F476919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 714 | 410 | 628 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300003323|rootH1_10005224|rootH1_100052241 |
| Length | 249 |
| Sequence | MTCDEARIMLHALLDGELDAGHAREVEAHIAGCADCAAEFAAQRQMQRVLADTNLRYAAPASLRNKIEASLPKAQPQPSRRSVLRGFAMGSAVSALAATGIVAVVLRQDDQQRILSEVVSAHLRSLQAGHLIDVVSTDXWFNGKLDVAPPVIDLTAQGFTLVGGRLDYIDARAIGAVVYKRRQHVINLFVAQTSSTEHRAPKTQTMQGFNCRRWGERGLNFWAVSDIGADELAEFVDKFEAAMKANVEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 8 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 9 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 10 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 11 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 12 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 13 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 14 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 15 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 16 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 17 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 18 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 19 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 20 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 21 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 22 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 23 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 24 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 25 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 26 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 27 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 28 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 29 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 30 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 31 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 32 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 33 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 34 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 35 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 36 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 37 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 38 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 39 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 40 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 41 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 42 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 43 | 2904699407 | |||
| 44 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 45 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 46 | 2906610324 | |||
| 47 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 48 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 49 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 50 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 51 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 52 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 53 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 54 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 55 | 2922425934 | |||
| 56 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 57 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 58 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 59 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 60 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 61 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 62 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 63 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 64 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 65 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 66 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 67 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 68 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 69 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 70 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 71 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 72 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 73 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 74 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 75 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 76 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 77 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 78 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 79 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 80 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 81 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 83 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 85 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 98 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 114 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 122 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 123 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 214 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 230 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 235 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 236 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 248 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 249 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 310 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 314 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 319 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 320 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 321 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 324 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 325 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 326 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 327 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 328 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 329 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 330 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 331 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 332 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 360 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 374 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 375 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 376 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 377 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 378 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 379 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 382 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 383 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 384 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 386 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 387 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 388 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 390 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 391 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 393 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 399 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 403 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 404 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 405 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 406 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 407 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 408 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 409 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 410 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.9 |
| Metatranscriptomes | 0.28 |
| Isolates | 11.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.8 |
| Nodule | 9.24 |
| Rhizoplane | 6.3 |
| Rhizosphere | 62.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10003323 | 3300003215 | Bacteria | 9041 |
| 2 | JGI25153J46596_10015142 | 3300003215 | Bacteria | 3161 |
| 3 | rootH1_10005224 | 3300003316 | Bacteria | 2924 |
| 4 | rootH1_10005224 | 3300003323 | Bacteria | 1116 |
| 5 | Ga0070683_100002101 | 3300005329 | Bacteria | 15736 |
| 6 | Ga0070683_100003746 | 3300005329 | Bacteria | 12404 |
| 7 | Ga0068869_100181402 | 3300005334 | Bacteria | 1650 |
| 8 | Ga0070680_100026227 | 3300005336 | Bacteria | 4660 |
| 9 | Ga0070680_100041937 | 3300005336 | Bacteria | 3711 |
| 10 | Ga0070680_100157997 | 3300005336 | Bacteria | 1905 |
| 11 | Ga0068868_100492475 | 3300005338 | Bacteria | 1072 |
| 12 | Ga0070660_100313105 | 3300005339 | Bacteria | 1288 |
| 13 | Ga0070661_100142530 | 3300005344 | Bacteria | 1807 |
| 14 | Ga0070709_10000980 | 3300005434 | Bacteria | 15831 |
| 15 | Ga0070709_10012949 | 3300005434 | Bacteria | 4678 |
| 16 | Ga0070714_100014017 | 3300005435 | Bacteria | 6431 |
| 17 | Ga0070713_100016044 | 3300005436 | Bacteria | 5624 |
| 18 | Ga0070713_100016379 | 3300005436 | Bacteria | 5574 |
| 19 | Ga0070713_100232989 | 3300005436 | Bacteria | 1674 |
| 20 | Ga0070710_10001038 | 3300005437 | Bacteria | 13188 |
| 21 | Ga0070710_10024250 | 3300005437 | Bacteria | 3198 |
| 22 | Ga0070710_10047236 | 3300005437 | Bacteria | 2400 |
| 23 | Ga0070710_10063463 | 3300005437 | Bacteria | 2110 |
| 24 | Ga0070711_100025185 | 3300005439 | Bacteria | 3889 |
| 25 | Ga0070711_100031068 | 3300005439 | Bacteria | 3542 |
| 26 | Ga0070711_100268440 | 3300005439 | Bacteria | 1345 |
