga0070680_100026227 3300005336 Bacteria 4660
9 Ga0070680_100041937 3300005336 Bacteria 3711
10 Ga0070680_100157997 3300005336 Bacteria 1905
11 Ga0068868_100492475 3300005338 Bacteria 1072
12 Ga0070660_100313105 3300005339 Bacteria 1288
13 Ga0070661_100142530 3300005344 Bacteria 1807
14 Ga0070709_10000980 3300005434 Bacteria 15831
15 Ga0070709_10012949 3300005434 Bacteria 4678
16 Ga0070714_100014017 3300005435 Bacteria 6431
17 Ga0070713_100016044 3300005436 Bacteria 5624
18 Ga0070713_100016379 3300005436 Bacteria 5574
19 Ga0070713_100232989 3300005436 Bacteria 1674
20 Ga0070710_10001038 3300005437 Bacteria 13188
21 Ga0070710_10024250 3300005437 Bacteria 3198
22 Ga0070710_10047236 3300005437 Bacteria 2400
23 Ga0070710_10063463 3300005437 Bacteria 2110
24 Ga0070711_100025185 3300005439 Bacteria 3889
25 Ga0070711_100031068 3300005439 Bacteria 3542
26 Ga0070711_100268440 3300005439 Bacteria 1345
27 Ga0070663_100685642 3300005455 Bacteria 870
28 Ga0070678_100308841 3300005456 Bacteria 1346
29 Ga0070681_10110910 3300005458 Bacteria 2683
30 Ga0070681_10149452 3300005458 Bacteria 2263
31 Ga0070706_100228815 3300005467 Bacteria 1736
32 Ga0070707_100132939 3300005468 Bacteria 2420
33 Ga0070679_100005873 3300005530 Bacteria 11399
34 Ga0070679_100027524 3300005530 Bacteria 5597
35 Ga0070679_100030562 3300005530 Bacteria 5317
36 Ga0070679_100145182 3300005530 Bacteria 2351
37 Ga0070684_100054648 3300005535 Bacteria 3479
38 Ga0070684_100093310 3300005535 Bacteria 2679
39 Ga0070684_100198510 3300005535 Bacteria 1827
40 Ga0068853_100275655 3300005539 Bacteria 1550
41 Ga0068853_100559339 3300005539 Bacteria 1084
42 Ga0070665_100103763 3300005548 Bacteria 2846
43 Ga0070665_100328997 3300005548 Bacteria 1532
44 Ga0068855_100040685 3300005563 Bacteria 5515
45 Ga0068855_100165838 3300005563 Bacteria 2504
46 Ga0068855_100169680 3300005563 Bacteria 2472
47 Ga0068855_100349199 3300005563 Bacteria 1630
48 Ga0070664_100235962 3300005564 Bacteria 1641
49 Ga0068857_100524382 3300005577 Bacteria 1114
50 Ga0068854_100105262 3300005578 Bacteria 2121
51 Ga0068856_100119855 3300005614 Bacteria 2633
52 Ga0068856_100263946 3300005614 Bacteria 1738
53 Ga0068856_100502444 3300005614 Bacteria 1234
54 Ga0068852_100740895 3300005616 Bacteria 994
55 Ga0068861_100351246 3300005719 Bacteria 1293
56 Ga0068860_100000081 3300005843 Bacteria 170066
57 Ga0081455_10040362 3300005937 Bacteria 4116
58 Ga0081455_10083231 3300005937 Bacteria 2615
59 Ga0081455_10174921 3300005937 Bacteria 1631
60 Ga0081540_1001760 3300005983 Bacteria 18218
61 Ga0081540_1005540 3300005983 Bacteria 9406
62 Ga0081540_1014485 3300005983 Bacteria 5046
63 Ga0081540_1048993 3300005983 Bacteria 2111
64 Ga0081540_1134530 3300005983 Bacteria 1003
65 Ga0070717_10049634 3300006028 Bacteria 3445
66 Ga0070717_10348019 3300006028 Bacteria 1324
67 Ga0075368_10081227 3300006042 Bacteria 1319
68 Ga0070716_100012668 3300006173 Bacteria 4279
69 Ga0070712_100010019 3300006175 Bacteria 5973
70 Ga0070712_100034839 3300006175 Bacteria 3413
71 Ga0070712_100073280 3300006175 Bacteria 2456
72 Ga0070712_100278340 3300006175 Bacteria 1347
73 Ga0070712_100455498 3300006175 Bacteria 1066
74 Ga0075367_10120568 3300006178 Bacteria 1616
75 Ga0075369_10051341 3300006186 Bacteria 1785
76 Ga0097621_100134565 3300006237 Bacteria 2107
77 Ga0068871_100031590 3300006358 Bacteria 4177
78 Ga0068871_100129359 3300006358 Bacteria 2139
79 Ga0068871_100190467 3300006358 Bacteria 1767
80 Ga0068865_100024309 3300006881 Bacteria 3974
81 Ga0068865_100181529 3300006881 Bacteria 1621
82 Ga0075436_100257481 3300006914 Bacteria 1244
83 Ga0099825_1027119 3300006941 Bacteria 2958
84 Ga0099825_1036202 3300006941 Bacteria 1714
85 Ga0099824_1008208 3300006942 Bacteria 13453
86 Ga0099823_1069183 3300006944 Bacteria 1609
87 Ga0075435_100088546 3300007076 Bacteria 2552
88 Ga0105240_10006945 3300009093 Bacteria 16535
89 Ga0105240_10074116 3300009093 Bacteria 4202
90 Ga0105240_10128623 3300009093 Bacteria 3041
91 Ga0105240_10157827 3300009093 Bacteria 2697
92 Ga0105245_10041292 3300009098 Bacteria 4112
93 Ga0105245_10042042 3300009098 Bacteria 4076
94 Ga0105245_10246306 3300009098 Bacteria 1735
95 Ga0105247_10098555 3300009101 Bacteria 1866
96 Ga0114129_10042454 3300009147 Bacteria 6404
97 Ga0105243_10421094 3300009148 Bacteria 1246
98 Ga0105241_10145845 3300009174 Bacteria 1931
99 Ga0105248_10180880 3300009177 Bacteria 2376
100 Ga0105248_11229537 3300009177 Bacteria 847
101 Ga0105237_10012502 3300009545 Bacteria 8943
102 Ga0105237_10097272 3300009545 Bacteria 2934
103 Ga0105237_10115212 3300009545 Bacteria 2681
104 Ga0105238_10083155 3300009551 Bacteria 3191
105 Ga0105238_10415542 3300009551 Bacteria 1339
106 Ga0105239_10052277 3300010375 Bacteria 4480
107 Ga0105239_10215656 3300010375 Bacteria 2152
108 Ga0105239_10229696 3300010375 Bacteria 2082
109 Ga0105239_10342604 3300010375 Bacteria 1687
110 Ga0105239_10350304 3300010375 Bacteria 1667
111 Ga0105246_10021797 3300011119 Bacteria 4127
112 Ga0105246_10118561 3300011119 Bacteria 1957
113 Ga0157370_10030019 3300013104 Bacteria 5328
114 Ga0157369_10007421 3300013105 Bacteria 12626
115 Ga0157369_10016145 3300013105 Bacteria 8405
116 Ga0157374_10021619 3300013296 Bacteria 5729
117 Ga0157374_10561451 3300013296 Bacteria 1150
118 Ga0157378_10009553 3300013297 Bacteria 8447
119 Ga0157378_10054478 3300013297 Bacteria 3561
120 Ga0163162_10067831 3300013306 Bacteria 3618
121 Ga0163162_10243654 3300013306 Bacteria 1929
122 Ga0157372_10080864 3300013307 Bacteria 3677
123 Ga0157372_10177241 3300013307 Bacteria 2467
124 Ga0157372_10314569 3300013307 Bacteria 1823
125 Ga0157372_10428682 3300013307 Bacteria 1541
126 Ga0157375_10012564 3300013308 Bacteria 7516
127 Ga0163163_10013378 3300014325 Bacteria 7511
128 Ga0157379_10084510 3300014968 Bacteria 2844
129 Ga0157376_10006417 3300014969 Bacteria 8309
130 Ga0182006_1092547 3300015261 Bacteria 1085
131 Ga0163161_10320706 3300017792 Bacteria 1225
132 Ga0206354_10458954 3300020081 Bacteria 1636
133 Ga0206353_12012706 3300020082 Bacteria 1456
134 Ga0213874_10003010 3300021377 Bacteria 3695
135 Ga0213876_10003065 3300021384 Bacteria 9662
136 Ga0213876_10059895 3300021384 Bacteria 2009
137 Ga0209677_100210 3300025253 Bacteria 44738
138 Ga0209677_105160 3300025253 Bacteria 3496
139 Ga0209148_1000180 3300025254 Bacteria 124830
140 Ga0209148_1003954 3300025254 Bacteria 3812
141 Ga0209233_1001530 3300025261 Bacteria 9065
142 Ga0209233_1009847 3300025261 Bacteria 2890
143 Ga0209455_1000620 3300025272 Bacteria 22265
144 Ga0209455_1007098 3300025272 Bacteria 3208
145 Ga0209758_1000133 3300025297 Bacteria 182442
146 Ga0209758_1001429 3300025297 Bacteria 28224
147 Ga0209758_1001880 3300025297 Bacteria 22994
148 Ga0209758_1047180 3300025297 Bacteria 1545
149 Ga0207426_1000620 3300025302 Bacteria 45305
150 Ga0207656_10159053 3300025321 Bacteria 1074
151 Ga0207692_10001278 3300025898 Bacteria 9337
152 Ga0207692_10005492 3300025898 Bacteria 5083
153 Ga0207692_10060370 3300025898 Bacteria 1961
154 Ga0207710_10030808 3300025900 Bacteria 2342
155 Ga0207680_10108586 3300025903 Bacteria 1795
156 Ga0207685_10026343 3300025905 Bacteria 2021
157 Ga0207699_10011463 3300025906 Bacteria 4478
158 Ga0207699_10034223 3300025906 Bacteria 2879
159 Ga0207699_10038517 3300025906 Bacteria 2741
160 Ga0207699_10073848 3300025906 Bacteria 2093
161 Ga0207643_10073216 3300025908 Bacteria 1974
162 Ga0207705_10118468 3300025909 Bacteria 1962
163 Ga0207684_10135572 3300025910 Bacteria 2114
164 Ga0207654_10059170 3300025911 Bacteria 2233
165 Ga0207654_10146593 3300025911 Bacteria 1511
166 Ga0207707_10000916 3300025912 Bacteria 28696
167 Ga0207707_10051186 3300025912 Bacteria 3597
168 Ga0207707_10539242 3300025912 Bacteria 992
169 Ga0207695_10000008 3300025913 Bacteria 1058268
170 Ga0207695_10022496 3300025913 Bacteria 7152
171 Ga0207695_10029844 3300025913 Bacteria 6016
172 Ga0207695_10054668 3300025913 Bacteria 4167
173 Ga0207695_10126645 3300025913 Bacteria 2515
174 Ga0207671_10072463 3300025914 Bacteria 2571
175 Ga0207671_10077041 3300025914 Bacteria 2496
176 Ga0207671_10133891 3300025914 Bacteria 1904
177 Ga0207693_10006620 3300025915 Bacteria 9572
178 Ga0207693_10019724 3300025915 Bacteria 5361
179 Ga0207693_10054006 3300025915 Bacteria 3152
180 Ga0207693_10298796 3300025915 Bacteria 1261
181 Ga0207663_10018681 3300025916 Bacteria 3891
182 Ga0207663_10033274 3300025916 Bacteria 3069
183 Ga0207663_10064826 3300025916 Bacteria 2333
184 Ga0207660_10021110 3300025917 Bacteria 4377
185 Ga0207660_10129847 3300025917 Bacteria 1917
186 Ga0207657_10430182 3300025919 Bacteria 1037
187 Ga0207649_10091894 3300025920 Bacteria 1989
188 Ga0207649_10318199 3300025920 Bacteria 1142
189 Ga0207652_10038672 3300025921 Bacteria 4046
190 Ga0207652_10069643 3300025921 Bacteria 3054
191 Ga0207652_10136727 3300025921 Bacteria 2189
192 Ga0207652_10180742 3300025921 Bacteria 1896
193 Ga0207694_10073020 3300025924 Bacteria 2683
194 Ga0207694_10397175 3300025924 Bacteria 1146
195 Ga0207687_10008249 3300025927 Bacteria 6815
196 Ga0207687_10257582 3300025927 Bacteria 1390
197 Ga0207687_10271898 3300025927 Bacteria 1355
198 Ga0207700_10003970 3300025928 Bacteria 8655
199 Ga0207700_10026454 3300025928 Bacteria 4045
200 Ga0207700_10055560 3300025928 Bacteria 2977
201 Ga0207700_10057722 3300025928 Bacteria 2928
202 Ga0207664_10004931 3300025929 Bacteria 9075
203 Ga0207664_10060274 3300025929 Bacteria 3024
204 Ga0207664_10622983 3300025929 Bacteria 969
205 Ga0207704_10235747 3300025938 Bacteria 1364
206 Ga0207665_10017817 3300025939 Bacteria 4668
207 Ga0207665_10082708 3300025939 Bacteria 2213
208 Ga0207711_10142170 3300025941 Bacteria 2160
209 Ga0207711_10348564 3300025941 Bacteria 1371
210 Ga0207689_10045378 3300025942 Bacteria 3634
211 Ga0207661_10002064 3300025944 Bacteria 13826
212 Ga0207661_10002496 3300025944 Bacteria 12664
213 Ga0207661_10341620 3300025944 Bacteria 1349
214 Ga0207661_10364813 3300025944 Bacteria 1305
215 Ga0207679_10298706 3300025945 Bacteria 1387
216 Ga0207667_10018061 3300025949 Bacteria 7921
217 Ga0207667_10274050 3300025949 Bacteria 1725
218 Ga0207667_10298458 3300025949 Bacteria 1646
219 Ga0207667_10612597 3300025949 Bacteria 1097
220 Ga0207640_10308809 3300025981 Bacteria 1254
221 Ga0207640_10481263 3300025981 Bacteria 1030
222 Ga0207677_10061957 3300026023 Bacteria 2593
223 Ga0207703_10034858 3300026035 Bacteria 3996
224 Ga0207639_10079464 3300026041 Bacteria 2592
225 Ga0207639_10598686 3300026041 Bacteria 1016
226 Ga0207678_10041101 3300026067 Bacteria 4009
227 Ga0207702_10155120 3300026078 Bacteria 2086
228 Ga0207702_10458614 3300026078 Bacteria 1238
229 Ga0207702_10565238 3300026078 Bacteria 1113
230 Ga0207675_100443744 3300026118 Bacteria 1285
231 Ga0207675_100464261 3300026118 Bacteria 1256
232 Ga0207683_10010904 3300026121 Bacteria 7751
233 Ga0207698_10042683 3300026142 Bacteria 3391
234 Ga0207698_10058662 3300026142 Bacteria 2984
235 Ga0207698_10747192 3300026142 Bacteria 977
236 Ga0209389_1000001 3300027296 Bacteria 463799
237 Ga0209589_1000014 3300027357 Bacteria 227996
238 Ga0209489_100014 3300027361 Bacteria 227996
239 Ga0209489_119997 3300027361 Bacteria 2055
240 Ga0209700_100007 3300027363 Bacteria 454608
241 Ga0209700_100024 3300027363 Bacteria 227996
242 Ga0209179_1035618 3300027512 Bacteria 1035
243 Ga0268264_10000048 3300028381 Bacteria 334457
244 Ga0265338_10302683 3300028800 Bacteria 1162
245 Ga0307511_10022568 3300030521 Bacteria 5895
246 Ga0265330_10034863 3300031235 Bacteria 2247
247 Ga0265340_10071372 3300031247 Bacteria 1646
248 Ga0265339_10016773 3300031249 Bacteria 4358
249 Ga0307509_10074244 3300031507 Bacteria 3537
250 Ga0307509_10140206 3300031507 Bacteria 2355
251 Ga0265313_10114165 3300031595 Bacteria 1185
252 Ga0307508_10000032 3300031616 Bacteria 163293
253 Ga0307508_10076043 3300031616 Bacteria 2935
254 Ga0265314_10005447 3300031711 Bacteria 11490
255 Ga0265314_10024001 3300031711 Bacteria 4634
256 Ga0307406_10484461 3300031901 Bacteria 1000
257 Ga0315911_1000002 3300033442 Bacteria 926833
258 Ga0316215_1009399 3300033544 Bacteria 963
259 Ga0373926_0017225 3300035083 Bacteria 2478
260 Ga0373926_0022939 3300035083 Bacteria 2166
261 Ga0373934_0033956 3300035086 Bacteria 2004
262 Ga0373936_0003229 3300035113 Bacteria 6115
263 Ga0373936_0021224 3300035113 Bacteria 2525
264 Ga0373936_0103265 3300035113 Bacteria 1204
265 Ga0373945_0009107 3300035116 Bacteria 3245
266 Ga0373953_0032257 3300035117 Bacteria 2042
267 Ga0373954_0006338 3300035118 Bacteria 5158
268 Ga0373956_0011739 3300035119 Bacteria 3615
269 Ga0373956_0016342 3300035119 Bacteria 3116
270 Ga0373943_0008120 3300035170 Bacteria 4708
271 Ga0373946_0003292 3300035171 Bacteria 5739
272 Ga0373946_0159889 3300035171 Bacteria 1057
273 Ga0373955_0058087 3300035172 Bacteria 2127
274 Ga0373942_0158904 3300035207 Bacteria 730
275 Ga0373935_0007483 3300035692 Bacteria 6537
276 Ga0373935_0014513 3300035692 Bacteria 4754
277 Ga0373935_0076609 3300035692 Bacteria 2166
278 Ga0373927_0005166 3300035695 Bacteria 9030
279 Ga0373927_0017851 3300035695 Bacteria 4666
280 Ga0373927_0020402 3300035695 Bacteria 4345
281 Ga0373927_0077200 3300035695 Bacteria 2157
282 Ga0373933_0000406 3300035724 Bacteria 27321
283 Ga0373933_0016314 3300035724 Bacteria 4150
284 Ga0373933_0096426 3300035724 Bacteria 1830
285 Ga0373947_0110170 3300035725 Bacteria 1739
286 Ga0373937_0146362 3300036401 Bacteria 2211
287 Ga0373925_0104858 3300037068 Bacteria 2178
288 Ga0373925_0177234 3300037068 Bacteria 1685
289 Ga0395900_0000948 3300037418 Bacteria 37848
290 Ga0395900_0048549 3300037418 Bacteria 4373
291 Ga0395898_0273869 3300037466 Bacteria 1610
292 Ga0395898_0370698 3300037466 Bacteria 1365
293 Ga0395905_0004515 3300037471 Bacteria 14421
294 Ga0395905_0071333 3300037471 Bacteria 3256
295 Ga0436364_0519650 3300037853 Bacteria 2126
296 Ga0395901_0370210 3300038443 Bacteria 1476
297 Ga0436365_0227213 3300039437 Bacteria 2604
298 Ga0436365_0230691 3300039437 Bacteria 977
299 Ga0436365_1558214 3300039437 Bacteria 2191
300 Ga0436365_1580667 3300039437 Bacteria 5735
301 Ga0436365_1835761 3300039437 Bacteria 36188
302 Ga0436360_0655438 3300039438 Bacteria 3133
303 Ga0436361_0216778 3300039447 Bacteria 1502
304 Ga0436361_0248601 3300039447 Bacteria 2522
305 Ga0436361_0785428 3300039447 Bacteria 1067
306 Ga0436363_0362302 3300039450 Bacteria 4805
307 Ga0436362_0074913 3300039453 Bacteria 4447
308 Ga0436362_1193065 3300039453 Bacteria 3700
309 Ga0466972_0001899 3300044658 Bacteria 10263
310 Ga0466972_0010445 3300044658 Bacteria 4663
311 Ga0466965_0126569 3300044683 Bacteria 1322
312 Ga0466965_0149087 3300044683 Bacteria 1222
313 Ga0466966_0063523 3300044684 Bacteria 2326
314 Ga0466966_0137292 3300044684 Bacteria 1495
315 Ga0466961_0000050 3300044693 Bacteria 71289
316 Ga0466963_0156531 3300044694 Bacteria 1584
317 Ga0466968_0079107 3300044735 Bacteria 1442
318 Ga0466968_0095810 3300044735 Bacteria 1321
319 Ga0466970_0262392 3300044765 Bacteria 969
320 Ga0466957_0171864 3300044842 Bacteria 1412
321 Ga0466960_0118840 3300044901 Bacteria 1382
322 Ga0466959_0005557 3300045049 Bacteria 8654
323 Ga0466959_0016947 3300045049 Bacteria 5333
324 Ga0466959_0270002 3300045049 Bacteria 1169
325 Ga0466958_0107646 3300045836 Bacteria 1739
326 Ga0466967_0070734 3300045976 Bacteria 3122
327 Ga0466967_0095054 3300045976 Bacteria 2715
328 Ga0466967_0132737 3300045976 Bacteria 2313
329 Ga0466967_0259926 3300045976 Bacteria 1661
330 Ga0495592_0016464 3300046454 Bacteria 5610
331 Ga0495603_0062365 3300046455 Bacteria 2201
332 Ga0495603_0306441 3300046455 Bacteria 912
333 Ga0495629_0004164 3300046459 Bacteria 10856
334 Ga0495629_0016212 3300046459 Bacteria 5349
335 Ga0495629_0316027 3300046459 Bacteria 1068
336 Ga0495651_0054312 3300046462 Bacteria 3081
337 Ga0495651_0199431 3300046462 Bacteria 1401
338 Ga0495653_0106668 3300046463 Bacteria 2020
339 Ga0495580_0004514 3300046472 Bacteria 11688
340 Ga0495580_0410943 3300046472 Bacteria 911
341 Ga0495582_0041115 3300046473 Bacteria 2547
342 Ga0495582_0064270 3300046473 Bacteria 2026
343 Ga0495582_0099343 3300046473 Bacteria 1629
344 Ga0495639_0004971 3300046475 Bacteria 5703
345 Ga0495662_0107074 3300046476 Bacteria 1369
346 Ga0495664_0019517 3300046477 Bacteria 3898
347 Ga0495594_0067294 3300046499 Bacteria 1988
348 Ga0495607_0032466 3300046501 Bacteria 3186
349 Ga0495583_0074593 3300046506 Bacteria 1485
350 Ga0495606_0061638 3300046507 Bacteria 2398
351 Ga0495606_0138159 3300046507 Bacteria 1441
352 Ga0495608_0017348 3300046511 Bacteria 4980
353 Ga0495608_0285828 3300046511 Bacteria 1023
354 Ga0495618_0064109 3300046514 Bacteria 2334
355 Ga0495618_0135281 3300046514 Bacteria 1577
356 Ga0495628_0292851 3300046516 Bacteria 1206
357 Ga0495630_0061693 3300046517 Bacteria 2815
358 Ga0495630_0188680 3300046517 Bacteria 1573
359 Ga0495631_0112100 3300046518 Bacteria 1173
360 Ga0495648_0012980 3300046524 Bacteria 6183
361 Ga0495666_0061310 3300046526 Bacteria 1797
362 Ga0495652_0023483 3300046529 Bacteria 5466
363 Ga0495652_0063455 3300046529 Bacteria 3110
364 Ga0495652_0166690 3300046529 Bacteria 1704
365 Ga0495652_0221291 3300046529 Bacteria 1422
366 Ga0495665_0012269 3300046531 Bacteria 4637
367 Ga0495640_0029778 3300046533 Bacteria 3914
368 Ga0495640_0031288 3300046533 Bacteria 3799
369 Ga0495640_0061328 3300046533 Bacteria 2555
370 Ga0495587_0006060 3300046536 Bacteria 7887
371 Ga0495587_0112409 3300046536 Bacteria 1564
372 Ga0495587_0130859 3300046536 Bacteria 1434
373 Ga0495597_0039041 3300046542 Bacteria 2127
374 Ga0495645_0031198 3300046543 Bacteria 3883
375 Ga0495645_0067622 3300046543 Bacteria 2580
376 Ga0495645_0093671 3300046543 Bacteria 2143
377 Ga0495645_0146919 3300046543 Bacteria 1641
378 Ga0495622_0014914 3300046557 Bacteria 3613
379 Ga0495667_0031571 3300046559 Bacteria 3554
380 Ga0495667_0068906 3300046559 Bacteria 2309
381 Ga0495667_0181793 3300046559 Bacteria 1349
382 Ga0495634_0033435 3300046642 Bacteria 3534
383 Ga0495625_0125544 3300046660 Bacteria 1742
384 Ga0495635_0001219 3300046663 Bacteria 17201
385 Ga0495635_0010817 3300046663 Bacteria 6392
386 Ga0495635_0043607 3300046663 Bacteria 3095
387 Ga0495661_0018009 3300046665 Bacteria 4653
388 Ga0495657_0008675 3300046675 Bacteria 7759
389 Ga0495657_0023046 3300046675 Bacteria 4453
390 Ga0495599_0257260 3300046678 Bacteria 1061
391 Ga0495623_0011265 3300046679 Bacteria 5783
392 Ga0495623_0044114 3300046679 Bacteria 2834
393 Ga0495646_0051044 3300046680 Bacteria 2504
394 Ga0495646_0092917 3300046680 Bacteria 1739