| 27 | Ga0070663_100685642 | 3300005455 | Bacteria | 870 |
| 28 | Ga0070678_100308841 | 3300005456 | Bacteria | 1346 |
| 29 | Ga0070681_10110910 | 3300005458 | Bacteria | 2683 |
| 30 | Ga0070681_10149452 | 3300005458 | Bacteria | 2263 |
| 31 | Ga0070706_100228815 | 3300005467 | Bacteria | 1736 |
| 32 | Ga0070707_100132939 | 3300005468 | Bacteria | 2420 |
| 33 | Ga0070679_100005873 | 3300005530 | Bacteria | 11399 |
| 34 | Ga0070679_100027524 | 3300005530 | Bacteria | 5597 |
| 35 | Ga0070679_100030562 | 3300005530 | Bacteria | 5317 |
| 36 | Ga0070679_100145182 | 3300005530 | Bacteria | 2351 |
| 37 | Ga0070684_100054648 | 3300005535 | Bacteria | 3479 |
| 38 | Ga0070684_100093310 | 3300005535 | Bacteria | 2679 |
| 39 | Ga0070684_100198510 | 3300005535 | Bacteria | 1827 |
| 40 | Ga0068853_100275655 | 3300005539 | Bacteria | 1550 |
| 41 | Ga0068853_100559339 | 3300005539 | Bacteria | 1084 |
| 42 | Ga0070665_100103763 | 3300005548 | Bacteria | 2846 |
| 43 | Ga0070665_100328997 | 3300005548 | Bacteria | 1532 |
| 44 | Ga0068855_100040685 | 3300005563 | Bacteria | 5515 |
| 45 | Ga0068855_100165838 | 3300005563 | Bacteria | 2504 |
| 46 | Ga0068855_100169680 | 3300005563 | Bacteria | 2472 |
| 47 | Ga0068855_100349199 | 3300005563 | Bacteria | 1630 |
| 48 | Ga0070664_100235962 | 3300005564 | Bacteria | 1641 |
| 49 | Ga0068857_100524382 | 3300005577 | Bacteria | 1114 |
| 50 | Ga0068854_100105262 | 3300005578 | Bacteria | 2121 |
| 51 | Ga0068856_100119855 | 3300005614 | Bacteria | 2633 |
| 52 | Ga0068856_100263946 | 3300005614 | Bacteria | 1738 |
| 53 | Ga0068856_100502444 | 3300005614 | Bacteria | 1234 |
| 54 | Ga0068852_100740895 | 3300005616 | Bacteria | 994 |
| 55 | Ga0068861_100351246 | 3300005719 | Bacteria | 1293 |
| 56 | Ga0068860_100000081 | 3300005843 | Bacteria | 170066 |
| 57 | Ga0081455_10040362 | 3300005937 | Bacteria | 4116 |
| 58 | Ga0081455_10083231 | 3300005937 | Bacteria | 2615 |
| 59 | Ga0081455_10174921 | 3300005937 | Bacteria | 1631 |
| 60 | Ga0081540_1001760 | 3300005983 | Bacteria | 18218 |
| 61 | Ga0081540_1005540 | 3300005983 | Bacteria | 9406 |
| 62 | Ga0081540_1014485 | 3300005983 | Bacteria | 5046 |
| 63 | Ga0081540_1048993 | 3300005983 | Bacteria | 2111 |
| 64 | Ga0081540_1134530 | 3300005983 | Bacteria | 1003 |
| 65 | Ga0070717_10049634 | 3300006028 | Bacteria | 3445 |
| 66 | Ga0070717_10348019 | 3300006028 | Bacteria | 1324 |
| 67 | Ga0075368_10081227 | 3300006042 | Bacteria | 1319 |
| 68 | Ga0070716_100012668 | 3300006173 | Bacteria | 4279 |
| 69 | Ga0070712_100010019 | 3300006175 | Bacteria | 5973 |
| 70 | Ga0070712_100034839 | 3300006175 | Bacteria | 3413 |
| 71 | Ga0070712_100073280 | 3300006175 | Bacteria | 2456 |
| 72 | Ga0070712_100278340 | 3300006175 | Bacteria | 1347 |
| 73 | Ga0070712_100455498 | 3300006175 | Bacteria | 1066 |
| 74 | Ga0075367_10120568 | 3300006178 | Bacteria | 1616 |
| 75 | Ga0075369_10051341 | 3300006186 | Bacteria | 1785 |
| 76 | Ga0097621_100134565 | 3300006237 | Bacteria | 2107 |
| 77 | Ga0068871_100031590 | 3300006358 | Bacteria | 4177 |
| 78 | Ga0068871_100129359 | 3300006358 | Bacteria | 2139 |
| 79 | Ga0068871_100190467 | 3300006358 | Bacteria | 1767 |
| 80 | Ga0068865_100024309 | 3300006881 | Bacteria | 3974 |
| 81 | Ga0068865_100181529 | 3300006881 | Bacteria | 1621 |
| 82 | Ga0075436_100257481 | 3300006914 | Bacteria | 1244 |
| 83 | Ga0099825_1027119 | 3300006941 | Bacteria | 2958 |
| 84 | Ga0099825_1036202 | 3300006941 | Bacteria | 1714 |
| 85 | Ga0099824_1008208 | 3300006942 | Bacteria | 13453 |
| 86 | Ga0099823_1069183 | 3300006944 | Bacteria | 1609 |
| 87 | Ga0075435_100088546 | 3300007076 | Bacteria | 2552 |
| 88 | Ga0105240_10006945 | 3300009093 | Bacteria | 16535 |
| 89 | Ga0105240_10074116 | 3300009093 | Bacteria | 4202 |
| 90 | Ga0105240_10128623 | 3300009093 | Bacteria | 3041 |
| 91 | Ga0105240_10157827 | 3300009093 | Bacteria | 2697 |
| 92 | Ga0105245_10041292 | 3300009098 | Bacteria | 4112 |
| 93 | Ga0105245_10042042 | 3300009098 | Bacteria | 4076 |
| 94 | Ga0105245_10246306 | 3300009098 | Bacteria | 1735 |
| 95 | Ga0105247_10098555 | 3300009101 | Bacteria | 1866 |
| 96 | Ga0114129_10042454 | 3300009147 | Bacteria | 6404 |
| 97 | Ga0105243_10421094 | 3300009148 | Bacteria | 1246 |
| 98 | Ga0105241_10145845 | 3300009174 | Bacteria | 1931 |
| 99 | Ga0105248_10180880 | 3300009177 | Bacteria | 2376 |
| 100 | Ga0105248_11229537 | 3300009177 | Bacteria | 847 |
| 101 | Ga0105237_10012502 | 3300009545 | Bacteria | 8943 |
| 102 | Ga0105237_10097272 | 3300009545 | Bacteria | 2934 |
| 103 | Ga0105237_10115212 | 3300009545 | Bacteria | 2681 |
| 104 | Ga0105238_10083155 | 3300009551 | Bacteria | 3191 |
| 105 | Ga0105238_10415542 | 3300009551 | Bacteria | 1339 |
| 106 | Ga0105239_10052277 | 3300010375 | Bacteria | 4480 |
| 107 | Ga0105239_10215656 | 3300010375 | Bacteria | 2152 |
| 108 | Ga0105239_10229696 | 3300010375 | Bacteria | 2082 |
| 109 | Ga0105239_10342604 | 3300010375 | Bacteria | 1687 |
| 110 | Ga0105239_10350304 | 3300010375 | Bacteria | 1667 |
| 111 | Ga0105246_10021797 | 3300011119 | Bacteria | 4127 |
| 112 | Ga0105246_10118561 | 3300011119 | Bacteria | 1957 |
| 113 | Ga0157370_10030019 | 3300013104 | Bacteria | 5328 |
| 114 | Ga0157369_10007421 | 3300013105 | Bacteria | 12626 |
| 115 | Ga0157369_10016145 | 3300013105 | Bacteria | 8405 |
| 116 | Ga0157374_10021619 | 3300013296 | Bacteria | 5729 |
| 117 | Ga0157374_10561451 | 3300013296 | Bacteria | 1150 |
| 118 | Ga0157378_10009553 | 3300013297 | Bacteria | 8447 |
| 119 | Ga0157378_10054478 | 3300013297 | Bacteria | 3561 |
| 120 | Ga0163162_10067831 | 3300013306 | Bacteria | 3618 |
| 121 | Ga0163162_10243654 | 3300013306 | Bacteria | 1929 |
| 122 | Ga0157372_10080864 | 3300013307 | Bacteria | 3677 |
| 123 | Ga0157372_10177241 | 3300013307 | Bacteria | 2467 |
| 124 | Ga0157372_10314569 | 3300013307 | Bacteria | 1823 |
| 125 | Ga0157372_10428682 | 3300013307 | Bacteria | 1541 |
| 126 | Ga0157375_10012564 | 3300013308 | Bacteria | 7516 |
| 127 | Ga0163163_10013378 | 3300014325 | Bacteria | 7511 |
| 128 | Ga0157379_10084510 | 3300014968 | Bacteria | 2844 |
| 129 | Ga0157376_10006417 | 3300014969 | Bacteria | 8309 |
| 130 | Ga0182006_1092547 | 3300015261 | Bacteria | 1085 |
| 131 | Ga0163161_10320706 | 3300017792 | Bacteria | 1225 |
| 132 | Ga0206354_10458954 | 3300020081 | Bacteria | 1636 |
| 133 | Ga0206353_12012706 | 3300020082 | Bacteria | 1456 |
| 134 | Ga0213874_10003010 | 3300021377 | Bacteria | 3695 |
| 135 | Ga0213876_10003065 | 3300021384 | Bacteria | 9662 |
| 136 | Ga0213876_10059895 | 3300021384 | Bacteria | 2009 |
| 137 | Ga0209677_100210 | 3300025253 | Bacteria | 44738 |
| 138 | Ga0209677_105160 | 3300025253 | Bacteria | 3496 |
| 139 | Ga0209148_1000180 | 3300025254 | Bacteria | 124830 |
| 140 | Ga0209148_1003954 | 3300025254 | Bacteria | 3812 |
| 141 | Ga0209233_1001530 | 3300025261 | Bacteria | 9065 |
| 142 | Ga0209233_1009847 | 3300025261 | Bacteria | 2890 |
| 143 | Ga0209455_1000620 | 3300025272 | Bacteria | 22265 |
| 144 | Ga0209455_1007098 | 3300025272 | Bacteria | 3208 |
| 145 | Ga0209758_1000133 | 3300025297 | Bacteria | 182442 |
| 146 | Ga0209758_1001429 | 3300025297 | Bacteria | 28224 |
| 147 | Ga0209758_1001880 | 3300025297 | Bacteria | 22994 |
| 148 | Ga0209758_1047180 | 3300025297 | Bacteria | 1545 |
| 149 | Ga0207426_1000620 | 3300025302 | Bacteria | 45305 |
| 150 | Ga0207656_10159053 | 3300025321 | Bacteria | 1074 |
| 151 | Ga0207692_10001278 | 3300025898 | Bacteria | 9337 |
| 152 | Ga0207692_10005492 | 3300025898 | Bacteria | 5083 |
| 153 | Ga0207692_10060370 | 3300025898 | Bacteria | 1961 |
| 154 | Ga0207710_10030808 | 3300025900 | Bacteria | 2342 |
| 155 | Ga0207680_10108586 | 3300025903 | Bacteria | 1795 |
| 156 | Ga0207685_10026343 | 3300025905 | Bacteria | 2021 |
| 157 | Ga0207699_10011463 | 3300025906 | Bacteria | 4478 |
| 158 | Ga0207699_10034223 | 3300025906 | Bacteria | 2879 |
| 159 | Ga0207699_10038517 | 3300025906 | Bacteria | 2741 |
| 160 | Ga0207699_10073848 | 3300025906 | Bacteria | 2093 |
| 161 | Ga0207643_10073216 | 3300025908 | Bacteria | 1974 |
| 162 | Ga0207705_10118468 | 3300025909 | Bacteria | 1962 |
| 163 | Ga0207684_10135572 | 3300025910 | Bacteria | 2114 |
| 164 | Ga0207654_10059170 | 3300025911 | Bacteria | 2233 |
| 165 | Ga0207654_10146593 | 3300025911 | Bacteria | 1511 |
| 166 | Ga0207707_10000916 | 3300025912 | Bacteria | 28696 |
| 167 | Ga0207707_10051186 | 3300025912 | Bacteria | 3597 |
| 168 | Ga0207707_10539242 | 3300025912 | Bacteria | 992 |
| 169 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 170 | Ga0207695_10022496 | 3300025913 | Bacteria | 7152 |
| 171 | Ga0207695_10029844 | 3300025913 | Bacteria | 6016 |
| 172 | Ga0207695_10054668 | 3300025913 | Bacteria | 4167 |
| 173 | Ga0207695_10126645 | 3300025913 | Bacteria | 2515 |
| 174 | Ga0207671_10072463 | 3300025914 | Bacteria | 2571 |
| 175 | Ga0207671_10077041 | 3300025914 | Bacteria | 2496 |
| 176 | Ga0207671_10133891 | 3300025914 | Bacteria | 1904 |
| 177 | Ga0207693_10006620 | 3300025915 | Bacteria | 9572 |
| 178 | Ga0207693_10019724 | 3300025915 | Bacteria | 5361 |
| 179 | Ga0207693_10054006 | 3300025915 | Bacteria | 3152 |
| 180 | Ga0207693_10298796 | 3300025915 | Bacteria | 1261 |
| 181 | Ga0207663_10018681 | 3300025916 | Bacteria | 3891 |
| 182 | Ga0207663_10033274 | 3300025916 | Bacteria | 3069 |