395 Ga0495658_0024424 3300046683 Bacteria 3219
396 Ga0495658_0061147 3300046683 Bacteria 2162
397 Ga0495613_0034342 3300046689 Bacteria 3767
398 Ga0495613_0054981 3300046689 Bacteria 2926
399 Ga0495624_0034608 3300046690 Bacteria 3266
400 Ga0495624_0039263 3300046690 Bacteria 3035
401 Ga0495624_0188699 3300046690 Bacteria 1254
402 Ga0495649_0079714 3300046694 Bacteria 1751
403 Ga0495600_0076852 3300046809 Bacteria 2180
404 Ga0495581_0021847 3300047315 Bacteria 3709
405 Ga0495581_0043324 3300047315 Bacteria 2603
406 Ga0495581_0151367 3300047315 Bacteria 1355
407 Ga0495604_0138281 3300047317 Bacteria 1743
408 Ga0495604_0314615 3300047317 Bacteria 1048
409 Ga0495674_0067364 3300047319 Bacteria 3102
410 Ga0495674_0216183 3300047319 Bacteria 1586
411 Ga0495674_0413141 3300047319 Bacteria 1088
412 Ga0495674_0589442 3300047319 Bacteria 882
413 Ga0495672_0145806 3300047320 Bacteria 1232
414 Ga0495676_0184673 3300047321 Bacteria 1459
415 Ga0495680_0027996 3300047322 Bacteria 4624
416 Ga0495675_0031619 3300047444 Bacteria 3379
417 Ga0495675_0151883 3300047444 Bacteria 1430
418 Ga0495684_0010530 3300047471 Bacteria 7149
419 Ga0495684_0019701 3300047471 Bacteria 5198
420 Ga0495684_0108177 3300047471 Bacteria 2100
421 Ga0495686_0033809 3300047472 Bacteria 3298
422 Ga0495686_0139551 3300047472 Bacteria 1431
423 Ga0495593_0028308 3300047673 Bacteria 3078
424 Ga0495593_0031403 3300047673 Bacteria 2901
425 Ga0495593_0042204 3300047673 Bacteria 2449
426 Ga0495602_0033120 3300048088 Bacteria 4853
427 Ga0495602_0286678 3300048088 Bacteria 1211
428 Ga0496100_0089884 3300048903 Bacteria 2093
429 Ga0496100_0262968 3300048903 Bacteria 1280
430 Ga0496100_0405975 3300048903 Bacteria 1038
431 Ga0496100_0487555 3300048903 Bacteria 948
432 Ga0496100_0616533 3300048903 Bacteria 843
433 Ga0496101_0075626 3300048904 Bacteria 2479
434 Ga0496101_0148703 3300048904 Bacteria 1790
435 Ga0496102_0058766 3300048905 Bacteria 3515
436 Ga0496102_0114298 3300048905 Bacteria 2518
437 Ga0496102_0146084 3300048905 Bacteria 2220
438 Ga0496102_0585047 3300048905 Bacteria 1039
439 Ga0496103_0020025 3300048906 Bacteria 4017
440 Ga0496104_0018839 3300048907 Bacteria 6305
441 Ga0496104_0098246 3300048907 Bacteria 2803
442 Ga0496105_0016130 3300048908 Bacteria 5958
443 Ga0496105_0063988 3300048908 Bacteria 3034
444 Ga0496106_0000240 3300048909 Bacteria 38188
445 Ga0496106_0003104 3300048909 Bacteria 12404
446 Ga0496107_0006959 3300048910 Bacteria 7794
447 Ga0496107_0050244 3300048910 Bacteria 3006
448 Ga0496108_0002900 3300048911 Bacteria 13769
449 Ga0496108_0015092 3300048911 Bacteria 6305
450 Ga0496109_0002875 3300048912 Bacteria 14407
451 Ga0496109_0213881 3300048912 Bacteria 1813
452 Ga0496110_0014112 3300048913 Bacteria 6624
453 Ga0496110_0034780 3300048913 Bacteria 4367
454 Ga0496110_0142471 3300048913 Bacteria 2167
455 Ga0496111_0101097 3300048914 Bacteria 2118
456 Ga0496112_0004764 3300048915 Bacteria 11568
457 Ga0496112_0026862 3300048915 Bacteria 5547
458 Ga0496112_0446735 3300048915 Bacteria 1231
459 Ga0496112_0661452 3300048915 Bacteria 974
460 Ga0496113_0005360 3300048916 Bacteria 7994
461 Ga0496113_0042681 3300048916 Bacteria 3352
462 Ga0496113_0183206 3300048916 Bacteria 1660
463 Ga0496113_0439440 3300048916 Bacteria 1048
464 Ga0496114_0066871 3300048917 Bacteria 3014
465 Ga0496114_0286060 3300048917 Bacteria 1454
466 Ga0496114_0684180 3300048917 Bacteria 900
467 Ga0496115_0004354 3300048918 Bacteria 10246
468 Ga0496115_0031524 3300048918 Bacteria 4178
469 Ga0496115_0365512 3300048918 Bacteria 1175
470 Ga0496115_0394969 3300048918 Bacteria 1123
471 Ga0496116_0001913 3300048919 Bacteria 22414
472 Ga0496117_0059196 3300048920 Bacteria 2648
473 Ga0496117_0107837 3300048920 Bacteria 1743
474 Ga0496117_0176772 3300048920 Bacteria 1232
475 Ga0496117_0272441 3300048920 Bacteria 911
476 Ga0496118_0014922 3300048921 Bacteria 7231
477 Ga0496118_0036957 3300048921 Bacteria 3939
478 Ga0496118_0137954 3300048921 Bacteria 1553
479 Ga0496118_0179234 3300048921 Bacteria 1282
480 Ga0496119_0007401 3300048922 Bacteria 9897
481 Ga0496119_0053987 3300048922 Bacteria 2450
482 Ga0496120_0042313 3300048923 Bacteria 2661
483 Ga0496120_0050889 3300048923 Bacteria 2370
484 Ga0496121_0000230 3300048924 Bacteria 120616
485 Ga0496121_0004398 3300048924 Bacteria 19000
486 Ga0496121_0012985 3300048924 Bacteria 9002
487 Ga0496121_0012991 3300048924 Bacteria 8999
488 Ga0496121_0072354 3300048924 Bacteria 2768
489 Ga0496121_0080720 3300048924 Bacteria 2577
490 Ga0496121_0195417 3300048924 Bacteria 1446
491 Ga0496122_0060463 3300048925 Bacteria 2790
492 Ga0496122_0097437 3300048925 Bacteria 1979
493 Ga0496125_0000040 3300048928 Bacteria 314478
494 Ga0496125_0010916 3300048928 Bacteria 9134
495 Ga0496125_0057016 3300048928 Bacteria 3167
496 Ga0496125_0063668 3300048928 Bacteria 2938
497 Ga0496125_0072103 3300048928 Bacteria 2694
498 Ga0496125_0115698 3300048928 Bacteria 1928
499 Ga0496126_0005072 3300048929 Bacteria 15276
500 Ga0496126_0007510 3300048929 Bacteria 11940
501 Ga0496126_0035899 3300048929 Bacteria 4640
502 Ga0496126_0039704 3300048929 Bacteria 4365
503 Ga0496126_0096139 3300048929 Bacteria 2597
504 Ga0496126_0104813 3300048929 Bacteria 2470
505 Ga0496126_0124793 3300048929 Bacteria 2229
506 Ga0496126_0218933 3300048929 Bacteria 1600
507 Ga0496126_0250775 3300048929 Bacteria 1475
508 Ga0496126_0360391 3300048929 Bacteria 1188
509 Ga0496126_0402111 3300048929 Bacteria 1110
510 Ga0496126_0608361 3300048929 Bacteria 860
511 Ga0495678_104845 3300049459 Bacteria 974
512 Ga0501031_0001217 3300049568 Bacteria 15748
513 Ga0501032_0011357 3300049569 Bacteria 6397
514 Ga0501032_0028163 3300049569 Bacteria 3860
515 Ga0501032_0036558 3300049569 Bacteria 3351
516 Ga0501033_0000667 3300049570 Bacteria 31755
517 Ga0501033_0004962 3300049570 Bacteria 10583
518 Ga0501033_0039325 3300049570 Bacteria 3533
519 Ga0501034_0001924 3300049571 Bacteria 26305
520 Ga0501034_0163614 3300049571 Bacteria 2194
521 Ga0501036_0001359 3300049572 Bacteria 18755
522 Ga0501036_0077813 3300049572 Bacteria 2806
523 Ga0501037_0000715 3300049573 Bacteria 25186
524 Ga0501037_0068347 3300049573 Bacteria 2586
525 Ga0501038_0000342 3300049574 Bacteria 40148
526 Ga0501038_0021064 3300049574 Bacteria 5856
527 Ga0501039_0001565 3300049575 Bacteria 16831
528 Ga0501039_0032158 3300049575 Bacteria 4043
529 Ga0501039_0132064 3300049575 Bacteria 1959
530 Ga0501040_0020439 3300049576 Bacteria 4411
531 Ga0501042_0021464 3300049578 Bacteria 4501
532 Ga0501043_0000120 3300049579 Bacteria 72670
533 Ga0501043_0003554 3300049579 Bacteria 12804
534 Ga0501046_0001506 3300049580 Bacteria 22255
535 Ga0501046_0082098 3300049580 Bacteria 2489
536 Ga0501047_0000697 3300049581 Bacteria 35083
537 Ga0501047_0008066 3300049581 Bacteria 9937
538 Ga0501047_0033590 3300049581 Bacteria 4951
539 Ga0501047_0095041 3300049581 Bacteria 2859
540 Ga0501047_0440625 3300049581 Bacteria 1133
541 Ga0501048_0000288 3300049582 Bacteria 34175
542 Ga0501048_0014507 3300049582 Bacteria 5832
543 Ga0501067_0000682 3300049583 Bacteria 18262
544 Ga0501067_0074226 3300049583 Bacteria 1884
545 Ga0501068_0124562 3300049584 Bacteria 1608
546 Ga0501070_0003047 3300049586 Bacteria 14595
547 Ga0501070_0150319 3300049586 Bacteria 1921
548 Ga0501070_0237769 3300049586 Bacteria 1491
549 Ga0501072_0000936 3300049588 Bacteria 21487
550 Ga0501073_0000091 3300049589 Bacteria 57029
551 Ga0501073_0073507 3300049589 Bacteria 2380
552 Ga0501073_0179987 3300049589 Bacteria 1463
553 Ga0501074_0004116 3300049590 Bacteria 10380
554 Ga0501076_0049798 3300049592 Bacteria 3314
555 Ga0501079_0001942 3300049741 Bacteria 14808
556 Ga0501079_0042558 3300049741 Bacteria 3506
557 Ga0501080_0007154 3300049742 Bacteria 10072
558 Ga0501080_0059524 3300049742 Bacteria 3554
559 Ga0501083_0000470 3300049744 Bacteria 25912
560 Ga0501083_0080926 3300049744 Bacteria 2153
561 Ga0501035_0000452 3300049822 Bacteria 45865
562 Ga0501035_0126221 3300049822 Bacteria 2233
563 Ga0501044_0000274 3300049823 Bacteria 65668
564 Ga0501044_0081070 3300049823 Bacteria 3285
565 Ga0501044_0114224 3300049823 Bacteria 2706
566 Ga0501044_0200130 3300049823 Bacteria 1956
567 Ga0501044_0365053 3300049823 Bacteria 1361
568 nmdc:mga0yw44_6230_c2 3300050492 Bacteria 2972
569 nmdc:mga0k408_8246_c1 3300050493 Bacteria 5589
570 nmdc:mga05p37_161675_c1 3300050507 Bacteria 2734
571 nmdc:mga0sz30_74984_c1 3300050516 Bacteria 1460
572 Ga0495601_0062094 3300053077 Bacteria 2372
573 Ga0495601_0120162 3300053077 Bacteria 1706
574 Ga0495612_0004388 3300053078 Bacteria 5851
575 Ga0500635_0002076 3300053080 Bacteria 4905
576 Ga0495595_0072134 3300053084 Bacteria 1634
577 Ga0495619_0000557 3300053085 Bacteria 24670
578 Ga0500578_0135637 3300053086 Bacteria 1541
579 Ga0500643_013175 3300053087 Bacteria 2931
580 Ga0500644_0027616 3300053088 Bacteria 1767
581 Ga0500644_0043881 3300053088 Bacteria 1498
582 Ga0500647_0024301 3300053091 Bacteria 2849
583 Ga0500566_0000331 3300053094 Bacteria 25736
584 Ga0500566_0001048 3300053094 Bacteria 16009
585 Ga0500566_0021105 3300053094 Bacteria 3831
586 Ga0500566_0152949 3300053094 Bacteria 1211
587 Ga0500640_000214 3300053095 Bacteria 12549
588 Ga0500648_202869 3300053097 Bacteria 994
589 Ga0500556_0000069 3300053104 Bacteria 101263
590 Ga0500569_013753 3300053109 Bacteria 1989
591 Ga0500572_000025 3300053111 Bacteria 45953
592 Ga0500572_000175 3300053111 Bacteria 22657
593 Ga0500591_053485 3300053115 Bacteria 1886
594 Ga0500593_097835 3300053117 Bacteria 1229
595 Ga0500595_000407 3300053119 Bacteria 27509
596 Ga0500595_000715 3300053119 Bacteria 19771
597 Ga0500595_015655 3300053119 Bacteria 2842
598 Ga0500608_001694 3300053122 Bacteria 7896
599 Ga0500608_006744 3300053122 Bacteria 4703
600 Ga0500614_001781 3300053123 Bacteria 4996
601 Ga0500652_001281 3300053131 Bacteria 7967
602 Ga0500559_0000289 3300053136 Bacteria 38837
603 Ga0500559_0001458 3300053136 Bacteria 13416
604 Ga0500559_0021044 3300053136 Bacteria 2761
605 Ga0500559_0028447 3300053136 Bacteria 2388
606 Ga0500568_0020133 3300053139 Bacteria 2891
607 Ga0500573_0025499 3300053140 Bacteria 3399
608 Ga0500590_049893 3300053148 Bacteria 2130
609 Ga0500603_002027 3300053150 Bacteria 4486
610 Ga0500616_0000461 3300053153 Bacteria 53095
611 Ga0500622_0000602 3300053156 Bacteria 32636
612 Ga0500630_000213 3300053159 Bacteria 22563
613 Ga0500634_0071635 3300053161 Bacteria 1812
614 Ga0500638_001677 3300053162 Bacteria 7185
615 Ga0500639_000239 3300053163 Bacteria 27228
616 Ga0500639_006810 3300053163 Bacteria 5912
617 Ga0500636_0007566 3300053177 Bacteria 6281
618 Ga0500636_0047846 3300053177 Bacteria 2518
619 Ga0500636_0085360 3300053177 Bacteria 1813
620 Ga0500636_0206406 3300053177 Bacteria 1035
621 Ga0500637_0000265 3300053178 Bacteria 19602
622 Ga0500637_0060102 3300053178 Bacteria 2176
623 Ga0500645_012726 3300053730 Bacteria 2715
624 Ga0500596_002172 3300053735 Bacteria 3887
625 Ga0501084_0004871 3300054114 Bacteria 10961
626 Ga0500661_003010 3300055283 Bacteria 3164
627 Ga0501082_0041409 3300060353 Bacteria 3971
628 Ga0501082_0167518 3300060353 Bacteria 1909

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046511 Ga0495608_0285828 Ga0495608_0285828_323_973 204
2 3300048903 Ga0496100_0616533 Ga0496100_0616533_170_832 210
3 3300035207 Ga0373942_0158904 Ga0373942_0158904_52_702 211
4 3300049589 Ga0501073_0179987 Ga0501073_0179987_42_728 214
5 3300005614 Ga0068856_100263946 Ga0068856_1002639462 225
6 3300037466 Ga0395898_0273869 Ga0395898_0273869_572_1336 225
7 3300037471 Ga0395905_0071333 Ga0395905_0071333_1045_1809 225
8 3300047319 Ga0495674_0067364 Ga0495674_0067364_1257_2033 226
9 3300005439 Ga0070711_100025185 Ga0070711_1000251852 230
10 3300025916 Ga0207663_10018681 Ga0207663_100186814 230
11 3300044658 Ga0466972_0010445 Ga0466972_0010445_713_1477 230
12 iso_pu_bacteria 2919073203 2919079345 230
13 3300005434 Ga0070709_10000980 Ga0070709_100009802 231
14 3300005435 Ga0070714_100014017 Ga0070714_1000140174 231
15 3300005436 Ga0070713_100016044 Ga0070713_1000160442 231
16 3300005437 Ga0070710_10001038 Ga0070710_100010385 231
17 3300006028 Ga0070717_10348019 Ga0070717_103480192 231
18 3300006173 Ga0070716_100012668 Ga0070716_1000126682 231
19 3300006175 Ga0070712_100010019 Ga0070712_1000100193 231
20 3300025898 Ga0207692_10001278 Ga0207692_100012788 231
21 3300025906 Ga0207699_10011463 Ga0207699_100114632 231
22 3300025915 Ga0207693_10006620 Ga0207693_100066207 231
23 3300025928 Ga0207700_10026454 Ga0207700_100264542 231
24 3300025929 Ga0207664_10004931 Ga0207664_100049315 231
25 3300025939 Ga0207665_10017817 Ga0207665_100178172 231
26 3300048929 Ga0496126_0608361 Ga0496126_0608361_11_847 231
27 iso_pu_bacteria 2824704595 2824711294 231
28 3300021384 Ga0213876_10003065 Ga0213876_100030657 232
29 3300039437 Ga0436365_1835761 Ga0436365_1835761_10299_11123 232
30 3300039453 Ga0436362_0074913 Ga0436362_0074913_2039_2836 234
31 3300046462 Ga0495651_0054312 Ga0495651_0054312_578_1342 234
32 3300046476 Ga0495662_0107074 Ga0495662_0107074_218_982 234
33 3300046516 Ga0495628_0292851 Ga0495628_0292851_140_904 234
34 3300046517 Ga0495630_0188680 Ga0495630_0188680_432_1196 234
35 3300046529 Ga0495652_0166690 Ga0495652_0166690_161_925 234
36 3300046536 Ga0495587_0130859 Ga0495587_0130859_305_1069 234
37 3300046543 Ga0495645_0067622 Ga0495645_0067622_865_1629 234
38 3300046559 Ga0495667_0181793 Ga0495667_0181793_71_835 234
39 3300046678 Ga0495599_0257260 Ga0495599_0257260_128_892 234
40 3300046680 Ga0495646_0092917 Ga0495646_0092917_431_1195 234
41 3300046809 Ga0495600_0076852 Ga0495600_0076852_833_1597 234
42 3300047317 Ga0495604_0138281 Ga0495604_0138281_33_797 234
43 3300047322 Ga0495680_0027996 Ga0495680_0027996_806_1570 234
44 3300047444 Ga0495675_0031619 Ga0495675_0031619_2135_2899 234
45 3300053084 Ga0495595_0072134 Ga0495595_0072134_436_1200 234
46 3300053177 Ga0500636_0206406 Ga0500636_0206406_82_846 234
47 iso_pu_bacteria 2903768456 2903769667 237
48 3300025253 Ga0209677_105160 Ga0209677_1051603 241
49 3300025297 Ga0209758_1047180 Ga0209758_10471801 241
50 3300045976 Ga0466967_0070734 Ga0466967_0070734_2217_2996 241
51 iso_pu_bacteria 2941531003 2941531141 241
52 3300003215 JGI25153J46596_10015142 JGI25153J46596_100151423 242
53 3300005577 Ga0068857_100524382 Ga0068857_1005243821 242
54 3300009545 Ga0105237_10097272 Ga0105237_100972723 242
55 3300025297 Ga0209758_1000133 Ga0209758_10001331 242
56 3300048929 Ga0496126_0035899 Ga0496126_0035899_825_1610 242
57 iso_pu_bacteria 2602042107 2603860955 242
58 iso_pu_bacteria 2857524615 2857530995 242
59 iso_pu_bacteria 2893066018 2893069114 242
60 3300047471 Ga0495684_0108177 Ga0495684_0108177_1220_1984 243
61 iso_pu_bacteria 2841949485 2841953416 243
62 3300003323 rootH1_10005224 rootH1_100052241 244
63 3300046679 Ga0495623_0044114 Ga0495623_0044114_1607_2371 244
64 3300048924 Ga0496121_0072354 Ga0496121_0072354_377_1159 244
65 iso_pu_bacteria 2513237092 2513622993 244
66 iso_pu_bacteria 2508501128 2509149350 245
67 iso_pu_bacteria 2513237094 2513642914 245
68 iso_pu_bacteria 2513237096 2513654033 245
69 iso_pu_bacteria 2513237104 2513719430 245
70 iso_pu_bacteria 2513237137 2513856785 245
71 iso_pu_bacteria 2513237139 2513878459 245
72 iso_pu_bacteria 2513237141 2513891307 245
73 iso_pu_bacteria 2513237145 2513918373 245
74 iso_pu_bacteria 2513237161 2514009493 245
75 iso_pu_bacteria 2517572143 2517891393 245
76 iso_pu_bacteria 2524023228 2524538421 245
77 iso_pu_bacteria 2617270735 2617346738 245
78 iso_pu_bacteria 2667528175 2671118827 245
79 iso_pu_bacteria 2728368998 2728750101 245
80 iso_pu_bacteria 2791355197 2793066763 245
81 iso_pu_bacteria 2802429603 2805919117 245
82 iso_pu_bacteria 2824671348 2824674831 245
83 iso_pu_bacteria 2824687955 2824693491 245
84 iso_pu_bacteria 2824696289 2824701984 245
85 iso_pu_bacteria 2824753945 2824758488 245
86 iso_pu_bacteria 2824763712 2824770072 245
87 iso_pu_bacteria 2824773399 2824775189 245
88 iso_pu_bacteria 2841966195 2841972113 245
89 iso_pu_bacteria 2841974524 2841978141 245
90 iso_pu_bacteria 2844315083 2844319956 245
91 iso_pu_bacteria 2847930680 2847937268 245
92 iso_pu_bacteria 2847939898 2847947678 245
93 iso_pu_bacteria 2874620515 2874628018 245
94 iso_pu_bacteria 2876761206 2876766153 245
95 iso_pu_bacteria 2879083081 2879086573 245
96 iso_pu_bacteria 2888388044 2888392858 245
97 iso_pu_bacteria 2903727486 2903730371 245
98 iso_pu_bacteria 2903748898 2903755953 245
99 iso_pu_bacteria 2904666416 2904674364 245
100 iso_pu_bacteria 2904690495 2904691256 245
101 iso_pu_bacteria 2904699407 2904704941 245
102 iso_pu_bacteria 2904711408 2904712045 245
103 iso_pu_bacteria 2906602504 2906604696 245
104 iso_pu_bacteria 2906610324 2906616575 245
105 iso_pu_bacteria 2906626472 2906627404 245
106 iso_pu_bacteria 2906635258 2906635352 245
107 iso_pu_bacteria 2906643746 2906643893 245
108 iso_pu_bacteria 2906660503 2906666898 245
109 iso_pu_bacteria 2908739725 2908741743 245
110 iso_pu_bacteria 2908756301 2908759103 245
111 iso_pu_bacteria 2922361189 2922368632 245
112 iso_pu_bacteria 2922425934 2922431401 245
113 iso_pu_bacteria 2932794094 2932795214 245
114 iso_pu_bacteria 2932801729 2932805744 245
115 iso_pu_bacteria 2935608549 2935609768 245
116 iso_pu_bacteria 2935630451 2935633997 245
117 iso_pu_bacteria 2935819856 2935822930 245
118 iso_pu_bacteria 2935847175 2935848512 245
119 iso_pu_bacteria 2935883170 2935883886 245
120 iso_pu_bacteria 2935908558 2935909683 245
121 iso_pu_bacteria 2935916978 2935917407 245
122 iso_pu_bacteria 2935926038 2935927164 245
123 iso_pu_bacteria 2935934488 2935936992 245
124 iso_pu_bacteria 2935942939 2935944705 245
125 iso_pu_bacteria 2935951376 2935953142 245
126 iso_pu_bacteria 2935959822 2935966654 245
127 iso_pu_bacteria 2935967501 2935969982 245
128 iso_pu_bacteria 2941507105 2941510700 245
129 iso_pu_bacteria 2941515067 2941518084 245
130 iso_pu_bacteria 2941523033 2941527045 245
131 iso_pu_bacteria 3005474847 3005481198 245
132 iso_pu_bacteria 3005594810 3005600240 245
133 iso_pu_bacteria 3005710791 3005715748 245
134 iso_pu_bacteria 3005718088 3005723096 245
135 iso_pu_bacteria 8006933436 8006939515 245
136 iso_pu_bacteria 8006973647 8006979265 245
137 iso_pu_bacteria 8016583857 8016594248 245
138 iso_pu_bacteria 8019555841 8019565398 245
139 iso_pu_bacteria 8019565922 8019575492 245
140 iso_pu_bacteria 8019576017 8019584232 245
141 iso_pu_bacteria 8019687851 8019691003 245
142 iso_pu_bacteria 8056689827 8056693114 245
143 iso_pu_bacteria 8056967851 8056975139 245