| 183 | Ga0207663_10064826 | 3300025916 | Bacteria | 2333 |
| 184 | Ga0207660_10021110 | 3300025917 | Bacteria | 4377 |
| 185 | Ga0207660_10129847 | 3300025917 | Bacteria | 1917 |
| 186 | Ga0207657_10430182 | 3300025919 | Bacteria | 1037 |
| 187 | Ga0207649_10091894 | 3300025920 | Bacteria | 1989 |
| 188 | Ga0207649_10318199 | 3300025920 | Bacteria | 1142 |
| 189 | Ga0207652_10038672 | 3300025921 | Bacteria | 4046 |
| 190 | Ga0207652_10069643 | 3300025921 | Bacteria | 3054 |
| 191 | Ga0207652_10136727 | 3300025921 | Bacteria | 2189 |
| 192 | Ga0207652_10180742 | 3300025921 | Bacteria | 1896 |
| 193 | Ga0207694_10073020 | 3300025924 | Bacteria | 2683 |
| 194 | Ga0207694_10397175 | 3300025924 | Bacteria | 1146 |
| 195 | Ga0207687_10008249 | 3300025927 | Bacteria | 6815 |
| 196 | Ga0207687_10257582 | 3300025927 | Bacteria | 1390 |
| 197 | Ga0207687_10271898 | 3300025927 | Bacteria | 1355 |
| 198 | Ga0207700_10003970 | 3300025928 | Bacteria | 8655 |
| 199 | Ga0207700_10026454 | 3300025928 | Bacteria | 4045 |
| 200 | Ga0207700_10055560 | 3300025928 | Bacteria | 2977 |
| 201 | Ga0207700_10057722 | 3300025928 | Bacteria | 2928 |
| 202 | Ga0207664_10004931 | 3300025929 | Bacteria | 9075 |
| 203 | Ga0207664_10060274 | 3300025929 | Bacteria | 3024 |
| 204 | Ga0207664_10622983 | 3300025929 | Bacteria | 969 |
| 205 | Ga0207704_10235747 | 3300025938 | Bacteria | 1364 |
| 206 | Ga0207665_10017817 | 3300025939 | Bacteria | 4668 |
| 207 | Ga0207665_10082708 | 3300025939 | Bacteria | 2213 |
| 208 | Ga0207711_10142170 | 3300025941 | Bacteria | 2160 |
| 209 | Ga0207711_10348564 | 3300025941 | Bacteria | 1371 |
| 210 | Ga0207689_10045378 | 3300025942 | Bacteria | 3634 |
| 211 | Ga0207661_10002064 | 3300025944 | Bacteria | 13826 |
| 212 | Ga0207661_10002496 | 3300025944 | Bacteria | 12664 |
| 213 | Ga0207661_10341620 | 3300025944 | Bacteria | 1349 |
| 214 | Ga0207661_10364813 | 3300025944 | Bacteria | 1305 |
| 215 | Ga0207679_10298706 | 3300025945 | Bacteria | 1387 |
| 216 | Ga0207667_10018061 | 3300025949 | Bacteria | 7921 |
| 217 | Ga0207667_10274050 | 3300025949 | Bacteria | 1725 |
| 218 | Ga0207667_10298458 | 3300025949 | Bacteria | 1646 |
| 219 | Ga0207667_10612597 | 3300025949 | Bacteria | 1097 |
| 220 | Ga0207640_10308809 | 3300025981 | Bacteria | 1254 |
| 221 | Ga0207640_10481263 | 3300025981 | Bacteria | 1030 |
| 222 | Ga0207677_10061957 | 3300026023 | Bacteria | 2593 |
| 223 | Ga0207703_10034858 | 3300026035 | Bacteria | 3996 |
| 224 | Ga0207639_10079464 | 3300026041 | Bacteria | 2592 |
| 225 | Ga0207639_10598686 | 3300026041 | Bacteria | 1016 |
| 226 | Ga0207678_10041101 | 3300026067 | Bacteria | 4009 |
| 227 | Ga0207702_10155120 | 3300026078 | Bacteria | 2086 |
| 228 | Ga0207702_10458614 | 3300026078 | Bacteria | 1238 |
| 229 | Ga0207702_10565238 | 3300026078 | Bacteria | 1113 |
| 230 | Ga0207675_100443744 | 3300026118 | Bacteria | 1285 |
| 231 | Ga0207675_100464261 | 3300026118 | Bacteria | 1256 |
| 232 | Ga0207683_10010904 | 3300026121 | Bacteria | 7751 |
| 233 | Ga0207698_10042683 | 3300026142 | Bacteria | 3391 |
| 234 | Ga0207698_10058662 | 3300026142 | Bacteria | 2984 |
| 235 | Ga0207698_10747192 | 3300026142 | Bacteria | 977 |
| 236 | Ga0209389_1000001 | 3300027296 | Bacteria | 463799 |
| 237 | Ga0209589_1000014 | 3300027357 | Bacteria | 227996 |
| 238 | Ga0209489_100014 | 3300027361 | Bacteria | 227996 |
| 239 | Ga0209489_119997 | 3300027361 | Bacteria | 2055 |
| 240 | Ga0209700_100007 | 3300027363 | Bacteria | 454608 |
| 241 | Ga0209700_100024 | 3300027363 | Bacteria | 227996 |
| 242 | Ga0209179_1035618 | 3300027512 | Bacteria | 1035 |
| 243 | Ga0268264_10000048 | 3300028381 | Bacteria | 334457 |
| 244 | Ga0265338_10302683 | 3300028800 | Bacteria | 1162 |
| 245 | Ga0307511_10022568 | 3300030521 | Bacteria | 5895 |
| 246 | Ga0265330_10034863 | 3300031235 | Bacteria | 2247 |
| 247 | Ga0265340_10071372 | 3300031247 | Bacteria | 1646 |
| 248 | Ga0265339_10016773 | 3300031249 | Bacteria | 4358 |
| 249 | Ga0307509_10074244 | 3300031507 | Bacteria | 3537 |
| 250 | Ga0307509_10140206 | 3300031507 | Bacteria | 2355 |
| 251 | Ga0265313_10114165 | 3300031595 | Bacteria | 1185 |
| 252 | Ga0307508_10000032 | 3300031616 | Bacteria | 163293 |
| 253 | Ga0307508_10076043 | 3300031616 | Bacteria | 2935 |
| 254 | Ga0265314_10005447 | 3300031711 | Bacteria | 11490 |
| 255 | Ga0265314_10024001 | 3300031711 | Bacteria | 4634 |
| 256 | Ga0307406_10484461 | 3300031901 | Bacteria | 1000 |
| 257 | Ga0315911_1000002 | 3300033442 | Bacteria | 926833 |
| 258 | Ga0316215_1009399 | 3300033544 | Bacteria | 963 |
| 259 | Ga0373926_0017225 | 3300035083 | Bacteria | 2478 |
| 260 | Ga0373926_0022939 | 3300035083 | Bacteria | 2166 |
| 261 | Ga0373934_0033956 | 3300035086 | Bacteria | 2004 |
| 262 | Ga0373936_0003229 | 3300035113 | Bacteria | 6115 |
| 263 | Ga0373936_0021224 | 3300035113 | Bacteria | 2525 |
| 264 | Ga0373936_0103265 | 3300035113 | Bacteria | 1204 |
| 265 | Ga0373945_0009107 | 3300035116 | Bacteria | 3245 |
| 266 | Ga0373953_0032257 | 3300035117 | Bacteria | 2042 |
| 267 | Ga0373954_0006338 | 3300035118 | Bacteria | 5158 |
| 268 | Ga0373956_0011739 | 3300035119 | Bacteria | 3615 |
| 269 | Ga0373956_0016342 | 3300035119 | Bacteria | 3116 |
| 270 | Ga0373943_0008120 | 3300035170 | Bacteria | 4708 |
| 271 | Ga0373946_0003292 | 3300035171 | Bacteria | 5739 |
| 272 | Ga0373946_0159889 | 3300035171 | Bacteria | 1057 |
| 273 | Ga0373955_0058087 | 3300035172 | Bacteria | 2127 |
| 274 | Ga0373942_0158904 | 3300035207 | Bacteria | 730 |
| 275 | Ga0373935_0007483 | 3300035692 | Bacteria | 6537 |
| 276 | Ga0373935_0014513 | 3300035692 | Bacteria | 4754 |
| 277 | Ga0373935_0076609 | 3300035692 | Bacteria | 2166 |
| 278 | Ga0373927_0005166 | 3300035695 | Bacteria | 9030 |
| 279 | Ga0373927_0017851 | 3300035695 | Bacteria | 4666 |
| 280 | Ga0373927_0020402 | 3300035695 | Bacteria | 4345 |
| 281 | Ga0373927_0077200 | 3300035695 | Bacteria | 2157 |
| 282 | Ga0373933_0000406 | 3300035724 | Bacteria | 27321 |
| 283 | Ga0373933_0016314 | 3300035724 | Bacteria | 4150 |
| 284 | Ga0373933_0096426 | 3300035724 | Bacteria | 1830 |
| 285 | Ga0373947_0110170 | 3300035725 | Bacteria | 1739 |
| 286 | Ga0373937_0146362 | 3300036401 | Bacteria | 2211 |
| 287 | Ga0373925_0104858 | 3300037068 | Bacteria | 2178 |
| 288 | Ga0373925_0177234 | 3300037068 | Bacteria | 1685 |
| 289 | Ga0395900_0000948 | 3300037418 | Bacteria | 37848 |
| 290 | Ga0395900_0048549 | 3300037418 | Bacteria | 4373 |
| 291 | Ga0395898_0273869 | 3300037466 | Bacteria | 1610 |
| 292 | Ga0395898_0370698 | 3300037466 | Bacteria | 1365 |
| 293 | Ga0395905_0004515 | 3300037471 | Bacteria | 14421 |
| 294 | Ga0395905_0071333 | 3300037471 | Bacteria | 3256 |
| 295 | Ga0436364_0519650 | 3300037853 | Bacteria | 2126 |
| 296 | Ga0395901_0370210 | 3300038443 | Bacteria | 1476 |
| 297 | Ga0436365_0227213 | 3300039437 | Bacteria | 2604 |
| 298 | Ga0436365_0230691 | 3300039437 | Bacteria | 977 |
| 299 | Ga0436365_1558214 | 3300039437 | Bacteria | 2191 |
| 300 | Ga0436365_1580667 | 3300039437 | Bacteria | 5735 |
| 301 | Ga0436365_1835761 | 3300039437 | Bacteria | 36188 |
| 302 | Ga0436360_0655438 | 3300039438 | Bacteria | 3133 |
| 303 | Ga0436361_0216778 | 3300039447 | Bacteria | 1502 |
| 304 | Ga0436361_0248601 | 3300039447 | Bacteria | 2522 |
| 305 | Ga0436361_0785428 | 3300039447 | Bacteria | 1067 |
| 306 | Ga0436363_0362302 | 3300039450 | Bacteria | 4805 |
| 307 | Ga0436362_0074913 | 3300039453 | Bacteria | 4447 |
| 308 | Ga0436362_1193065 | 3300039453 | Bacteria | 3700 |
| 309 | Ga0466972_0001899 | 3300044658 | Bacteria | 10263 |
| 310 | Ga0466972_0010445 | 3300044658 | Bacteria | 4663 |
| 311 | Ga0466965_0126569 | 3300044683 | Bacteria | 1322 |
| 312 | Ga0466965_0149087 | 3300044683 | Bacteria | 1222 |
| 313 | Ga0466966_0063523 | 3300044684 | Bacteria | 2326 |
| 314 | Ga0466966_0137292 | 3300044684 | Bacteria | 1495 |
| 315 | Ga0466961_0000050 | 3300044693 | Bacteria | 71289 |
| 316 | Ga0466963_0156531 | 3300044694 | Bacteria | 1584 |
| 317 | Ga0466968_0079107 | 3300044735 | Bacteria | 1442 |
| 318 | Ga0466968_0095810 | 3300044735 | Bacteria | 1321 |
| 319 | Ga0466970_0262392 | 3300044765 | Bacteria | 969 |
| 320 | Ga0466957_0171864 | 3300044842 | Bacteria | 1412 |
| 321 | Ga0466960_0118840 | 3300044901 | Bacteria | 1382 |
| 322 | Ga0466959_0005557 | 3300045049 | Bacteria | 8654 |
| 323 | Ga0466959_0016947 | 3300045049 | Bacteria | 5333 |
| 324 | Ga0466959_0270002 | 3300045049 | Bacteria | 1169 |
| 325 | Ga0466958_0107646 | 3300045836 | Bacteria | 1739 |
| 326 | Ga0466967_0070734 | 3300045976 | Bacteria | 3122 |
| 327 | Ga0466967_0095054 | 3300045976 | Bacteria | 2715 |
| 328 | Ga0466967_0132737 | 3300045976 | Bacteria | 2313 |
| 329 | Ga0466967_0259926 | 3300045976 | Bacteria | 1661 |
| 330 | Ga0495592_0016464 | 3300046454 | Bacteria | 5610 |
| 331 | Ga0495603_0062365 | 3300046455 | Bacteria | 2201 |
| 332 | Ga0495603_0306441 | 3300046455 | Bacteria | 912 |
| 333 | Ga0495629_0004164 | 3300046459 | Bacteria | 10856 |
| 334 | Ga0495629_0016212 | 3300046459 | Bacteria | 5349 |
| 335 | Ga0495629_0316027 | 3300046459 | Bacteria | 1068 |
| 336 | Ga0495651_0054312 | 3300046462 | Bacteria | 3081 |
| 337 | Ga0495651_0199431 | 3300046462 | Bacteria | 1401 |
| 338 | Ga0495653_0106668 | 3300046463 | Bacteria | 2020 |