144 3300006178 Ga0075367_10120568 Ga0075367_101205682 246
145 3300006186 Ga0075369_10051341 Ga0075369_100513411 246
146 3300046501 Ga0495607_0032466 Ga0495607_0032466_2296_3048 246
147 3300046524 Ga0495648_0012980 Ga0495648_0012980_1058_1810 246
148 3300046542 Ga0495597_0039041 Ga0495597_0039041_719_1471 246
149 3300046557 Ga0495622_0014914 Ga0495622_0014914_1253_2005 246
150 3300046660 Ga0495625_0125544 Ga0495625_0125544_756_1508 246
151 3300046665 Ga0495661_0018009 Ga0495661_0018009_210_962 246
152 3300047472 Ga0495686_0033809 Ga0495686_0033809_83_835 246
153 3300048919 Ga0496116_0001913 Ga0496116_0001913_5609_6361 246
154 3300048920 Ga0496117_0107837 Ga0496117_0107837_337_1089 246
155 3300048920 Ga0496117_0176772 Ga0496117_0176772_127_879 246
156 3300048921 Ga0496118_0179234 Ga0496118_0179234_12_764 246
157 3300048923 Ga0496120_0050889 Ga0496120_0050889_458_1210 246
158 3300048924 Ga0496121_0012985 Ga0496121_0012985_1123_1875 246
159 3300048924 Ga0496121_0012991 Ga0496121_0012991_456_1208 246
160 3300048925 Ga0496122_0097437 Ga0496122_0097437_954_1706 246
161 3300048928 Ga0496125_0000040 Ga0496125_0000040_68235_68987 246
162 3300048928 Ga0496125_0010916 Ga0496125_0010916_7216_7968 246
163 3300048929 Ga0496126_0402111 Ga0496126_0402111_92_844 246
164 3300049459 Ga0495678_104845 Ga0495678_104845_98_850 246
165 3300050492 nmdc:mga0yw44_6230_c2 nmdc:mga0yw44_6230_c2_2045_2797 246
166 3300050516 nmdc:mga0sz30_74984_c1 nmdc:mga0sz30_74984_c1_77_829 246
167 3300053086 Ga0500578_0135637 Ga0500578_0135637_148_900 246
168 3300053087 Ga0500643_013175 Ga0500643_013175_398_1150 246
169 3300053088 Ga0500644_0027616 Ga0500644_0027616_776_1528 246
170 3300053088 Ga0500644_0043881 Ga0500644_0043881_380_1132 246
171 3300053094 Ga0500566_0000331 Ga0500566_0000331_19354_20106 246
172 3300053104 Ga0500556_0000069 Ga0500556_0000069_56816_57568 246
173 3300053109 Ga0500569_013753 Ga0500569_013753_309_1061 246
174 3300053117 Ga0500593_097835 Ga0500593_097835_38_790 246
175 3300053122 Ga0500608_001694 Ga0500608_001694_1649_2401 246
176 3300053131 Ga0500652_001281 Ga0500652_001281_5236_5988 246
177 3300053136 Ga0500559_0001458 Ga0500559_0001458_9335_10087 246
178 3300053148 Ga0500590_049893 Ga0500590_049893_505_1257 246
179 3300053153 Ga0500616_0000461 Ga0500616_0000461_8541_9293 246
180 3300053156 Ga0500622_0000602 Ga0500622_0000602_465_1217 246
181 3300053161 Ga0500634_0071635 Ga0500634_0071635_965_1717 246
182 3300053177 Ga0500636_0007566 Ga0500636_0007566_3949_4701 246
183 3300053730 Ga0500645_012726 Ga0500645_012726_1208_1960 246
184 3300005334 Ga0068869_100181402 Ga0068869_1001814022 247
185 3300005338 Ga0068868_100492475 Ga0068868_1004924751 247
186 3300005456 Ga0070678_100308841 Ga0070678_1003088412 247
187 3300005539 Ga0068853_100275655 Ga0068853_1002756552 247
188 3300005548 Ga0070665_100103763 Ga0070665_1001037634 247
189 3300005548 Ga0070665_100328997 Ga0070665_1003289972 247
190 3300005563 Ga0068855_100165838 Ga0068855_1001658384 247
191 3300005564 Ga0070664_100235962 Ga0070664_1002359623 247
192 3300005578 Ga0068854_100105262 Ga0068854_1001052624 247
193 3300005719 Ga0068861_100351246 Ga0068861_1003512462 247
194 3300005937 Ga0081455_10040362 Ga0081455_100403624 247
195 3300005937 Ga0081455_10083231 Ga0081455_100832314 247
196 3300005983 Ga0081540_1001760 Ga0081540_10017609 247
197 3300005983 Ga0081540_1014485 Ga0081540_10144856 247
198 3300006042 Ga0075368_10081227 Ga0075368_100812272 247
199 3300006358 Ga0068871_100190467 Ga0068871_1001904673 247
200 3300009101 Ga0105247_10098555 Ga0105247_100985553 247
201 3300009147 Ga0114129_10042454 Ga0114129_100424546 247
202 3300009148 Ga0105243_10421094 Ga0105243_104210942 247
203 3300009177 Ga0105248_10180880 Ga0105248_101808804 247
204 3300009545 Ga0105237_10115212 Ga0105237_101152124 247
205 3300009551 Ga0105238_10083155 Ga0105238_100831555 247
206 3300010375 Ga0105239_10350304 Ga0105239_103503042 247
207 3300011119 Ga0105246_10118561 Ga0105246_101185612 247
208 3300013296 Ga0157374_10561451 Ga0157374_105614512 247
209 3300013306 Ga0163162_10243654 Ga0163162_102436542 247
210 3300013307 Ga0157372_10428682 Ga0157372_104286822 247
211 3300015261 Ga0182006_1092547 Ga0182006_10925472 247
212 3300025903 Ga0207680_10108586 Ga0207680_101085862 247
213 3300025908 Ga0207643_10073216 Ga0207643_100732162 247
214 3300025927 Ga0207687_10257582 Ga0207687_102575822 247
215 3300025941 Ga0207711_10142170 Ga0207711_101421703 247
216 3300025942 Ga0207689_10045378 Ga0207689_100453785 247
217 3300025981 Ga0207640_10308809 Ga0207640_103088092 247
218 3300026023 Ga0207677_10061957 Ga0207677_100619574 247
219 3300026035 Ga0207703_10034858 Ga0207703_100348582 247
220 3300026041 Ga0207639_10079464 Ga0207639_100794644 247
221 3300026118 Ga0207675_100464261 Ga0207675_1004642612 247
222 3300026142 Ga0207698_10747192 Ga0207698_107471921 247
223 3300031711 Ga0265314_10005447 Ga0265314_100054474 247
224 3300031901 Ga0307406_10484461 Ga0307406_104844611 247
225 3300035117 Ga0373953_0032257 Ga0373953_0032257_555_1331 247
226 3300035119 Ga0373956_0016342 Ga0373956_0016342_2229_3005 247
227 3300035172 Ga0373955_0058087 Ga0373955_0058087_1340_2116 247
228 3300035724 Ga0373933_0016314 Ga0373933_0016314_3284_4060 247
229 3300037471 Ga0395905_0004515 Ga0395905_0004515_5143_5907 247
230 3300038443 Ga0395901_0370210 Ga0395901_0370210_38_802 247
231 3300046459 Ga0495629_0016212 Ga0495629_0016212_2340_3116 247
232 3300046511 Ga0495608_0017348 Ga0495608_0017348_2524_3300 247
233 3300046529 Ga0495652_0023483 Ga0495652_0023483_221_997 247
234 3300046533 Ga0495640_0061328 Ga0495640_0061328_758_1534 247
235 3300046536 Ga0495587_0006060 Ga0495587_0006060_878_1654 247
236 3300046543 Ga0495645_0031198 Ga0495645_0031198_2777_3553 247
237 3300046559 Ga0495667_0031571 Ga0495667_0031571_434_1210 247
238 3300046642 Ga0495634_0033435 Ga0495634_0033435_1297_2073 247
239 3300046663 Ga0495635_0043607 Ga0495635_0043607_1253_2029 247
240 3300046675 Ga0495657_0008675 Ga0495657_0008675_5047_5823 247
241 3300046679 Ga0495623_0011265 Ga0495623_0011265_2669_3445 247
242 3300046680 Ga0495646_0051044 Ga0495646_0051044_306_1082 247
243 3300046689 Ga0495613_0034342 Ga0495613_0034342_2168_2944 247
244 3300047444 Ga0495675_0151883 Ga0495675_0151883_434_1210 247
245 3300047471 Ga0495684_0010530 Ga0495684_0010530_5218_5994 247
246 3300047673 Ga0495593_0031403 Ga0495593_0031403_960_1736 247
247 3300048088 Ga0495602_0033120 Ga0495602_0033120_118_894 247
248 3300048905 Ga0496102_0058766 Ga0496102_0058766_1844_2617 247
249 3300048907 Ga0496104_0018839 Ga0496104_0018839_2581_3354 247
250 3300048909 Ga0496106_0003104 Ga0496106_0003104_7259_8032 247
251 3300048910 Ga0496107_0006959 Ga0496107_0006959_5851_6624 247
252 3300048911 Ga0496108_0002900 Ga0496108_0002900_12145_12918 247
253 3300048912 Ga0496109_0002875 Ga0496109_0002875_710_1483 247
254 3300048912 Ga0496109_0213881 Ga0496109_0213881_693_1457 247
255 3300048913 Ga0496110_0014112 Ga0496110_0014112_1657_2430 247
256 3300048913 Ga0496110_0142471 Ga0496110_0142471_981_1739 247
257 3300048915 Ga0496112_0026862 Ga0496112_0026862_815_1588 247
258 3300048915 Ga0496112_0446735 Ga0496112_0446735_316_1074 247
259 3300048916 Ga0496113_0042681 Ga0496113_0042681_827_1600 247
260 3300048918 Ga0496115_0031524 Ga0496115_0031524_2063_2836 247
261 3300048929 Ga0496126_0039704 Ga0496126_0039704_3107_3874 247
262 3300050493 nmdc:mga0k408_8246_c1 nmdc:mga0k408_8246_c1_4201_4959 247
263 3300050507 nmdc:mga05p37_161675_c1 nmdc:mga05p37_161675_c1_603_1361 247
264 3300053085 Ga0495619_0000557 Ga0495619_0000557_21119_21895 247
265 3300005937 Ga0081455_10174921 Ga0081455_101749212 248
266 3300025915 Ga0207693_10019724 Ga0207693_100197244 248
267 3300028800 Ga0265338_10302683 Ga0265338_103026832 248
268 3300031235 Ga0265330_10034863 Ga0265330_100348634 248
269 3300046462 Ga0495651_0199431 Ga0495651_0199431_492_1265 248
270 3300047472 Ga0495686_0139551 Ga0495686_0139551_322_1080 248
271 3300048924 Ga0496121_0000230 Ga0496121_0000230_115378_116136 248
272 3300053119 Ga0500595_000407 Ga0500595_000407_2134_2892 248
273 3300053139 Ga0500568_0020133 Ga0500568_0020133_863_1621 248
274 3300003215 JGI25153J46596_10003323 JGI25153J46596_100033232 249
275 3300005329 Ga0070683_100002101 Ga0070683_1000021012 249
276 3300005329 Ga0070683_100003746 Ga0070683_1000037464 249
277 3300005336 Ga0070680_100026227 Ga0070680_1000262275 249
278 3300005336 Ga0070680_100041937 Ga0070680_1000419375 249
279 3300005336 Ga0070680_100157997 Ga0070680_1001579972 249
280 3300005339 Ga0070660_100313105 Ga0070660_1003131052 249
281 3300005344 Ga0070661_100142530 Ga0070661_1001425302 249
282 3300005434 Ga0070709_10012949 Ga0070709_100129495 249
283 3300005436 Ga0070713_100016379 Ga0070713_1000163791 249
284 3300005436 Ga0070713_100232989 Ga0070713_1002329892 249
285 3300005437 Ga0070710_10024250 Ga0070710_100242503 249
286 3300005437 Ga0070710_10047236 Ga0070710_100472364 249
287 3300005437 Ga0070710_10063463 Ga0070710_100634634 249
288 3300005439 Ga0070711_100031068 Ga0070711_1000310684 249
289 3300005439 Ga0070711_100268440 Ga0070711_1002684401 249
290 3300005455 Ga0070663_100685642 Ga0070663_1006856421 249
291 3300005458 Ga0070681_10110910 Ga0070681_101109104 249
292 3300005458 Ga0070681_10149452 Ga0070681_101494521 249
293 3300005467 Ga0070706_100228815 Ga0070706_1002288151 249
294 3300005468 Ga0070707_100132939 Ga0070707_1001329393 249
295 3300005530 Ga0070679_100005873 Ga0070679_1000058734 249
296 3300005530 Ga0070679_100027524 Ga0070679_1000275246 249
297 3300005530 Ga0070679_100030562 Ga0070679_1000305624 249
298 3300005530 Ga0070679_100145182 Ga0070679_1001451824 249
299 3300005535 Ga0070684_100054648 Ga0070684_1000546484 249
300 3300005535 Ga0070684_100093310 Ga0070684_1000933104 249
301 3300005535 Ga0070684_100198510 Ga0070684_1001985101 249
302 3300005539 Ga0068853_100559339 Ga0068853_1005593391 249
303 3300005563 Ga0068855_100040685 Ga0068855_1000406857 249
304 3300005563 Ga0068855_100169680 Ga0068855_1001696802 249
305 3300005563 Ga0068855_100349199 Ga0068855_1003491993 249
306 3300005614 Ga0068856_100119855 Ga0068856_1001198554 249
307 3300005614 Ga0068856_100502444 Ga0068856_1005024442 249
308 3300005616 Ga0068852_100740895 Ga0068852_1007408951 249
309 3300005843 Ga0068860_100000081 Ga0068860_100000081130 249
310 3300005983 Ga0081540_1005540 Ga0081540_10055406 249
311 3300005983 Ga0081540_1048993 Ga0081540_10489934 249
312 3300005983 Ga0081540_1134530 Ga0081540_11345301 249
313 3300006028 Ga0070717_10049634 Ga0070717_100496342 249
314 3300006175 Ga0070712_100034839 Ga0070712_1000348393 249
315 3300006175 Ga0070712_100073280 Ga0070712_1000732802 249
316 3300006175 Ga0070712_100278340 Ga0070712_1002783402 249
317 3300006175 Ga0070712_100455498 Ga0070712_1004554982 249
318 3300006237 Ga0097621_100134565 Ga0097621_1001345654 249
319 3300006358 Ga0068871_100031590 Ga0068871_1000315903 249
320 3300006358 Ga0068871_100129359 Ga0068871_1001293592 249
321 3300006881 Ga0068865_100024309 Ga0068865_1000243092 249
322 3300006881 Ga0068865_100181529 Ga0068865_1001815293 249
323 3300006914 Ga0075436_100257481 Ga0075436_1002574812 249
324 3300006941 Ga0099825_1027119 Ga0099825_10271192 249
325 3300006941 Ga0099825_1036202 Ga0099825_10362022 249
326 3300006942 Ga0099824_1008208 Ga0099824_10082086 249
327 3300006944 Ga0099823_1069183 Ga0099823_10691832 249
328 3300007076 Ga0075435_100088546 Ga0075435_1000885463 249
329 3300009093 Ga0105240_10006945 Ga0105240_1000694513 249
330 3300009093 Ga0105240_10074116 Ga0105240_100741165 249
331 3300009093 Ga0105240_10128623 Ga0105240_101286234 249
332 3300009093 Ga0105240_10157827 Ga0105240_101578272 249
333 3300009098 Ga0105245_10041292 Ga0105245_100412925 249
334 3300009098 Ga0105245_10042042 Ga0105245_100420424 249
335 3300009098 Ga0105245_10246306 Ga0105245_102463062 249
336 3300009174 Ga0105241_10145845 Ga0105241_101458454 249
337 3300009177 Ga0105248_11229537 Ga0105248_112295371 249
338 3300009545 Ga0105237_10012502 Ga0105237_100125023 249
339 3300009551 Ga0105238_10415542 Ga0105238_104155422 249
340 3300010375 Ga0105239_10052277 Ga0105239_100522772 249
341 3300010375 Ga0105239_10215656 Ga0105239_102156562 249
342 3300010375 Ga0105239_10229696 Ga0105239_102296964 249
343 3300010375 Ga0105239_10342604 Ga0105239_103426042 249
344 3300011119 Ga0105246_10021797 Ga0105246_100217972 249
345 3300013104 Ga0157370_10030019 Ga0157370_100300196 249
346 3300013105 Ga0157369_10007421 Ga0157369_100074218 249
347 3300013105 Ga0157369_10016145 Ga0157369_100161457 249
348 3300013296 Ga0157374_10021619 Ga0157374_100216194 249
349 3300013297 Ga0157378_10009553 Ga0157378_100095533 249
350 3300013297 Ga0157378_10054478 Ga0157378_100544785 249
351 3300013306 Ga0163162_10067831 Ga0163162_100678313 249
352 3300013307 Ga0157372_10080864 Ga0157372_100808645 249
353 3300013307 Ga0157372_10177241 Ga0157372_101772412 249
354 3300013307 Ga0157372_10314569 Ga0157372_103145692 249
355 3300013308 Ga0157375_10012564 Ga0157375_100125645 249
356 3300014325 Ga0163163_10013378 Ga0163163_100133785 249
357 3300014968 Ga0157379_10084510 Ga0157379_100845102 249
358 3300014969 Ga0157376_10006417 Ga0157376_100064173 249
359 3300017792 Ga0163161_10320706 Ga0163161_103207061 249
360 3300020081 Ga0206354_10458954 Ga0206354_104589542 249
361 3300020082 Ga0206353_12012706 Ga0206353_120127061 249
362 3300021377 Ga0213874_10003010 Ga0213874_100030101 249
363 3300021384 Ga0213876_10059895 Ga0213876_100598954 249
364 3300025253 Ga0209677_100210 Ga0209677_10021018 249
365 3300025254 Ga0209148_1000180 Ga0209148_100018035 249
366 3300025254 Ga0209148_1003954 Ga0209148_10039543 249
367 3300025261 Ga0209233_1001530 Ga0209233_10015306 249
368 3300025261 Ga0209233_1009847 Ga0209233_10098472 249
369 3300025272 Ga0209455_1000620 Ga0209455_100062012 249
370 3300025272 Ga0209455_1007098 Ga0209455_10070982 249
371 3300025297 Ga0209758_1001429 Ga0209758_100142921 249
372 3300025297 Ga0209758_1001880 Ga0209758_100188014 249
373 3300025302 Ga0207426_1000620 Ga0207426_100062032 249
374 3300025321 Ga0207656_10159053 Ga0207656_101590532 249
375 3300025898 Ga0207692_10005492 Ga0207692_100054924 249
376 3300025898 Ga0207692_10060370 Ga0207692_100603704 249
377 3300025900 Ga0207710_10030808 Ga0207710_100308082 249
378 3300025905 Ga0207685_10026343 Ga0207685_100263433 249
379 3300025906 Ga0207699_10034223 Ga0207699_100342234 249
380 3300025906 Ga0207699_10038517 Ga0207699_100385172 249
381 3300025906 Ga0207699_10073848 Ga0207699_100738481 249
382 3300025909 Ga0207705_10118468 Ga0207705_101184682 249
383 3300025910 Ga0207684_10135572 Ga0207684_101355721 249
384 3300025911 Ga0207654_10059170 Ga0207654_100591703 249
385 3300025911 Ga0207654_10146593 Ga0207654_101465932 249
386 3300025912 Ga0207707_10000916 Ga0207707_1000091622 249
387 3300025912 Ga0207707_10051186 Ga0207707_100511864 249
388 3300025912 Ga0207707_10539242 Ga0207707_105392421 249
389 3300025913 Ga0207695_10000008 Ga0207695_10000008733 249
390 3300025913 Ga0207695_10022496 Ga0207695_100224962 249
391 3300025913 Ga0207695_10029844 Ga0207695_100298446 249
392 3300025913 Ga0207695_10054668 Ga0207695_100546685 249
393 3300025913 Ga0207695_10126645 Ga0207695_101266454 249
394 3300025914 Ga0207671_10072463 Ga0207671_100724634 249
395 3300025914 Ga0207671_10077041 Ga0207671_100770414 249
396 3300025914 Ga0207671_10133891 Ga0207671_101338912 249
397 3300025915 Ga0207693_10054006 Ga0207693_100540063 249
398 3300025915 Ga0207693_10298796 Ga0207693_102987962 249
399 3300025916 Ga0207663_10033274 Ga0207663_100332741 249
400 3300025916 Ga0207663_10064826 Ga0207663_100648262 249
401 3300025917 Ga0207660_10021110 Ga0207660_100211102 249
402 3300025917 Ga0207660_10129847 Ga0207660_101298472 249
403 3300025919 Ga0207657_10430182 Ga0207657_104301822 249
404 3300025920 Ga0207649_10091894 Ga0207649_100918941 249
405 3300025920 Ga0207649_10318199 Ga0207649_103181992 249
406 3300025921 Ga0207652_10038672 Ga0207652_100386722 249
407 3300025921 Ga0207652_10069643 Ga0207652_100696434 249
408 3300025921 Ga0207652_10136727 Ga0207652_101367274 249
409 3300025921 Ga0207652_10180742 Ga0207652_101807422 249
410 3300025924 Ga0207694_10073020 Ga0207694_100730202 249
411 3300025924 Ga0207694_10397175 Ga0207694_103971751 249
412 3300025927 Ga0207687_10008249 Ga0207687_100082492 249
413 3300025927 Ga0207687_10271898 Ga0207687_102718982 249
414 3300025928 Ga0207700_10003970 Ga0207700_100039705 249
415 3300025928 Ga0207700_10055560 Ga0207700_100555604 249
416 3300025928 Ga0207700_10057722 Ga0207700_100577222 249
417 3300025929 Ga0207664_10060274 Ga0207664_100602742 249
418 3300025929 Ga0207664_10622983 Ga0207664_106229832 249
419 3300025938 Ga0207704_10235747 Ga0207704_102357471 249
420 3300025939 Ga0207665_10082708 Ga0207665_100827084 249
421 3300025941 Ga0207711_10348564 Ga0207711_103485642 249
422 3300025944 Ga0207661_10002064 Ga0207661_1000206410 249
423 3300025944 Ga0207661_10002496 Ga0207661_100024965 249
424 3300025944 Ga0207661_10341620 Ga0207661_103416201 249
425 3300025944 Ga0207661_10364813 Ga0207661_103648132 249
426 3300025945 Ga0207679_10298706 Ga0207679_102987062 249
427 3300025949 Ga0207667_10018061 Ga0207667_100180619 249
428 3300025949 Ga0207667_10274050 Ga0207667_102740503 249
429 3300025949 Ga0207667_10298458 Ga0207667_102984583 249
430 3300025949 Ga0207667_10612597 Ga0207667_106125972 249
431 3300025981 Ga0207640_10481263 Ga0207640_104812631 249
432 3300026041 Ga0207639_10598686 Ga0207639_105986862 249
433 3300026067 Ga0207678_10041101 Ga0207678_100411012 249
434 3300026078 Ga0207702_10155120 Ga0207702_101551202 249
435 3300026078 Ga0207702_10458614 Ga0207702_104586142 249
436 3300026078 Ga0207702_10565238 Ga0207702_105652382 249
437 3300026118 Ga0207675_100443744 Ga0207675_1004437442 249
438 3300026121 Ga0207683_10010904 Ga0207683_100109045 249
439 3300026142 Ga0207698_10042683 Ga0207698_100426832 249
440 3300026142 Ga0207698_10058662 Ga0207698_100586622 249
441 3300027296 Ga0209389_1000001 Ga0209389_1000001202 249
442 3300027357 Ga0209589_1000014 Ga0209589_1000014138 249
443 3300027361 Ga0209489_100014 Ga0209489_100014138 249
444 3300027361 Ga0209489_119997 Ga0209489_1199972 249
445 3300027363 Ga0209700_100007 Ga0209700_100007222 249
446 3300027363 Ga0209700_100024 Ga0209700_100024138 249
447 3300027512 Ga0209179_1035618 Ga0209179_10356182 249
448 3300028381 Ga0268264_10000048 Ga0268264_10000048122 249
449 3300030521 Ga0307511_10022568 Ga0307511_100225682 249
450 3300031247 Ga0265340_10071372 Ga0265340_100713721 249