| 339 | Ga0495580_0004514 | 3300046472 | Bacteria | 11688 |
| 340 | Ga0495580_0410943 | 3300046472 | Bacteria | 911 |
| 341 | Ga0495582_0041115 | 3300046473 | Bacteria | 2547 |
| 342 | Ga0495582_0064270 | 3300046473 | Bacteria | 2026 |
| 343 | Ga0495582_0099343 | 3300046473 | Bacteria | 1629 |
| 344 | Ga0495639_0004971 | 3300046475 | Bacteria | 5703 |
| 345 | Ga0495662_0107074 | 3300046476 | Bacteria | 1369 |
| 346 | Ga0495664_0019517 | 3300046477 | Bacteria | 3898 |
| 347 | Ga0495594_0067294 | 3300046499 | Bacteria | 1988 |
| 348 | Ga0495607_0032466 | 3300046501 | Bacteria | 3186 |
| 349 | Ga0495583_0074593 | 3300046506 | Bacteria | 1485 |
| 350 | Ga0495606_0061638 | 3300046507 | Bacteria | 2398 |
| 351 | Ga0495606_0138159 | 3300046507 | Bacteria | 1441 |
| 352 | Ga0495608_0017348 | 3300046511 | Bacteria | 4980 |
| 353 | Ga0495608_0285828 | 3300046511 | Bacteria | 1023 |
| 354 | Ga0495618_0064109 | 3300046514 | Bacteria | 2334 |
| 355 | Ga0495618_0135281 | 3300046514 | Bacteria | 1577 |
| 356 | Ga0495628_0292851 | 3300046516 | Bacteria | 1206 |
| 357 | Ga0495630_0061693 | 3300046517 | Bacteria | 2815 |
| 358 | Ga0495630_0188680 | 3300046517 | Bacteria | 1573 |
| 359 | Ga0495631_0112100 | 3300046518 | Bacteria | 1173 |
| 360 | Ga0495648_0012980 | 3300046524 | Bacteria | 6183 |
| 361 | Ga0495666_0061310 | 3300046526 | Bacteria | 1797 |
| 362 | Ga0495652_0023483 | 3300046529 | Bacteria | 5466 |
| 363 | Ga0495652_0063455 | 3300046529 | Bacteria | 3110 |
| 364 | Ga0495652_0166690 | 3300046529 | Bacteria | 1704 |
| 365 | Ga0495652_0221291 | 3300046529 | Bacteria | 1422 |
| 366 | Ga0495665_0012269 | 3300046531 | Bacteria | 4637 |
| 367 | Ga0495640_0029778 | 3300046533 | Bacteria | 3914 |
| 368 | Ga0495640_0031288 | 3300046533 | Bacteria | 3799 |
| 369 | Ga0495640_0061328 | 3300046533 | Bacteria | 2555 |
| 370 | Ga0495587_0006060 | 3300046536 | Bacteria | 7887 |
| 371 | Ga0495587_0112409 | 3300046536 | Bacteria | 1564 |
| 372 | Ga0495587_0130859 | 3300046536 | Bacteria | 1434 |
| 373 | Ga0495597_0039041 | 3300046542 | Bacteria | 2127 |
| 374 | Ga0495645_0031198 | 3300046543 | Bacteria | 3883 |
| 375 | Ga0495645_0067622 | 3300046543 | Bacteria | 2580 |
| 376 | Ga0495645_0093671 | 3300046543 | Bacteria | 2143 |
| 377 | Ga0495645_0146919 | 3300046543 | Bacteria | 1641 |
| 378 | Ga0495622_0014914 | 3300046557 | Bacteria | 3613 |
| 379 | Ga0495667_0031571 | 3300046559 | Bacteria | 3554 |
| 380 | Ga0495667_0068906 | 3300046559 | Bacteria | 2309 |
| 381 | Ga0495667_0181793 | 3300046559 | Bacteria | 1349 |
| 382 | Ga0495634_0033435 | 3300046642 | Bacteria | 3534 |
| 383 | Ga0495625_0125544 | 3300046660 | Bacteria | 1742 |
| 384 | Ga0495635_0001219 | 3300046663 | Bacteria | 17201 |
| 385 | Ga0495635_0010817 | 3300046663 | Bacteria | 6392 |
| 386 | Ga0495635_0043607 | 3300046663 | Bacteria | 3095 |
| 387 | Ga0495661_0018009 | 3300046665 | Bacteria | 4653 |
| 388 | Ga0495657_0008675 | 3300046675 | Bacteria | 7759 |
| 389 | Ga0495657_0023046 | 3300046675 | Bacteria | 4453 |
| 390 | Ga0495599_0257260 | 3300046678 | Bacteria | 1061 |
| 391 | Ga0495623_0011265 | 3300046679 | Bacteria | 5783 |
| 392 | Ga0495623_0044114 | 3300046679 | Bacteria | 2834 |
| 393 | Ga0495646_0051044 | 3300046680 | Bacteria | 2504 |
| 394 | Ga0495646_0092917 | 3300046680 | Bacteria | 1739 |
| 395 | Ga0495658_0024424 | 3300046683 | Bacteria | 3219 |
| 396 | Ga0495658_0061147 | 3300046683 | Bacteria | 2162 |
| 397 | Ga0495613_0034342 | 3300046689 | Bacteria | 3767 |
| 398 | Ga0495613_0054981 | 3300046689 | Bacteria | 2926 |
| 399 | Ga0495624_0034608 | 3300046690 | Bacteria | 3266 |
| 400 | Ga0495624_0039263 | 3300046690 | Bacteria | 3035 |
| 401 | Ga0495624_0188699 | 3300046690 | Bacteria | 1254 |
| 402 | Ga0495649_0079714 | 3300046694 | Bacteria | 1751 |
| 403 | Ga0495600_0076852 | 3300046809 | Bacteria | 2180 |
| 404 | Ga0495581_0021847 | 3300047315 | Bacteria | 3709 |
| 405 | Ga0495581_0043324 | 3300047315 | Bacteria | 2603 |
| 406 | Ga0495581_0151367 | 3300047315 | Bacteria | 1355 |
| 407 | Ga0495604_0138281 | 3300047317 | Bacteria | 1743 |
| 408 | Ga0495604_0314615 | 3300047317 | Bacteria | 1048 |
| 409 | Ga0495674_0067364 | 3300047319 | Bacteria | 3102 |
| 410 | Ga0495674_0216183 | 3300047319 | Bacteria | 1586 |
| 411 | Ga0495674_0413141 | 3300047319 | Bacteria | 1088 |
| 412 | Ga0495674_0589442 | 3300047319 | Bacteria | 882 |
| 413 | Ga0495672_0145806 | 3300047320 | Bacteria | 1232 |
| 414 | Ga0495676_0184673 | 3300047321 | Bacteria | 1459 |
| 415 | Ga0495680_0027996 | 3300047322 | Bacteria | 4624 |
| 416 | Ga0495675_0031619 | 3300047444 | Bacteria | 3379 |
| 417 | Ga0495675_0151883 | 3300047444 | Bacteria | 1430 |
| 418 | Ga0495684_0010530 | 3300047471 | Bacteria | 7149 |
| 419 | Ga0495684_0019701 | 3300047471 | Bacteria | 5198 |
| 420 | Ga0495684_0108177 | 3300047471 | Bacteria | 2100 |
| 421 | Ga0495686_0033809 | 3300047472 | Bacteria | 3298 |
| 422 | Ga0495686_0139551 | 3300047472 | Bacteria | 1431 |
| 423 | Ga0495593_0028308 | 3300047673 | Bacteria | 3078 |
| 424 | Ga0495593_0031403 | 3300047673 | Bacteria | 2901 |
| 425 | Ga0495593_0042204 | 3300047673 | Bacteria | 2449 |
| 426 | Ga0495602_0033120 | 3300048088 | Bacteria | 4853 |
| 427 | Ga0495602_0286678 | 3300048088 | Bacteria | 1211 |
| 428 | Ga0496100_0089884 | 3300048903 | Bacteria | 2093 |
| 429 | Ga0496100_0262968 | 3300048903 | Bacteria | 1280 |
| 430 | Ga0496100_0405975 | 3300048903 | Bacteria | 1038 |
| 431 | Ga0496100_0487555 | 3300048903 | Bacteria | 948 |
| 432 | Ga0496100_0616533 | 3300048903 | Bacteria | 843 |
| 433 | Ga0496101_0075626 | 3300048904 | Bacteria | 2479 |
| 434 | Ga0496101_0148703 | 3300048904 | Bacteria | 1790 |
| 435 | Ga0496102_0058766 | 3300048905 | Bacteria | 3515 |
| 436 | Ga0496102_0114298 | 3300048905 | Bacteria | 2518 |
| 437 | Ga0496102_0146084 | 3300048905 | Bacteria | 2220 |
| 438 | Ga0496102_0585047 | 3300048905 | Bacteria | 1039 |
| 439 | Ga0496103_0020025 | 3300048906 | Bacteria | 4017 |
| 440 | Ga0496104_0018839 | 3300048907 | Bacteria | 6305 |
| 441 | Ga0496104_0098246 | 3300048907 | Bacteria | 2803 |
| 442 | Ga0496105_0016130 | 3300048908 | Bacteria | 5958 |
| 443 | Ga0496105_0063988 | 3300048908 | Bacteria | 3034 |
| 444 | Ga0496106_0000240 | 3300048909 | Bacteria | 38188 |
| 445 | Ga0496106_0003104 | 3300048909 | Bacteria | 12404 |
| 446 | Ga0496107_0006959 | 3300048910 | Bacteria | 7794 |
| 447 | Ga0496107_0050244 | 3300048910 | Bacteria | 3006 |
| 448 | Ga0496108_0002900 | 3300048911 | Bacteria | 13769 |
| 449 | Ga0496108_0015092 | 3300048911 | Bacteria | 6305 |
| 450 | Ga0496109_0002875 | 3300048912 | Bacteria | 14407 |
| 451 | Ga0496109_0213881 | 3300048912 | Bacteria | 1813 |
| 452 | Ga0496110_0014112 | 3300048913 | Bacteria | 6624 |
| 453 | Ga0496110_0034780 | 3300048913 | Bacteria | 4367 |
| 454 | Ga0496110_0142471 | 3300048913 | Bacteria | 2167 |
| 455 | Ga0496111_0101097 | 3300048914 | Bacteria | 2118 |
| 456 | Ga0496112_0004764 | 3300048915 | Bacteria | 11568 |
| 457 | Ga0496112_0026862 | 3300048915 | Bacteria | 5547 |
| 458 | Ga0496112_0446735 | 3300048915 | Bacteria | 1231 |
| 459 | Ga0496112_0661452 | 3300048915 | Bacteria | 974 |
| 460 | Ga0496113_0005360 | 3300048916 | Bacteria | 7994 |
| 461 | Ga0496113_0042681 | 3300048916 | Bacteria | 3352 |
| 462 | Ga0496113_0183206 | 3300048916 | Bacteria | 1660 |
| 463 | Ga0496113_0439440 | 3300048916 | Bacteria | 1048 |
| 464 | Ga0496114_0066871 | 3300048917 | Bacteria | 3014 |
| 465 | Ga0496114_0286060 | 3300048917 | Bacteria | 1454 |
| 466 | Ga0496114_0684180 | 3300048917 | Bacteria | 900 |
| 467 | Ga0496115_0004354 | 3300048918 | Bacteria | 10246 |
| 468 | Ga0496115_0031524 | 3300048918 | Bacteria | 4178 |
| 469 | Ga0496115_0365512 | 3300048918 | Bacteria | 1175 |
| 470 | Ga0496115_0394969 | 3300048918 | Bacteria | 1123 |
| 471 | Ga0496116_0001913 | 3300048919 | Bacteria | 22414 |
| 472 | Ga0496117_0059196 | 3300048920 | Bacteria | 2648 |
| 473 | Ga0496117_0107837 | 3300048920 | Bacteria | 1743 |
| 474 | Ga0496117_0176772 | 3300048920 | Bacteria | 1232 |
| 475 | Ga0496117_0272441 | 3300048920 | Bacteria | 911 |
| 476 | Ga0496118_0014922 | 3300048921 | Bacteria | 7231 |
| 477 | Ga0496118_0036957 | 3300048921 | Bacteria | 3939 |
| 478 | Ga0496118_0137954 | 3300048921 | Bacteria | 1553 |
| 479 | Ga0496118_0179234 | 3300048921 | Bacteria | 1282 |
| 480 | Ga0496119_0007401 | 3300048922 | Bacteria | 9897 |
| 481 | Ga0496119_0053987 | 3300048922 | Bacteria | 2450 |
| 482 | Ga0496120_0042313 | 3300048923 | Bacteria | 2661 |
| 483 | Ga0496120_0050889 | 3300048923 | Bacteria | 2370 |
| 484 | Ga0496121_0000230 | 3300048924 | Bacteria | 120616 |
| 485 | Ga0496121_0004398 | 3300048924 | Bacteria | 19000 |
| 486 | Ga0496121_0012985 | 3300048924 | Bacteria | 9002 |
| 487 | Ga0496121_0012991 | 3300048924 | Bacteria | 8999 |
| 488 | Ga0496121_0072354 | 3300048924 | Bacteria | 2768 |
| 489 | Ga0496121_0080720 | 3300048924 | Bacteria | 2577 |
| 490 | Ga0496121_0195417 | 3300048924 | Bacteria | 1446 |
| 491 | Ga0496122_0060463 | 3300048925 | Bacteria | 2790 |
| 492 | Ga0496122_0097437 | 3300048925 | Bacteria | 1979 |
| 493 | Ga0496125_0000040 | 3300048928 | Bacteria | 314478 |
| 494 | Ga0496125_0010916 | 3300048928 | Bacteria | 9134 |
| 495 | Ga0496125_0057016 | 3300048928 | Bacteria | 3167 |
| 496 | Ga0496125_0063668 | 3300048928 | Bacteria | 2938 |