451 3300031249 Ga0265339_10016773 Ga0265339_100167733 249
452 3300031507 Ga0307509_10074244 Ga0307509_100742444 249
453 3300031507 Ga0307509_10140206 Ga0307509_101402063 249
454 3300031595 Ga0265313_10114165 Ga0265313_101141651 249
455 3300031616 Ga0307508_10000032 Ga0307508_10000032110 249
456 3300031616 Ga0307508_10076043 Ga0307508_100760433 249
457 3300031711 Ga0265314_10024001 Ga0265314_100240014 249
458 3300033442 Ga0315911_1000002 Ga0315911_1000002190 249
459 3300033544 Ga0316215_1009399 Ga0316215_10093991 249
460 3300035083 Ga0373926_0017225 Ga0373926_0017225_487_1272 249
461 3300035083 Ga0373926_0022939 Ga0373926_0022939_767_1528 249
462 3300035086 Ga0373934_0033956 Ga0373934_0033956_1022_1807 249
463 3300035113 Ga0373936_0003229 Ga0373936_0003229_4039_4824 249
464 3300035113 Ga0373936_0021224 Ga0373936_0021224_1423_2187 249
465 3300035113 Ga0373936_0103265 Ga0373936_0103265_161_925 249
466 3300035116 Ga0373945_0009107 Ga0373945_0009107_1933_2718 249
467 3300035118 Ga0373954_0006338 Ga0373954_0006338_2435_3220 249
468 3300035119 Ga0373956_0011739 Ga0373956_0011739_1691_2476 249
469 3300035170 Ga0373943_0008120 Ga0373943_0008120_3784_4569 249
470 3300035171 Ga0373946_0003292 Ga0373946_0003292_2616_3401 249
471 3300035171 Ga0373946_0159889 Ga0373946_0159889_244_1008 249
472 3300035692 Ga0373935_0007483 Ga0373935_0007483_3830_4591 249
473 3300035692 Ga0373935_0014513 Ga0373935_0014513_2563_3348 249
474 3300035692 Ga0373935_0076609 Ga0373935_0076609_1122_1886 249
475 3300035695 Ga0373927_0005166 Ga0373927_0005166_7762_8523 249
476 3300035695 Ga0373927_0017851 Ga0373927_0017851_225_989 249
477 3300035695 Ga0373927_0020402 Ga0373927_0020402_3468_4229 249
478 3300035695 Ga0373927_0077200 Ga0373927_0077200_1241_2005 249
479 3300035724 Ga0373933_0000406 Ga0373933_0000406_19332_20099 249
480 3300035724 Ga0373933_0096426 Ga0373933_0096426_528_1313 249
481 3300035725 Ga0373947_0110170 Ga0373947_0110170_421_1185 249
482 3300036401 Ga0373937_0146362 Ga0373937_0146362_1195_1980 249
483 3300037068 Ga0373925_0104858 Ga0373925_0104858_45_806 249
484 3300037068 Ga0373925_0177234 Ga0373925_0177234_120_884 249
485 3300037418 Ga0395900_0000948 Ga0395900_0000948_23199_23963 249
486 3300037418 Ga0395900_0048549 Ga0395900_0048549_2080_2865 249
487 3300037466 Ga0395898_0370698 Ga0395898_0370698_406_1191 249
488 3300037853 Ga0436364_0519650 Ga0436364_0519650_1214_1993 249
489 3300039437 Ga0436365_0227213 Ga0436365_0227213_746_1525 249
490 3300039437 Ga0436365_0230691 Ga0436365_0230691_24_821 249
491 3300039437 Ga0436365_1558214 Ga0436365_1558214_932_1699 249
492 3300039437 Ga0436365_1580667 Ga0436365_1580667_4433_5230 249
493 3300039438 Ga0436360_0655438 Ga0436360_0655438_2295_3065 249
494 3300039447 Ga0436361_0216778 Ga0436361_0216778_563_1330 249
495 3300039447 Ga0436361_0248601 Ga0436361_0248601_681_1451 249
496 3300039447 Ga0436361_0785428 Ga0436361_0785428_169_972 249
497 3300039450 Ga0436363_0362302 Ga0436363_0362302_3902_4666 249
498 3300039453 Ga0436362_1193065 Ga0436362_1193065_923_1693 249
499 3300044658 Ga0466972_0001899 Ga0466972_0001899_6255_7019 249
500 3300044683 Ga0466965_0126569 Ga0466965_0126569_449_1213 249
501 3300044683 Ga0466965_0149087 Ga0466965_0149087_396_1184 249
502 3300044684 Ga0466966_0063523 Ga0466966_0063523_1282_2046 249
503 3300044684 Ga0466966_0137292 Ga0466966_0137292_268_1056 249
504 3300044693 Ga0466961_0000050 Ga0466961_0000050_43625_44389 249
505 3300044694 Ga0466963_0156531 Ga0466963_0156531_789_1553 249
506 3300044735 Ga0466968_0079107 Ga0466968_0079107_492_1280 249
507 3300044735 Ga0466968_0095810 Ga0466968_0095810_223_987 249
508 3300044765 Ga0466970_0262392 Ga0466970_0262392_185_955 249
509 3300044842 Ga0466957_0171864 Ga0466957_0171864_509_1273 249
510 3300044901 Ga0466960_0118840 Ga0466960_0118840_300_1064 249
511 3300045049 Ga0466959_0005557 Ga0466959_0005557_6091_6855 249
512 3300045049 Ga0466959_0016947 Ga0466959_0016947_1881_2669 249
513 3300045049 Ga0466959_0270002 Ga0466959_0270002_35_805 249
514 3300045836 Ga0466958_0107646 Ga0466958_0107646_923_1711 249
515 3300045976 Ga0466967_0095054 Ga0466967_0095054_1605_2390 249
516 3300045976 Ga0466967_0132737 Ga0466967_0132737_1179_1943 249
517 3300045976 Ga0466967_0259926 Ga0466967_0259926_552_1316 249
518 3300046454 Ga0495592_0016464 Ga0495592_0016464_2310_3095 249
519 3300046455 Ga0495603_0062365 Ga0495603_0062365_1205_1969 249
520 3300046455 Ga0495603_0306441 Ga0495603_0306441_75_839 249
521 3300046459 Ga0495629_0004164 Ga0495629_0004164_7484_8248 249
522 3300046459 Ga0495629_0316027 Ga0495629_0316027_111_872 249
523 3300046463 Ga0495653_0106668 Ga0495653_0106668_458_1243 249
524 3300046472 Ga0495580_0004514 Ga0495580_0004514_3811_4596 249
525 3300046472 Ga0495580_0410943 Ga0495580_0410943_120_884 249
526 3300046473 Ga0495582_0041115 Ga0495582_0041115_488_1273 249
527 3300046473 Ga0495582_0064270 Ga0495582_0064270_1101_1865 249
528 3300046473 Ga0495582_0099343 Ga0495582_0099343_315_1079 249
529 3300046475 Ga0495639_0004971 Ga0495639_0004971_3955_4740 249
530 3300046477 Ga0495664_0019517 Ga0495664_0019517_2118_2903 249
531 3300046499 Ga0495594_0067294 Ga0495594_0067294_1021_1785 249
532 3300046506 Ga0495583_0074593 Ga0495583_0074593_79_843 249
533 3300046507 Ga0495606_0061638 Ga0495606_0061638_1620_2381 249
534 3300046507 Ga0495606_0138159 Ga0495606_0138159_91_855 249
535 3300046514 Ga0495618_0064109 Ga0495618_0064109_1187_1972 249
536 3300046514 Ga0495618_0135281 Ga0495618_0135281_280_1044 249
537 3300046517 Ga0495630_0061693 Ga0495630_0061693_1038_1823 249
538 3300046518 Ga0495631_0112100 Ga0495631_0112100_234_1004 249
539 3300046526 Ga0495666_0061310 Ga0495666_0061310_976_1761 249
540 3300046529 Ga0495652_0063455 Ga0495652_0063455_1860_2645 249
541 3300046529 Ga0495652_0221291 Ga0495652_0221291_627_1391 249
542 3300046531 Ga0495665_0012269 Ga0495665_0012269_3530_4315 249
543 3300046533 Ga0495640_0029778 Ga0495640_0029778_2078_2863 249
544 3300046533 Ga0495640_0031288 Ga0495640_0031288_491_1255 249
545 3300046536 Ga0495587_0112409 Ga0495587_0112409_303_1088 249
546 3300046543 Ga0495645_0093671 Ga0495645_0093671_1311_2096 249
547 3300046543 Ga0495645_0146919 Ga0495645_0146919_172_960 249
548 3300046559 Ga0495667_0068906 Ga0495667_0068906_1193_1978 249
549 3300046663 Ga0495635_0001219 Ga0495635_0001219_16022_16786 249
550 3300046663 Ga0495635_0010817 Ga0495635_0010817_686_1471 249
551 3300046675 Ga0495657_0023046 Ga0495657_0023046_134_898 249
552 3300046683 Ga0495658_0024424 Ga0495658_0024424_1396_2181 249
553 3300046683 Ga0495658_0061147 Ga0495658_0061147_1295_2056 249
554 3300046689 Ga0495613_0054981 Ga0495613_0054981_1769_2554 249
555 3300046690 Ga0495624_0034608 Ga0495624_0034608_2118_2903 249
556 3300046690 Ga0495624_0039263 Ga0495624_0039263_2211_2975 249
557 3300046690 Ga0495624_0188699 Ga0495624_0188699_182_946 249
558 3300046694 Ga0495649_0079714 Ga0495649_0079714_424_1188 249
559 3300047315 Ga0495581_0021847 Ga0495581_0021847_2469_3233 249
560 3300047315 Ga0495581_0043324 Ga0495581_0043324_1596_2381 249
561 3300047315 Ga0495581_0151367 Ga0495581_0151367_385_1146 249
562 3300047317 Ga0495604_0314615 Ga0495604_0314615_241_1026 249
563 3300047319 Ga0495674_0216183 Ga0495674_0216183_641_1405 249
564 3300047319 Ga0495674_0413141 Ga0495674_0413141_270_1037 249
565 3300047319 Ga0495674_0589442 Ga0495674_0589442_16_780 249
566 3300047320 Ga0495672_0145806 Ga0495672_0145806_17_778 249
567 3300047321 Ga0495676_0184673 Ga0495676_0184673_299_1063 249
568 3300047471 Ga0495684_0019701 Ga0495684_0019701_2982_3767 249
569 3300047673 Ga0495593_0028308 Ga0495593_0028308_2240_3025 249
570 3300047673 Ga0495593_0042204 Ga0495593_0042204_97_861 249
571 3300048088 Ga0495602_0286678 Ga0495602_0286678_45_806 249
572 3300048903 Ga0496100_0089884 Ga0496100_0089884_155_919 249
573 3300048903 Ga0496100_0262968 Ga0496100_0262968_465_1229 249
574 3300048903 Ga0496100_0405975 Ga0496100_0405975_66_830 249
575 3300048903 Ga0496100_0487555 Ga0496100_0487555_66_830 249
576 3300048904 Ga0496101_0075626 Ga0496101_0075626_1298_2062 249
577 3300048904 Ga0496101_0148703 Ga0496101_0148703_754_1518 249
578 3300048905 Ga0496102_0114298 Ga0496102_0114298_1235_1999 249
579 3300048905 Ga0496102_0146084 Ga0496102_0146084_656_1420 249
580 3300048905 Ga0496102_0585047 Ga0496102_0585047_110_874 249
581 3300048906 Ga0496103_0020025 Ga0496103_0020025_463_1227 249
582 3300048907 Ga0496104_0098246 Ga0496104_0098246_1941_2705 249
583 3300048908 Ga0496105_0016130 Ga0496105_0016130_2646_3410 249
584 3300048908 Ga0496105_0063988 Ga0496105_0063988_485_1249 249
585 3300048909 Ga0496106_0000240 Ga0496106_0000240_29625_30386 249
586 3300048910 Ga0496107_0050244 Ga0496107_0050244_1209_1973 249
587 3300048911 Ga0496108_0015092 Ga0496108_0015092_4766_5530 249
588 3300048913 Ga0496110_0034780 Ga0496110_0034780_3036_3800 249
589 3300048914 Ga0496111_0101097 Ga0496111_0101097_590_1354 249
590 3300048915 Ga0496112_0004764 Ga0496112_0004764_2477_3241 249
591 3300048915 Ga0496112_0661452 Ga0496112_0661452_97_873 249
592 3300048916 Ga0496113_0005360 Ga0496113_0005360_2790_3554 249
593 3300048916 Ga0496113_0183206 Ga0496113_0183206_551_1315 249
594 3300048916 Ga0496113_0439440 Ga0496113_0439440_73_849 249