| 497 | Ga0496125_0072103 | 3300048928 | Bacteria | 2694 |
| 498 | Ga0496125_0115698 | 3300048928 | Bacteria | 1928 |
| 499 | Ga0496126_0005072 | 3300048929 | Bacteria | 15276 |
| 500 | Ga0496126_0007510 | 3300048929 | Bacteria | 11940 |
| 501 | Ga0496126_0035899 | 3300048929 | Bacteria | 4640 |
| 502 | Ga0496126_0039704 | 3300048929 | Bacteria | 4365 |
| 503 | Ga0496126_0096139 | 3300048929 | Bacteria | 2597 |
| 504 | Ga0496126_0104813 | 3300048929 | Bacteria | 2470 |
| 505 | Ga0496126_0124793 | 3300048929 | Bacteria | 2229 |
| 506 | Ga0496126_0218933 | 3300048929 | Bacteria | 1600 |
| 507 | Ga0496126_0250775 | 3300048929 | Bacteria | 1475 |
| 508 | Ga0496126_0360391 | 3300048929 | Bacteria | 1188 |
| 509 | Ga0496126_0402111 | 3300048929 | Bacteria | 1110 |
| 510 | Ga0496126_0608361 | 3300048929 | Bacteria | 860 |
| 511 | Ga0495678_104845 | 3300049459 | Bacteria | 974 |
| 512 | Ga0501031_0001217 | 3300049568 | Bacteria | 15748 |
| 513 | Ga0501032_0011357 | 3300049569 | Bacteria | 6397 |
| 514 | Ga0501032_0028163 | 3300049569 | Bacteria | 3860 |
| 515 | Ga0501032_0036558 | 3300049569 | Bacteria | 3351 |
| 516 | Ga0501033_0000667 | 3300049570 | Bacteria | 31755 |
| 517 | Ga0501033_0004962 | 3300049570 | Bacteria | 10583 |
| 518 | Ga0501033_0039325 | 3300049570 | Bacteria | 3533 |
| 519 | Ga0501034_0001924 | 3300049571 | Bacteria | 26305 |
| 520 | Ga0501034_0163614 | 3300049571 | Bacteria | 2194 |
| 521 | Ga0501036_0001359 | 3300049572 | Bacteria | 18755 |
| 522 | Ga0501036_0077813 | 3300049572 | Bacteria | 2806 |
| 523 | Ga0501037_0000715 | 3300049573 | Bacteria | 25186 |
| 524 | Ga0501037_0068347 | 3300049573 | Bacteria | 2586 |
| 525 | Ga0501038_0000342 | 3300049574 | Bacteria | 40148 |
| 526 | Ga0501038_0021064 | 3300049574 | Bacteria | 5856 |
| 527 | Ga0501039_0001565 | 3300049575 | Bacteria | 16831 |
| 528 | Ga0501039_0032158 | 3300049575 | Bacteria | 4043 |
| 529 | Ga0501039_0132064 | 3300049575 | Bacteria | 1959 |
| 530 | Ga0501040_0020439 | 3300049576 | Bacteria | 4411 |
| 531 | Ga0501042_0021464 | 3300049578 | Bacteria | 4501 |
| 532 | Ga0501043_0000120 | 3300049579 | Bacteria | 72670 |
| 533 | Ga0501043_0003554 | 3300049579 | Bacteria | 12804 |
| 534 | Ga0501046_0001506 | 3300049580 | Bacteria | 22255 |
| 535 | Ga0501046_0082098 | 3300049580 | Bacteria | 2489 |
| 536 | Ga0501047_0000697 | 3300049581 | Bacteria | 35083 |
| 537 | Ga0501047_0008066 | 3300049581 | Bacteria | 9937 |
| 538 | Ga0501047_0033590 | 3300049581 | Bacteria | 4951 |
| 539 | Ga0501047_0095041 | 3300049581 | Bacteria | 2859 |
| 540 | Ga0501047_0440625 | 3300049581 | Bacteria | 1133 |
| 541 | Ga0501048_0000288 | 3300049582 | Bacteria | 34175 |
| 542 | Ga0501048_0014507 | 3300049582 | Bacteria | 5832 |
| 543 | Ga0501067_0000682 | 3300049583 | Bacteria | 18262 |
| 544 | Ga0501067_0074226 | 3300049583 | Bacteria | 1884 |
| 545 | Ga0501068_0124562 | 3300049584 | Bacteria | 1608 |
| 546 | Ga0501070_0003047 | 3300049586 | Bacteria | 14595 |
| 547 | Ga0501070_0150319 | 3300049586 | Bacteria | 1921 |
| 548 | Ga0501070_0237769 | 3300049586 | Bacteria | 1491 |
| 549 | Ga0501072_0000936 | 3300049588 | Bacteria | 21487 |
| 550 | Ga0501073_0000091 | 3300049589 | Bacteria | 57029 |
| 551 | Ga0501073_0073507 | 3300049589 | Bacteria | 2380 |
| 552 | Ga0501073_0179987 | 3300049589 | Bacteria | 1463 |
| 553 | Ga0501074_0004116 | 3300049590 | Bacteria | 10380 |
| 554 | Ga0501076_0049798 | 3300049592 | Bacteria | 3314 |
| 555 | Ga0501079_0001942 | 3300049741 | Bacteria | 14808 |
| 556 | Ga0501079_0042558 | 3300049741 | Bacteria | 3506 |
| 557 | Ga0501080_0007154 | 3300049742 | Bacteria | 10072 |
| 558 | Ga0501080_0059524 | 3300049742 | Bacteria | 3554 |
| 559 | Ga0501083_0000470 | 3300049744 | Bacteria | 25912 |
| 560 | Ga0501083_0080926 | 3300049744 | Bacteria | 2153 |
| 561 | Ga0501035_0000452 | 3300049822 | Bacteria | 45865 |
| 562 | Ga0501035_0126221 | 3300049822 | Bacteria | 2233 |
| 563 | Ga0501044_0000274 | 3300049823 | Bacteria | 65668 |
| 564 | Ga0501044_0081070 | 3300049823 | Bacteria | 3285 |
| 565 | Ga0501044_0114224 | 3300049823 | Bacteria | 2706 |
| 566 | Ga0501044_0200130 | 3300049823 | Bacteria | 1956 |
| 567 | Ga0501044_0365053 | 3300049823 | Bacteria | 1361 |
| 568 | nmdc:mga0yw44_6230_c2 | 3300050492 | Bacteria | 2972 |
| 569 | nmdc:mga0k408_8246_c1 | 3300050493 | Bacteria | 5589 |
| 570 | nmdc:mga05p37_161675_c1 | 3300050507 | Bacteria | 2734 |
| 571 | nmdc:mga0sz30_74984_c1 | 3300050516 | Bacteria | 1460 |
| 572 | Ga0495601_0062094 | 3300053077 | Bacteria | 2372 |
| 573 | Ga0495601_0120162 | 3300053077 | Bacteria | 1706 |
| 574 | Ga0495612_0004388 | 3300053078 | Bacteria | 5851 |
| 575 | Ga0500635_0002076 | 3300053080 | Bacteria | 4905 |
| 576 | Ga0495595_0072134 | 3300053084 | Bacteria | 1634 |
| 577 | Ga0495619_0000557 | 3300053085 | Bacteria | 24670 |
| 578 | Ga0500578_0135637 | 3300053086 | Bacteria | 1541 |
| 579 | Ga0500643_013175 | 3300053087 | Bacteria | 2931 |
| 580 | Ga0500644_0027616 | 3300053088 | Bacteria | 1767 |
| 581 | Ga0500644_0043881 | 3300053088 | Bacteria | 1498 |
| 582 | Ga0500647_0024301 | 3300053091 | Bacteria | 2849 |
| 583 | Ga0500566_0000331 | 3300053094 | Bacteria | 25736 |
| 584 | Ga0500566_0001048 | 3300053094 | Bacteria | 16009 |
| 585 | Ga0500566_0021105 | 3300053094 | Bacteria | 3831 |
| 586 | Ga0500566_0152949 | 3300053094 | Bacteria | 1211 |
| 587 | Ga0500640_000214 | 3300053095 | Bacteria | 12549 |
| 588 | Ga0500648_202869 | 3300053097 | Bacteria | 994 |
| 589 | Ga0500556_0000069 | 3300053104 | Bacteria | 101263 |
| 590 | Ga0500569_013753 | 3300053109 | Bacteria | 1989 |
| 591 | Ga0500572_000025 | 3300053111 | Bacteria | 45953 |
| 592 | Ga0500572_000175 | 3300053111 | Bacteria | 22657 |
| 593 | Ga0500591_053485 | 3300053115 | Bacteria | 1886 |
| 594 | Ga0500593_097835 | 3300053117 | Bacteria | 1229 |
| 595 | Ga0500595_000407 | 3300053119 | Bacteria | 27509 |
| 596 | Ga0500595_000715 | 3300053119 | Bacteria | 19771 |
| 597 | Ga0500595_015655 | 3300053119 | Bacteria | 2842 |
| 598 | Ga0500608_001694 | 3300053122 | Bacteria | 7896 |
| 599 | Ga0500608_006744 | 3300053122 | Bacteria | 4703 |
| 600 | Ga0500614_001781 | 3300053123 | Bacteria | 4996 |
| 601 | Ga0500652_001281 | 3300053131 | Bacteria | 7967 |
| 602 | Ga0500559_0000289 | 3300053136 | Bacteria | 38837 |
| 603 | Ga0500559_0001458 | 3300053136 | Bacteria | 13416 |
| 604 | Ga0500559_0021044 | 3300053136 | Bacteria | 2761 |
| 605 | Ga0500559_0028447 | 3300053136 | Bacteria | 2388 |
| 606 | Ga0500568_0020133 | 3300053139 | Bacteria | 2891 |
| 607 | Ga0500573_0025499 | 3300053140 | Bacteria | 3399 |
| 608 | Ga0500590_049893 | 3300053148 | Bacteria | 2130 |
| 609 | Ga0500603_002027 | 3300053150 | Bacteria | 4486 |
| 610 | Ga0500616_0000461 | 3300053153 | Bacteria | 53095 |
| 611 | Ga0500622_0000602 | 3300053156 | Bacteria | 32636 |
| 612 | Ga0500630_000213 | 3300053159 | Bacteria | 22563 |
| 613 | Ga0500634_0071635 | 3300053161 | Bacteria | 1812 |
| 614 | Ga0500638_001677 | 3300053162 | Bacteria | 7185 |
| 615 | Ga0500639_000239 | 3300053163 | Bacteria | 27228 |
| 616 | Ga0500639_006810 | 3300053163 | Bacteria | 5912 |
| 617 | Ga0500636_0007566 | 3300053177 | Bacteria | 6281 |
| 618 | Ga0500636_0047846 | 3300053177 | Bacteria | 2518 |
| 619 | Ga0500636_0085360 | 3300053177 | Bacteria | 1813 |
| 620 | Ga0500636_0206406 | 3300053177 | Bacteria | 1035 |
| 621 | Ga0500637_0000265 | 3300053178 | Bacteria | 19602 |
| 622 | Ga0500637_0060102 | 3300053178 | Bacteria | 2176 |
| 623 | Ga0500645_012726 | 3300053730 | Bacteria | 2715 |
| 624 | Ga0500596_002172 | 3300053735 | Bacteria | 3887 |
| 625 | Ga0501084_0004871 | 3300054114 | Bacteria | 10961 |
| 626 | Ga0500661_003010 | 3300055283 | Bacteria | 3164 |
| 627 | Ga0501082_0041409 | 3300060353 | Bacteria | 3971 |
| 628 | Ga0501082_0167518 | 3300060353 | Bacteria | 1909 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046511 | Ga0495608_0285828 | Ga0495608_0285828_323_973 | 204 |
| 2 | 3300048903 | Ga0496100_0616533 | Ga0496100_0616533_170_832 | 210 |
| 3 | 3300035207 | Ga0373942_0158904 | Ga0373942_0158904_52_702 | 211 |
| 4 | 3300049589 | Ga0501073_0179987 | Ga0501073_0179987_42_728 | 214 |
| 5 | 3300005614 | Ga0068856_100263946 | Ga0068856_1002639462 | 225 |
| 6 | 3300037466 | Ga0395898_0273869 | Ga0395898_0273869_572_1336 | 225 |
| 7 | 3300037471 | Ga0395905_0071333 | Ga0395905_0071333_1045_1809 | 225 |
| 8 | 3300047319 | Ga0495674_0067364 | Ga0495674_0067364_1257_2033 | 226 |
| 9 | 3300005439 | Ga0070711_100025185 | Ga0070711_1000251852 | 230 |
| 10 | 3300025916 | Ga0207663_10018681 | Ga0207663_100186814 | 230 |
| 11 | 3300044658 | Ga0466972_0010445 | Ga0466972_0010445_713_1477 | 230 |
| 12 | iso_pu_bacteria | 2919073203 | 2919079345 | 230 |
| 13 | 3300005434 | Ga0070709_10000980 | Ga0070709_100009802 | 231 |
| 14 | 3300005435 | Ga0070714_100014017 | Ga0070714_1000140174 | 231 |
| 15 | 3300005436 | Ga0070713_100016044 | Ga0070713_1000160442 | 231 |
| 16 | 3300005437 | Ga0070710_10001038 | Ga0070710_100010385 | 231 |
| 17 | 3300006028 | Ga0070717_10348019 | Ga0070717_103480192 | 231 |
| 18 | 3300006173 | Ga0070716_100012668 | Ga0070716_1000126682 | 231 |
| 19 | 3300006175 | Ga0070712_100010019 | Ga0070712_1000100193 | 231 |
| 20 | 3300025898 | Ga0207692_10001278 | Ga0207692_100012788 | 231 |
| 21 | 3300025906 | Ga0207699_10011463 | Ga0207699_100114632 | 231 |
| 22 | 3300025915 | Ga0207693_10006620 | Ga0207693_100066207 | 231 |
| 23 | 3300025928 | Ga0207700_10026454 | Ga0207700_100264542 | 231 |
| 24 | 3300025929 | Ga0207664_10004931 | Ga0207664_100049315 | 231 |
| 25 | 3300025939 | Ga0207665_10017817 | Ga0207665_100178172 | 231 |
| 26 | 3300048929 | Ga0496126_0608361 | Ga0496126_0608361_11_847 | 231 |
| 27 | iso_pu_bacteria | 2824704595 | 2824711294 | 231 |
| 28 | 3300021384 | Ga0213876_10003065 | Ga0213876_100030657 | 232 |
| 29 | 3300039437 | Ga0436365_1835761 | Ga0436365_1835761_10299_11123 | 232 |
| 30 | 3300039453 | Ga0436362_0074913 | Ga0436362_0074913_2039_2836 | 234 |
| 31 | 3300046462 | Ga0495651_0054312 | Ga0495651_0054312_578_1342 | 234 |
| 32 | 3300046476 | Ga0495662_0107074 | Ga0495662_0107074_218_982 | 234 |
| 33 | 3300046516 | Ga0495628_0292851 | Ga0495628_0292851_140_904 | 234 |
| 34 | 3300046517 | Ga0495630_0188680 | Ga0495630_0188680_432_1196 | 234 |
| 35 | 3300046529 | Ga0495652_0166690 | Ga0495652_0166690_161_925 | 234 |
| 36 | 3300046536 | Ga0495587_0130859 | Ga0495587_0130859_305_1069 | 234 |
| 37 | 3300046543 | Ga0495645_0067622 | Ga0495645_0067622_865_1629 | 234 |
| 38 | 3300046559 | Ga0495667_0181793 | Ga0495667_0181793_71_835 | 234 |
| 39 | 3300046678 | Ga0495599_0257260 | Ga0495599_0257260_128_892 | 234 |
| 40 | 3300046680 | Ga0495646_0092917 | Ga0495646_0092917_431_1195 | 234 |
| 41 | 3300046809 | Ga0495600_0076852 | Ga0495600_0076852_833_1597 | 234 |
| 42 | 3300047317 | Ga0495604_0138281 | Ga0495604_0138281_33_797 | 234 |
| 43 | 3300047322 | Ga0495680_0027996 | Ga0495680_0027996_806_1570 | 234 |
| 44 | 3300047444 | Ga0495675_0031619 | Ga0495675_0031619_2135_2899 | 234 |
| 45 | 3300053084 | Ga0495595_0072134 | Ga0495595_0072134_436_1200 | 234 |
| 46 | 3300053177 | Ga0500636_0206406 | Ga0500636_0206406_82_846 | 234 |
| 47 | iso_pu_bacteria | 2903768456 | 2903769667 | 237 |
| 48 | 3300025253 | Ga0209677_105160 | Ga0209677_1051603 | 241 |
| 49 | 3300025297 | Ga0209758_1047180 | Ga0209758_10471801 | 241 |
| 50 | 3300045976 | Ga0466967_0070734 | Ga0466967_0070734_2217_2996 | 241 |
| 51 | iso_pu_bacteria | 2941531003 | 2941531141 | 241 |
| 52 | 3300003215 | JGI25153J46596_10015142 | JGI25153J46596_100151423 | 242 |
| 53 | 3300005577 | Ga0068857_100524382 | Ga0068857_1005243821 | 242 |
| 54 | 3300009545 | Ga0105237_10097272 | Ga0105237_100972723 | 242 |
| 55 | 3300025297 | Ga0209758_1000133 | Ga0209758_10001331 | 242 |
| 56 | 3300048929 | Ga0496126_0035899 | Ga0496126_0035899_825_1610 | 242 |
| 57 | iso_pu_bacteria | 2602042107 | 2603860955 | 242 |
| 58 | iso_pu_bacteria | 2857524615 | 2857530995 | 242 |
| 59 | iso_pu_bacteria | 2893066018 | 2893069114 | 242 |
| 60 | 3300047471 | Ga0495684_0108177 | Ga0495684_0108177_1220_1984 | 243 |
| 61 | iso_pu_bacteria | 2841949485 | 2841953416 | 243 |
| 62 | 3300003323 | rootH1_10005224 | rootH1_100052241 | 244 |
| 63 | 3300046679 | Ga0495623_0044114 | Ga0495623_0044114_1607_2371 | 244 |
| 64 | 3300048924 | Ga0496121_0072354 | Ga0496121_0072354_377_1159 | 244 |
| 65 | iso_pu_bacteria | 2513237092 | 2513622993 | 244 |
| 66 | iso_pu_bacteria | 2508501128 | 2509149350 | 245 |
| 67 | iso_pu_bacteria | 2513237094 | 2513642914 | 245 |
| 68 | iso_pu_bacteria | 2513237096 | 2513654033 | 245 |
| 69 | iso_pu_bacteria | 2513237104 | 2513719430 | 245 |
| 70 | iso_pu_bacteria | 2513237137 | 2513856785 | 245 |
| 71 | iso_pu_bacteria | 2513237139 | 2513878459 | 245 |
| 72 | iso_pu_bacteria | 2513237141 | 2513891307 | 245 |
| 73 | iso_pu_bacteria | 2513237145 | 2513918373 | 245 |
| 74 | iso_pu_bacteria | 2513237161 | 2514009493 | 245 |
| 75 | iso_pu_bacteria | 2517572143 | 2517891393 | 245 |
| 76 | iso_pu_bacteria | 2524023228 | 2524538421 | 245 |
| 77 | iso_pu_bacteria | 2617270735 | 2617346738 | 245 |
| 78 | iso_pu_bacteria | 2667528175 | 2671118827 | 245 |
| 79 | iso_pu_bacteria | 2728368998 | 2728750101 | 245 |
| 80 | iso_pu_bacteria | 2791355197 | 2793066763 | 245 |
| 81 | iso_pu_bacteria | 2802429603 | 2805919117 | 245 |
| 82 | iso_pu_bacteria | 2824671348 | 2824674831 | 245 |
| 83 | iso_pu_bacteria | 2824687955 | 2824693491 | 245 |
| 84 | iso_pu_bacteria | 2824696289 | 2824701984 | 245 |
| 85 | iso_pu_bacteria | 2824753945 | 2824758488 | 245 |
| 86 | iso_pu_bacteria | 2824763712 | 2824770072 | 245 |
| 87 | iso_pu_bacteria | 2824773399 | 2824775189 | 245 |
| 88 | iso_pu_bacteria | 2841966195 | 2841972113 | 245 |
| 89 | iso_pu_bacteria | 2841974524 | 2841978141 | 245 |
| 90 | iso_pu_bacteria | 2844315083 | 2844319956 | 245 |
| 91 | iso_pu_bacteria | 2847930680 | 2847937268 | 245 |
| 92 | iso_pu_bacteria | 2847939898 | 2847947678 | 245 |
| 93 | iso_pu_bacteria | 2874620515 | 2874628018 | 245 |
| 94 | iso_pu_bacteria | 2876761206 | 2876766153 | 245 |
| 95 | iso_pu_bacteria | 2879083081 | 2879086573 | 245 |
| 96 | iso_pu_bacteria | 2888388044 | 2888392858 | 245 |
| 97 | iso_pu_bacteria | 2903727486 | 2903730371 | 245 |
| 98 | iso_pu_bacteria | 2903748898 | 2903755953 | 245 |
| 99 | iso_pu_bacteria | 2904666416 | 2904674364 | 245 |
| 100 | iso_pu_bacteria | 2904690495 | 2904691256 | 245 |
| 101 | iso_pu_bacteria | 2904699407 | 2904704941 | 245 |
| 102 | iso_pu_bacteria | 2904711408 | 2904712045 | 245 |
| 103 | iso_pu_bacteria | 2906602504 | 2906604696 | 245 |
| 104 | iso_pu_bacteria | 2906610324 | 2906616575 | 245 |
| 105 | iso_pu_bacteria | 2906626472 | 2906627404 | 245 |
| 106 | iso_pu_bacteria | 2906635258 | 2906635352 | 245 |
| 107 | iso_pu_bacteria | 2906643746 | 2906643893 | 245 |
| 108 | iso_pu_bacteria | 2906660503 | 2906666898 | 245 |
| 109 | iso_pu_bacteria | 2908739725 | 2908741743 | 245 |
| 110 | iso_pu_bacteria | 2908756301 | 2908759103 | 245 |
| 111 | iso_pu_bacteria | 2922361189 | 2922368632 | 245 |
| 112 | iso_pu_bacteria | 2922425934 | 2922431401 | 245 |
| 113 | iso_pu_bacteria | 2932794094 | 2932795214 | 245 |
| 114 | iso_pu_bacteria | 2932801729 | 2932805744 | 245 |
| 115 | iso_pu_bacteria | 2935608549 | 2935609768 | 245 |
| 116 | iso_pu_bacteria | 2935630451 | 2935633997 | 245 |
| 117 | iso_pu_bacteria | 2935819856 | 2935822930 | 245 |
| 118 | iso_pu_bacteria | 2935847175 | 2935848512 | 245 |
| 119 | iso_pu_bacteria | 2935883170 | 2935883886 | 245 |
| 120 | iso_pu_bacteria | 2935908558 | 2935909683 | 245 |
| 121 | iso_pu_bacteria | 2935916978 | 2935917407 | 245 |
| 122 | iso_pu_bacteria | 2935926038 | 2935927164 | 245 |
| 123 | iso_pu_bacteria | 2935934488 | 2935936992 | 245 |
| 124 | iso_pu_bacteria | 2935942939 | 2935944705 | 245 |
| 125 | iso_pu_bacteria | 2935951376 | 2935953142 | 245 |
| 126 | iso_pu_bacteria | 2935959822 | 2935966654 | 245 |
| 127 | iso_pu_bacteria | 2935967501 | 2935969982 | 245 |
| 128 | iso_pu_bacteria | 2941507105 | 2941510700 | 245 |
| 129 | iso_pu_bacteria | 2941515067 | 2941518084 | 245 |
| 130 | iso_pu_bacteria | 2941523033 | 2941527045 | 245 |
| 131 | iso_pu_bacteria | 3005474847 | 3005481198 | 245 |
| 132 | iso_pu_bacteria | 3005594810 | 3005600240 | 245 |
| 133 | iso_pu_bacteria | 3005710791 | 3005715748 | 245 |
| 134 | iso_pu_bacteria | 3005718088 | 3005723096 | 245 |
| 135 | iso_pu_bacteria | 8006933436 | 8006939515 | 245 |
| 136 | iso_pu_bacteria | 8006973647 | 8006979265 | 245 |
| 137 | iso_pu_bacteria | 8016583857 | 8016594248 | 245 |
| 138 | iso_pu_bacteria | 8019555841 | 8019565398 | 245 |
| 139 | iso_pu_bacteria | 8019565922 | 8019575492 | 245 |
| 140 | iso_pu_bacteria | 8019576017 | 8019584232 | 245 |
| 141 | iso_pu_bacteria | 8019687851 | 8019691003 | 245 |
| 142 | iso_pu_bacteria | 8056689827 | 8056693114 | 245 |
| 143 | iso_pu_bacteria | 8056967851 | 8056975139 | 245 |
| 144 | 3300006178 | Ga0075367_10120568 | Ga0075367_101205682 | 246 |
| 145 | 3300006186 | Ga0075369_10051341 | Ga0075369_100513411 | 246 |
| 146 | 3300046501 | Ga0495607_0032466 | Ga0495607_0032466_2296_3048 | 246 |
| 147 | 3300046524 | Ga0495648_0012980 | Ga0495648_0012980_1058_1810 | 246 |
| 148 | 3300046542 | Ga0495597_0039041 | Ga0495597_0039041_719_1471 | 246 |
| 149 | 3300046557 | Ga0495622_0014914 | Ga0495622_0014914_1253_2005 | 246 |
| 150 | 3300046660 | Ga0495625_0125544 | Ga0495625_0125544_756_1508 | 246 |
| 151 | 3300046665 | Ga0495661_0018009 | Ga0495661_0018009_210_962 | 246 |
| 152 | 3300047472 | Ga0495686_0033809 | Ga0495686_0033809_83_835 | 246 |
| 153 | 3300048919 | Ga0496116_0001913 | Ga0496116_0001913_5609_6361 | 246 |
| 154 | 3300048920 | Ga0496117_0107837 | Ga0496117_0107837_337_1089 | 246 |
| 155 | 3300048920 | Ga0496117_0176772 | Ga0496117_0176772_127_879 | 246 |
| 156 | 3300048921 | Ga0496118_0179234 | Ga0496118_0179234_12_764 | 246 |
| 157 | 3300048923 | Ga0496120_0050889 | Ga0496120_0050889_458_1210 | 246 |
| 158 | 3300048924 | Ga0496121_0012985 | Ga0496121_0012985_1123_1875 | 246 |
| 159 | 3300048924 | Ga0496121_0012991 | Ga0496121_0012991_456_1208 | 246 |
| 160 | 3300048925 | Ga0496122_0097437 | Ga0496122_0097437_954_1706 | 246 |
| 161 | 3300048928 | Ga0496125_0000040 | Ga0496125_0000040_68235_68987 | 246 |
| 162 | 3300048928 | Ga0496125_0010916 | Ga0496125_0010916_7216_7968 | 246 |
| 163 | 3300048929 | Ga0496126_0402111 | Ga0496126_0402111_92_844 | 246 |
| 164 | 3300049459 | Ga0495678_104845 | Ga0495678_104845_98_850 | 246 |
| 165 | 3300050492 | nmdc:mga0yw44_6230_c2 | nmdc:mga0yw44_6230_c2_2045_2797 | 246 |