595 3300048917 Ga0496114_0066871 Ga0496114_0066871_1760_2524 249
596 3300048917 Ga0496114_0286060 Ga0496114_0286060_592_1356 249
597 3300048917 Ga0496114_0684180 Ga0496114_0684180_79_843 249
598 3300048918 Ga0496115_0004354 Ga0496115_0004354_666_1430 249
599 3300048918 Ga0496115_0365512 Ga0496115_0365512_119_883 249
600 3300048918 Ga0496115_0394969 Ga0496115_0394969_245_1009 249
601 3300048920 Ga0496117_0059196 Ga0496117_0059196_1139_1900 249
602 3300048920 Ga0496117_0272441 Ga0496117_0272441_11_781 249
603 3300048921 Ga0496118_0014922 Ga0496118_0014922_4949_5710 249
604 3300048921 Ga0496118_0036957 Ga0496118_0036957_1391_2161 249
605 3300048921 Ga0496118_0137954 Ga0496118_0137954_16_780 249
606 3300048922 Ga0496119_0007401 Ga0496119_0007401_6407_7171 249
607 3300048922 Ga0496119_0053987 Ga0496119_0053987_1646_2407 249
608 3300048923 Ga0496120_0042313 Ga0496120_0042313_456_1220 249
609 3300048924 Ga0496121_0004398 Ga0496121_0004398_13510_14271 249
610 3300048924 Ga0496121_0080720 Ga0496121_0080720_865_1650 249
611 3300048924 Ga0496121_0195417 Ga0496121_0195417_16_786 249
612 3300048925 Ga0496122_0060463 Ga0496122_0060463_216_980 249
613 3300048928 Ga0496125_0057016 Ga0496125_0057016_281_1045 249
614 3300048928 Ga0496125_0063668 Ga0496125_0063668_1927_2694 249
615 3300048928 Ga0496125_0072103 Ga0496125_0072103_1827_2597 249
616 3300048928 Ga0496125_0115698 Ga0496125_0115698_272_1033 249
617 3300048929 Ga0496126_0005072 Ga0496126_0005072_2641_3405 249
618 3300048929 Ga0496126_0007510 Ga0496126_0007510_4429_5193 249
619 3300048929 Ga0496126_0096139 Ga0496126_0096139_926_1690 249
620 3300048929 Ga0496126_0104813 Ga0496126_0104813_1456_2220 249
621 3300048929 Ga0496126_0124793 Ga0496126_0124793_937_1698 249
622 3300048929 Ga0496126_0218933 Ga0496126_0218933_39_800 249
623 3300048929 Ga0496126_0250775 Ga0496126_0250775_229_990 249
624 3300048929 Ga0496126_0360391 Ga0496126_0360391_369_1145 249
625 3300049568 Ga0501031_0001217 Ga0501031_0001217_6126_6887 249
626 3300049569 Ga0501032_0011357 Ga0501032_0011357_4894_5655 249
627 3300049569 Ga0501032_0028163 Ga0501032_0028163_610_1371 249
628 3300049569 Ga0501032_0036558 Ga0501032_0036558_2463_3224 249
629 3300049570 Ga0501033_0000667 Ga0501033_0000667_11092_11853 249
630 3300049570 Ga0501033_0004962 Ga0501033_0004962_5934_6695 249
631 3300049570 Ga0501033_0039325 Ga0501033_0039325_971_1732 249
632 3300049571 Ga0501034_0001924 Ga0501034_0001924_14458_15219 249
633 3300049571 Ga0501034_0163614 Ga0501034_0163614_129_890 249
634 3300049572 Ga0501036_0001359 Ga0501036_0001359_11084_11845 249
635 3300049572 Ga0501036_0077813 Ga0501036_0077813_36_797 249
636 3300049573 Ga0501037_0000715 Ga0501037_0000715_14850_15611 249
637 3300049573 Ga0501037_0068347 Ga0501037_0068347_1398_2159 249
638 3300049574 Ga0501038_0000342 Ga0501038_0000342_2400_3161 249
639 3300049574 Ga0501038_0021064 Ga0501038_0021064_5007_5768 249
640 3300049575 Ga0501039_0001565 Ga0501039_0001565_10778_11539 249
641 3300049575 Ga0501039_0032158 Ga0501039_0032158_1990_2751 249
642 3300049575 Ga0501039_0132064 Ga0501039_0132064_1075_1836 249
643 3300049576 Ga0501040_0020439 Ga0501040_0020439_328_1089 249
644 3300049578 Ga0501042_0021464 Ga0501042_0021464_2439_3200 249
645 3300049579 Ga0501043_0000120 Ga0501043_0000120_63802_64563 249
646 3300049579 Ga0501043_0003554 Ga0501043_0003554_2467_3228 249
647 3300049580 Ga0501046_0001506 Ga0501046_0001506_13387_14148 249
648 3300049580 Ga0501046_0082098 Ga0501046_0082098_707_1468 249
649 3300049581 Ga0501047_0000697 Ga0501047_0000697_28114_28875 249
650 3300049581 Ga0501047_0008066 Ga0501047_0008066_4647_5408 249
651 3300049581 Ga0501047_0033590 Ga0501047_0033590_1118_1900 249
652 3300049581 Ga0501047_0095041 Ga0501047_0095041_1064_1825 249
653 3300049581 Ga0501047_0440625 Ga0501047_0440625_157_921 249
654 3300049582 Ga0501048_0000288 Ga0501048_0000288_11170_11931 249
655 3300049582 Ga0501048_0014507 Ga0501048_0014507_4778_5539 249
656 3300049583 Ga0501067_0000682 Ga0501067_0000682_14344_15105 249
657 3300049583 Ga0501067_0074226 Ga0501067_0074226_707_1468 249
658 3300049584 Ga0501068_0124562 Ga0501068_0124562_421_1182 249
659 3300049586 Ga0501070_0003047 Ga0501070_0003047_11092_11853 249
660 3300049586 Ga0501070_0150319 Ga0501070_0150319_582_1343 249
661 3300049586 Ga0501070_0237769 Ga0501070_0237769_325_1086 249
662 3300049588 Ga0501072_0000936 Ga0501072_0000936_5156_5917 249
663 3300049589 Ga0501073_0000091 Ga0501073_0000091_45177_45938 249
664 3300049589 Ga0501073_0073507 Ga0501073_0073507_1213_1974 249
665 3300049590 Ga0501074_0004116 Ga0501074_0004116_7676_8437 249
666 3300049592 Ga0501076_0049798 Ga0501076_0049798_1782_2543 249
667 3300049741 Ga0501079_0001942 Ga0501079_0001942_11947_12708 249
668 3300049741 Ga0501079_0042558 Ga0501079_0042558_2167_2928 249
669 3300049742 Ga0501080_0007154 Ga0501080_0007154_6911_7672 249
670 3300049742 Ga0501080_0059524 Ga0501080_0059524_73_855 249
671 3300049744 Ga0501083_0000470 Ga0501083_0000470_19491_20252 249
672 3300049744 Ga0501083_0080926 Ga0501083_0080926_1074_1835 249
673 3300049822 Ga0501035_0000452 Ga0501035_0000452_29323_30084 249
674 3300049822 Ga0501035_0126221 Ga0501035_0126221_1056_1817 249
675 3300049823 Ga0501044_0000274 Ga0501044_0000274_15838_16599 249
676 3300049823 Ga0501044_0081070 Ga0501044_0081070_1036_1797 249
677 3300049823 Ga0501044_0114224 Ga0501044_0114224_420_1181 249
678 3300049823 Ga0501044_0200130 Ga0501044_0200130_766_1548 249
679 3300049823 Ga0501044_0365053 Ga0501044_0365053_537_1298 249
680 3300053077 Ga0495601_0062094 Ga0495601_0062094_1316_2101 249
681 3300053077 Ga0495601_0120162 Ga0495601_0120162_352_1140 249
682 3300053078 Ga0495612_0004388 Ga0495612_0004388_3108_3893 249
683 3300053080 Ga0500635_0002076 Ga0500635_0002076_4118_4879 249
684 3300053091 Ga0500647_0024301 Ga0500647_0024301_1873_2637 249
685 3300053094 Ga0500566_0001048 Ga0500566_0001048_13157_13921 249
686 3300053094 Ga0500566_0021105 Ga0500566_0021105_402_1166 249
687 3300053094 Ga0500566_0152949 Ga0500566_0152949_65_829 249
688 3300053095 Ga0500640_000214 Ga0500640_000214_7964_8728 249
689 3300053097 Ga0500648_202869 Ga0500648_202869_195_956 249
690 3300053111 Ga0500572_000025 Ga0500572_000025_17817_18581 249
691 3300053111 Ga0500572_000175 Ga0500572_000175_3067_3831 249
692 3300053115 Ga0500591_053485 Ga0500591_053485_957_1721 249
693 3300053119 Ga0500595_000715 Ga0500595_000715_4696_5460 249
694 3300053119 Ga0500595_015655 Ga0500595_015655_587_1351 249
695 3300053122 Ga0500608_006744 Ga0500608_006744_783_1547 249
696 3300053123 Ga0500614_001781 Ga0500614_001781_942_1706 249
697 3300053136 Ga0500559_0000289 Ga0500559_0000289_27390_28154 249
698 3300053136 Ga0500559_0021044 Ga0500559_0021044_880_1641 249
699 3300053136 Ga0500559_0028447 Ga0500559_0028447_850_1614 249
700 3300053140 Ga0500573_0025499 Ga0500573_0025499_1064_1825 249
701 3300053150 Ga0500603_002027 Ga0500603_002027_1033_1797 249
702 3300053159 Ga0500630_000213 Ga0500630_000213_1722_2486 249
703 3300053162 Ga0500638_001677 Ga0500638_001677_5890_6666 249
704 3300053163 Ga0500639_000239 Ga0500639_000239_9403_10167 249
705 3300053163 Ga0500639_006810 Ga0500639_006810_3059_3823 249
706 3300053177 Ga0500636_0047846 Ga0500636_0047846_1078_1845 249
707 3300053177 Ga0500636_0085360 Ga0500636_0085360_450_1211 249
708 3300053178 Ga0500637_0000265 Ga0500637_0000265_15473_16237 249
709 3300053178 Ga0500637_0060102 Ga0500637_0060102_460_1236 249
710 3300053735 Ga0500596_002172 Ga0500596_002172_1690_2451 249
711 3300054114 Ga0501084_0004871 Ga0501084_0004871_5189_5950 249
712 3300055283 Ga0500661_003010 Ga0500661_003010_283_1047 249
713 3300060353 Ga0501082_0041409 Ga0501082_0041409_1935_2696 249
714 3300060353 Ga0501082_0167518 Ga0501082_0167518_892_1653 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

3

37

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t3b-assembly1.cif.gz_G gator1-rag-ragulator - gap complex 0.8099 201 239
3hug-assembly6.cif.gz_P crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8029 6 54
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.7831 8 55
3l7h-assembly1.cif.gz_A insights into dynein assembly from a dynein intermediate chain light chain roadblock structure 0.7802 201 224
7uxh-assembly1.cif.gz_Y cryo-em structure of the mtorc1-tfeb-rag-ragulator complex 0.7694 201 239
ID Description Score Start End Superfamily
3hugP00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.8029 6 54 1.10.10.1320
af_Q4D9D6_71_184_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7976 200 224 3.30.450.50
af_Q54F59_1_120_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7969 201 227 3.30.450.30
af_A0A1D5RLS7_1_125_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.7936 200 228 3.30.450.50
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.7831 8 55 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A4R6CQM4-F1-model_v4 Anti-sigma factor 0.977 160 249
AF-A0A531M551-F1-model_v4 Anti-sigma factor 0.9744 158 243
AF-A0A2V8TLS2-F1-model_v4 Anti-sigma factor 0.9613 114 237
AF-A0A4R6CQM4-F1-model_v4 Anti-sigma factor 0.9562 160 249
AF-A0A538RRT3-F1-model_v4 Anti-sigma factor 0.9541 154 242

Feature Viewer

pLDDT pTM Quality
67.04 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map