| 166 | 3300050516 | nmdc:mga0sz30_74984_c1 | nmdc:mga0sz30_74984_c1_77_829 | 246 |
| 167 | 3300053086 | Ga0500578_0135637 | Ga0500578_0135637_148_900 | 246 |
| 168 | 3300053087 | Ga0500643_013175 | Ga0500643_013175_398_1150 | 246 |
| 169 | 3300053088 | Ga0500644_0027616 | Ga0500644_0027616_776_1528 | 246 |
| 170 | 3300053088 | Ga0500644_0043881 | Ga0500644_0043881_380_1132 | 246 |
| 171 | 3300053094 | Ga0500566_0000331 | Ga0500566_0000331_19354_20106 | 246 |
| 172 | 3300053104 | Ga0500556_0000069 | Ga0500556_0000069_56816_57568 | 246 |
| 173 | 3300053109 | Ga0500569_013753 | Ga0500569_013753_309_1061 | 246 |
| 174 | 3300053117 | Ga0500593_097835 | Ga0500593_097835_38_790 | 246 |
| 175 | 3300053122 | Ga0500608_001694 | Ga0500608_001694_1649_2401 | 246 |
| 176 | 3300053131 | Ga0500652_001281 | Ga0500652_001281_5236_5988 | 246 |
| 177 | 3300053136 | Ga0500559_0001458 | Ga0500559_0001458_9335_10087 | 246 |
| 178 | 3300053148 | Ga0500590_049893 | Ga0500590_049893_505_1257 | 246 |
| 179 | 3300053153 | Ga0500616_0000461 | Ga0500616_0000461_8541_9293 | 246 |
| 180 | 3300053156 | Ga0500622_0000602 | Ga0500622_0000602_465_1217 | 246 |
| 181 | 3300053161 | Ga0500634_0071635 | Ga0500634_0071635_965_1717 | 246 |
| 182 | 3300053177 | Ga0500636_0007566 | Ga0500636_0007566_3949_4701 | 246 |
| 183 | 3300053730 | Ga0500645_012726 | Ga0500645_012726_1208_1960 | 246 |
| 184 | 3300005334 | Ga0068869_100181402 | Ga0068869_1001814022 | 247 |
| 185 | 3300005338 | Ga0068868_100492475 | Ga0068868_1004924751 | 247 |
| 186 | 3300005456 | Ga0070678_100308841 | Ga0070678_1003088412 | 247 |
| 187 | 3300005539 | Ga0068853_100275655 | Ga0068853_1002756552 | 247 |
| 188 | 3300005548 | Ga0070665_100103763 | Ga0070665_1001037634 | 247 |
| 189 | 3300005548 | Ga0070665_100328997 | Ga0070665_1003289972 | 247 |
| 190 | 3300005563 | Ga0068855_100165838 | Ga0068855_1001658384 | 247 |
| 191 | 3300005564 | Ga0070664_100235962 | Ga0070664_1002359623 | 247 |
| 192 | 3300005578 | Ga0068854_100105262 | Ga0068854_1001052624 | 247 |
| 193 | 3300005719 | Ga0068861_100351246 | Ga0068861_1003512462 | 247 |
| 194 | 3300005937 | Ga0081455_10040362 | Ga0081455_100403624 | 247 |
| 195 | 3300005937 | Ga0081455_10083231 | Ga0081455_100832314 | 247 |
| 196 | 3300005983 | Ga0081540_1001760 | Ga0081540_10017609 | 247 |
| 197 | 3300005983 | Ga0081540_1014485 | Ga0081540_10144856 | 247 |
| 198 | 3300006042 | Ga0075368_10081227 | Ga0075368_100812272 | 247 |
| 199 | 3300006358 | Ga0068871_100190467 | Ga0068871_1001904673 | 247 |
| 200 | 3300009101 | Ga0105247_10098555 | Ga0105247_100985553 | 247 |
| 201 | 3300009147 | Ga0114129_10042454 | Ga0114129_100424546 | 247 |
| 202 | 3300009148 | Ga0105243_10421094 | Ga0105243_104210942 | 247 |
| 203 | 3300009177 | Ga0105248_10180880 | Ga0105248_101808804 | 247 |
| 204 | 3300009545 | Ga0105237_10115212 | Ga0105237_101152124 | 247 |
| 205 | 3300009551 | Ga0105238_10083155 | Ga0105238_100831555 | 247 |
| 206 | 3300010375 | Ga0105239_10350304 | Ga0105239_103503042 | 247 |
| 207 | 3300011119 | Ga0105246_10118561 | Ga0105246_101185612 | 247 |
| 208 | 3300013296 | Ga0157374_10561451 | Ga0157374_105614512 | 247 |
| 209 | 3300013306 | Ga0163162_10243654 | Ga0163162_102436542 | 247 |
| 210 | 3300013307 | Ga0157372_10428682 | Ga0157372_104286822 | 247 |
| 211 | 3300015261 | Ga0182006_1092547 | Ga0182006_10925472 | 247 |
| 212 | 3300025903 | Ga0207680_10108586 | Ga0207680_101085862 | 247 |
| 213 | 3300025908 | Ga0207643_10073216 | Ga0207643_100732162 | 247 |
| 214 | 3300025927 | Ga0207687_10257582 | Ga0207687_102575822 | 247 |
| 215 | 3300025941 | Ga0207711_10142170 | Ga0207711_101421703 | 247 |
| 216 | 3300025942 | Ga0207689_10045378 | Ga0207689_100453785 | 247 |
| 217 | 3300025981 | Ga0207640_10308809 | Ga0207640_103088092 | 247 |
| 218 | 3300026023 | Ga0207677_10061957 | Ga0207677_100619574 | 247 |
| 219 | 3300026035 | Ga0207703_10034858 | Ga0207703_100348582 | 247 |
| 220 | 3300026041 | Ga0207639_10079464 | Ga0207639_100794644 | 247 |
| 221 | 3300026118 | Ga0207675_100464261 | Ga0207675_1004642612 | 247 |
| 222 | 3300026142 | Ga0207698_10747192 | Ga0207698_107471921 | 247 |
| 223 | 3300031711 | Ga0265314_10005447 | Ga0265314_100054474 | 247 |
| 224 | 3300031901 | Ga0307406_10484461 | Ga0307406_104844611 | 247 |
| 225 | 3300035117 | Ga0373953_0032257 | Ga0373953_0032257_555_1331 | 247 |
| 226 | 3300035119 | Ga0373956_0016342 | Ga0373956_0016342_2229_3005 | 247 |
| 227 | 3300035172 | Ga0373955_0058087 | Ga0373955_0058087_1340_2116 | 247 |
| 228 | 3300035724 | Ga0373933_0016314 | Ga0373933_0016314_3284_4060 | 247 |
| 229 | 3300037471 | Ga0395905_0004515 | Ga0395905_0004515_5143_5907 | 247 |
| 230 | 3300038443 | Ga0395901_0370210 | Ga0395901_0370210_38_802 | 247 |
| 231 | 3300046459 | Ga0495629_0016212 | Ga0495629_0016212_2340_3116 | 247 |
| 232 | 3300046511 | Ga0495608_0017348 | Ga0495608_0017348_2524_3300 | 247 |
| 233 | 3300046529 | Ga0495652_0023483 | Ga0495652_0023483_221_997 | 247 |
| 234 | 3300046533 | Ga0495640_0061328 | Ga0495640_0061328_758_1534 | 247 |
| 235 | 3300046536 | Ga0495587_0006060 | Ga0495587_0006060_878_1654 | 247 |
| 236 | 3300046543 | Ga0495645_0031198 | Ga0495645_0031198_2777_3553 | 247 |
| 237 | 3300046559 | Ga0495667_0031571 | Ga0495667_0031571_434_1210 | 247 |
| 238 | 3300046642 | Ga0495634_0033435 | Ga0495634_0033435_1297_2073 | 247 |
| 239 | 3300046663 | Ga0495635_0043607 | Ga0495635_0043607_1253_2029 | 247 |
| 240 | 3300046675 | Ga0495657_0008675 | Ga0495657_0008675_5047_5823 | 247 |
| 241 | 3300046679 | Ga0495623_0011265 | Ga0495623_0011265_2669_3445 | 247 |
| 242 | 3300046680 | Ga0495646_0051044 | Ga0495646_0051044_306_1082 | 247 |
| 243 | 3300046689 | Ga0495613_0034342 | Ga0495613_0034342_2168_2944 | 247 |
| 244 | 3300047444 | Ga0495675_0151883 | Ga0495675_0151883_434_1210 | 247 |
| 245 | 3300047471 | Ga0495684_0010530 | Ga0495684_0010530_5218_5994 | 247 |
| 246 | 3300047673 | Ga0495593_0031403 | Ga0495593_0031403_960_1736 | 247 |
| 247 | 3300048088 | Ga0495602_0033120 | Ga0495602_0033120_118_894 | 247 |
| 248 | 3300048905 | Ga0496102_0058766 | Ga0496102_0058766_1844_2617 | 247 |
| 249 | 3300048907 | Ga0496104_0018839 | Ga0496104_0018839_2581_3354 | 247 |
| 250 | 3300048909 | Ga0496106_0003104 | Ga0496106_0003104_7259_8032 | 247 |
| 251 | 3300048910 | Ga0496107_0006959 | Ga0496107_0006959_5851_6624 | 247 |
| 252 | 3300048911 | Ga0496108_0002900 | Ga0496108_0002900_12145_12918 | 247 |
| 253 | 3300048912 | Ga0496109_0002875 | Ga0496109_0002875_710_1483 | 247 |
| 254 | 3300048912 | Ga0496109_0213881 | Ga0496109_0213881_693_1457 | 247 |
| 255 | 3300048913 | Ga0496110_0014112 | Ga0496110_0014112_1657_2430 | 247 |
| 256 | 3300048913 | Ga0496110_0142471 | Ga0496110_0142471_981_1739 | 247 |
| 257 | 3300048915 | Ga0496112_0026862 | Ga0496112_0026862_815_1588 | 247 |
| 258 | 3300048915 | Ga0496112_0446735 | Ga0496112_0446735_316_1074 | 247 |
| 259 | 3300048916 | Ga0496113_0042681 | Ga0496113_0042681_827_1600 | 247 |
| 260 | 3300048918 | Ga0496115_0031524 | Ga0496115_0031524_2063_2836 | 247 |
| 261 | 3300048929 | Ga0496126_0039704 | Ga0496126_0039704_3107_3874 | 247 |
| 262 | 3300050493 | nmdc:mga0k408_8246_c1 | nmdc:mga0k408_8246_c1_4201_4959 | 247 |
| 263 | 3300050507 | nmdc:mga05p37_161675_c1 | nmdc:mga05p37_161675_c1_603_1361 | 247 |
| 264 | 3300053085 | Ga0495619_0000557 | Ga0495619_0000557_21119_21895 | 247 |
| 265 | 3300005937 | Ga0081455_10174921 | Ga0081455_101749212 | 248 |
| 266 | 3300025915 | Ga0207693_10019724 | Ga0207693_100197244 | 248 |
| 267 | 3300028800 | Ga0265338_10302683 | Ga0265338_103026832 | 248 |
| 268 | 3300031235 | Ga0265330_10034863 | Ga0265330_100348634 | 248 |
| 269 | 3300046462 | Ga0495651_0199431 | Ga0495651_0199431_492_1265 | 248 |
| 270 | 3300047472 | Ga0495686_0139551 | Ga0495686_0139551_322_1080 | 248 |
| 271 | 3300048924 | Ga0496121_0000230 | Ga0496121_0000230_115378_116136 | 248 |
| 272 | 3300053119 | Ga0500595_000407 | Ga0500595_000407_2134_2892 | 248 |
| 273 | 3300053139 | Ga0500568_0020133 | Ga0500568_0020133_863_1621 | 248 |
| 274 | 3300003215 | JGI25153J46596_10003323 | JGI25153J46596_100033232 | 249 |
| 275 | 3300005329 | Ga0070683_100002101 | Ga0070683_1000021012 | 249 |
| 276 | 3300005329 | Ga0070683_100003746 | Ga0070683_1000037464 | 249 |
| 277 | 3300005336 | Ga0070680_100026227 | Ga0070680_1000262275 | 249 |
| 278 | 3300005336 | Ga0070680_100041937 | Ga0070680_1000419375 | 249 |
| 279 | 3300005336 | Ga0070680_100157997 | Ga0070680_1001579972 | 249 |
| 280 | 3300005339 | Ga0070660_100313105 | Ga0070660_1003131052 | 249 |
| 281 | 3300005344 | Ga0070661_100142530 | Ga0070661_1001425302 | 249 |
| 282 | 3300005434 | Ga0070709_10012949 | Ga0070709_100129495 | 249 |
| 283 | 3300005436 | Ga0070713_100016379 | Ga0070713_1000163791 | 249 |
| 284 | 3300005436 | Ga0070713_100232989 | Ga0070713_1002329892 | 249 |
| 285 | 3300005437 | Ga0070710_10024250 | Ga0070710_100242503 | 249 |
| 286 | 3300005437 | Ga0070710_10047236 | Ga0070710_100472364 | 249 |
| 287 | 3300005437 | Ga0070710_10063463 | Ga0070710_100634634 | 249 |
| 288 | 3300005439 | Ga0070711_100031068 | Ga0070711_1000310684 | 249 |
| 289 | 3300005439 | Ga0070711_100268440 | Ga0070711_1002684401 | 249 |
| 290 | 3300005455 | Ga0070663_100685642 | Ga0070663_1006856421 | 249 |
| 291 | 3300005458 | Ga0070681_10110910 | Ga0070681_101109104 | 249 |
| 292 | 3300005458 | Ga0070681_10149452 | Ga0070681_101494521 | 249 |
| 293 | 3300005467 | Ga0070706_100228815 | Ga0070706_1002288151 | 249 |
| 294 | 3300005468 | Ga0070707_100132939 | Ga0070707_1001329393 | 249 |
| 295 | 3300005530 | Ga0070679_100005873 | Ga0070679_1000058734 | 249 |
| 296 | 3300005530 | Ga0070679_100027524 | Ga0070679_1000275246 | 249 |
| 297 | 3300005530 | Ga0070679_100030562 | Ga0070679_1000305624 | 249 |
| 298 | 3300005530 | Ga0070679_100145182 | Ga0070679_1001451824 | 249 |
| 299 | 3300005535 | Ga0070684_100054648 | Ga0070684_1000546484 | 249 |
| 300 | 3300005535 | Ga0070684_100093310 | Ga0070684_1000933104 | 249 |
| 301 | 3300005535 | Ga0070684_100198510 | Ga0070684_1001985101 | 249 |
| 302 | 3300005539 | Ga0068853_100559339 | Ga0068853_1005593391 | 249 |
| 303 | 3300005563 | Ga0068855_100040685 | Ga0068855_1000406857 | 249 |
| 304 | 3300005563 | Ga0068855_100169680 | Ga0068855_1001696802 | 249 |
| 305 | 3300005563 | Ga0068855_100349199 | Ga0068855_1003491993 | 249 |
| 306 | 3300005614 | Ga0068856_100119855 | Ga0068856_1001198554 | 249 |
| 307 | 3300005614 | Ga0068856_100502444 | Ga0068856_1005024442 | 249 |
| 308 | 3300005616 | Ga0068852_100740895 | Ga0068852_1007408951 | 249 |
| 309 | 3300005843 | Ga0068860_100000081 | Ga0068860_100000081130 | 249 |
| 310 | 3300005983 | Ga0081540_1005540 | Ga0081540_10055406 | 249 |
| 311 | 3300005983 | Ga0081540_1048993 | Ga0081540_10489934 | 249 |
| 312 | 3300005983 | Ga0081540_1134530 | Ga0081540_11345301 | 249 |
| 313 | 3300006028 | Ga0070717_10049634 | Ga0070717_100496342 | 249 |
| 314 | 3300006175 | Ga0070712_100034839 | Ga0070712_1000348393 | 249 |
| 315 | 3300006175 | Ga0070712_100073280 | Ga0070712_1000732802 | 249 |
| 316 | 3300006175 | Ga0070712_100278340 | Ga0070712_1002783402 | 249 |
| 317 | 3300006175 | Ga0070712_100455498 | Ga0070712_1004554982 | 249 |
| 318 | 3300006237 | Ga0097621_100134565 | Ga0097621_1001345654 | 249 |
| 319 | 3300006358 | Ga0068871_100031590 | Ga0068871_1000315903 | 249 |
| 320 | 3300006358 | Ga0068871_100129359 | Ga0068871_1001293592 | 249 |
| 321 | 3300006881 | Ga0068865_100024309 | Ga0068865_1000243092 | 249 |
| 322 | 3300006881 | Ga0068865_100181529 | Ga0068865_1001815293 | 249 |
| 323 | 3300006914 | Ga0075436_100257481 | Ga0075436_1002574812 | 249 |
| 324 | 3300006941 | Ga0099825_1027119 | Ga0099825_10271192 | 249 |
| 325 | 3300006941 | Ga0099825_1036202 | Ga0099825_10362022 | 249 |
| 326 | 3300006942 | Ga0099824_1008208 | Ga0099824_10082086 | 249 |
| 327 | 3300006944 | Ga0099823_1069183 | Ga0099823_10691832 | 249 |
| 328 | 3300007076 | Ga0075435_100088546 | Ga0075435_1000885463 | 249 |
| 329 | 3300009093 | Ga0105240_10006945 | Ga0105240_1000694513 | 249 |
| 330 | 3300009093 | Ga0105240_10074116 | Ga0105240_100741165 | 249 |
| 331 | 3300009093 | Ga0105240_10128623 | Ga0105240_101286234 | 249 |
| 332 | 3300009093 | Ga0105240_10157827 | Ga0105240_101578272 | 249 |
| 333 | 3300009098 | Ga0105245_10041292 | Ga0105245_100412925 | 249 |
| 334 | 3300009098 | Ga0105245_10042042 | Ga0105245_100420424 | 249 |
| 335 | 3300009098 | Ga0105245_10246306 | Ga0105245_102463062 | 249 |
| 336 | 3300009174 | Ga0105241_10145845 | Ga0105241_101458454 | 249 |
| 337 | 3300009177 | Ga0105248_11229537 | Ga0105248_112295371 | 249 |
| 338 | 3300009545 | Ga0105237_10012502 | Ga0105237_100125023 | 249 |
| 339 | 3300009551 | Ga0105238_10415542 | Ga0105238_104155422 | 249 |
| 340 | 3300010375 | Ga0105239_10052277 | Ga0105239_100522772 | 249 |
| 341 | 3300010375 | Ga0105239_10215656 | Ga0105239_102156562 | 249 |
| 342 | 3300010375 | Ga0105239_10229696 | Ga0105239_102296964 | 249 |
| 343 | 3300010375 | Ga0105239_10342604 | Ga0105239_103426042 | 249 |
| 344 | 3300011119 | Ga0105246_10021797 | Ga0105246_100217972 | 249 |
| 345 | 3300013104 | Ga0157370_10030019 | Ga0157370_100300196 | 249 |
| 346 | 3300013105 | Ga0157369_10007421 | Ga0157369_100074218 | 249 |
| 347 | 3300013105 | Ga0157369_10016145 | Ga0157369_100161457 | 249 |
| 348 | 3300013296 | Ga0157374_10021619 | Ga0157374_100216194 | 249 |
| 349 | 3300013297 | Ga0157378_10009553 | Ga0157378_100095533 | 249 |
| 350 | 3300013297 | Ga0157378_10054478 | Ga0157378_100544785 | 249 |
| 351 | 3300013306 | Ga0163162_10067831 | Ga0163162_100678313 | 249 |
| 352 | 3300013307 | Ga0157372_10080864 | Ga0157372_100808645 | 249 |
| 353 | 3300013307 | Ga0157372_10177241 | Ga0157372_101772412 | 249 |
| 354 | 3300013307 | Ga0157372_10314569 | Ga0157372_103145692 | 249 |
| 355 | 3300013308 | Ga0157375_10012564 | Ga0157375_100125645 | 249 |
| 356 | 3300014325 | Ga0163163_10013378 | Ga0163163_100133785 | 249 |
| 357 | 3300014968 | Ga0157379_10084510 | Ga0157379_100845102 | 249 |
| 358 | 3300014969 | Ga0157376_10006417 | Ga0157376_100064173 | 249 |
| 359 | 3300017792 | Ga0163161_10320706 | Ga0163161_103207061 | 249 |
| 360 | 3300020081 | Ga0206354_10458954 | Ga0206354_104589542 | 249 |
| 361 | 3300020082 | Ga0206353_12012706 | Ga0206353_120127061 | 249 |
| 362 | 3300021377 | Ga0213874_10003010 | Ga0213874_100030101 | 249 |
| 363 | 3300021384 | Ga0213876_10059895 | Ga0213876_100598954 | 249 |
| 364 | 3300025253 | Ga0209677_100210 | Ga0209677_10021018 | 249 |
| 365 | 3300025254 | Ga0209148_1000180 | Ga0209148_100018035 | 249 |
| 366 | 3300025254 | Ga0209148_1003954 | Ga0209148_10039543 | 249 |
| 367 | 3300025261 | Ga0209233_1001530 | Ga0209233_10015306 | 249 |
| 368 | 3300025261 | Ga0209233_1009847 | Ga0209233_10098472 | 249 |
| 369 | 3300025272 | Ga0209455_1000620 | Ga0209455_100062012 | 249 |
| 370 | 3300025272 | Ga0209455_1007098 | Ga0209455_10070982 | 249 |
| 371 | 3300025297 | Ga0209758_1001429 | Ga0209758_100142921 | 249 |
| 372 | 3300025297 | Ga0209758_1001880 | Ga0209758_100188014 | 249 |
| 373 | 3300025302 | Ga0207426_1000620 | Ga0207426_100062032 | 249 |
| 374 | 3300025321 | Ga0207656_10159053 | Ga0207656_101590532 | 249 |
| 375 | 3300025898 | Ga0207692_10005492 | Ga0207692_100054924 | 249 |
| 376 | 3300025898 | Ga0207692_10060370 | Ga0207692_100603704 | 249 |
| 377 | 3300025900 | Ga0207710_10030808 | Ga0207710_100308082 | 249 |
| 378 | 3300025905 | Ga0207685_10026343 | Ga0207685_100263433 | 249 |
| 379 | 3300025906 | Ga0207699_10034223 | Ga0207699_100342234 | 249 |
| 380 | 3300025906 | Ga0207699_10038517 | Ga0207699_100385172 | 249 |
| 381 | 3300025906 | Ga0207699_10073848 | Ga0207699_100738481 | 249 |
| 382 | 3300025909 | Ga0207705_10118468 | Ga0207705_101184682 | 249 |
| 383 | 3300025910 | Ga0207684_10135572 | Ga0207684_101355721 | 249 |
| 384 | 3300025911 | Ga0207654_10059170 | Ga0207654_100591703 | 249 |
| 385 | 3300025911 | Ga0207654_10146593 | Ga0207654_101465932 | 249 |
| 386 | 3300025912 | Ga0207707_10000916 | Ga0207707_1000091622 | 249 |
| 387 | 3300025912 | Ga0207707_10051186 | Ga0207707_100511864 | 249 |
| 388 | 3300025912 | Ga0207707_10539242 | Ga0207707_105392421 | 249 |
| 389 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008733 | 249 |
| 390 | 3300025913 | Ga0207695_10022496 | Ga0207695_100224962 | 249 |
| 391 | 3300025913 | Ga0207695_10029844 | Ga0207695_100298446 | 249 |
| 392 | 3300025913 | Ga0207695_10054668 | Ga0207695_100546685 | 249 |
| 393 | 3300025913 | Ga0207695_10126645 | Ga0207695_101266454 | 249 |
| 394 | 3300025914 | Ga0207671_10072463 | Ga0207671_100724634 | 249 |
| 395 | 3300025914 | Ga0207671_10077041 | Ga0207671_100770414 | 249 |
| 396 | 3300025914 | Ga0207671_10133891 | Ga0207671_101338912 | 249 |
| 397 | 3300025915 | Ga0207693_10054006 | Ga0207693_100540063 | 249 |
| 398 | 3300025915 | Ga0207693_10298796 | Ga0207693_102987962 | 249 |
| 399 | 3300025916 | Ga0207663_10033274 | Ga0207663_100332741 | 249 |
| 400 | 3300025916 | Ga0207663_10064826 | Ga0207663_100648262 | 249 |
| 401 | 3300025917 | Ga0207660_10021110 | Ga0207660_100211102 | 249 |
| 402 | 3300025917 | Ga0207660_10129847 | Ga0207660_101298472 | 249 |
| 403 | 3300025919 | Ga0207657_10430182 | Ga0207657_104301822 | 249 |
| 404 | 3300025920 | Ga0207649_10091894 | Ga0207649_100918941 | 249 |
| 405 | 3300025920 | Ga0207649_10318199 | Ga0207649_103181992 | 249 |
| 406 | 3300025921 | Ga0207652_10038672 | Ga0207652_100386722 | 249 |
| 407 | 3300025921 | Ga0207652_10069643 | Ga0207652_100696434 | 249 |
| 408 | 3300025921 | Ga0207652_10136727 | Ga0207652_101367274 | 249 |
| 409 | 3300025921 | Ga0207652_10180742 | Ga0207652_101807422 | 249 |
| 410 | 3300025924 | Ga0207694_10073020 | Ga0207694_100730202 | 249 |
| 411 | 3300025924 | Ga0207694_10397175 | Ga0207694_103971751 | 249 |
| 412 | 3300025927 | Ga0207687_10008249 | Ga0207687_100082492 | 249 |
| 413 | 3300025927 | Ga0207687_10271898 | Ga0207687_102718982 | 249 |
| 414 | 3300025928 | Ga0207700_10003970 | Ga0207700_100039705 | 249 |
| 415 | 3300025928 | Ga0207700_10055560 | Ga0207700_100555604 | 249 |
| 416 | 3300025928 | Ga0207700_10057722 | Ga0207700_100577222 | 249 |
| 417 | 3300025929 | Ga0207664_10060274 | Ga0207664_100602742 | 249 |
| 418 | 3300025929 | Ga0207664_10622983 | Ga0207664_106229832 | 249 |
| 419 | 3300025938 | Ga0207704_10235747 | Ga0207704_102357471 | 249 |
| 420 | 3300025939 | Ga0207665_10082708 | Ga0207665_100827084 | 249 |
| 421 | 3300025941 | Ga0207711_10348564 | Ga0207711_103485642 | 249 |
| 422 | 3300025944 | Ga0207661_10002064 | Ga0207661_1000206410 | 249 |
| 423 | 3300025944 | Ga0207661_10002496 | Ga0207661_100024965 | 249 |
| 424 | 3300025944 | Ga0207661_10341620 | Ga0207661_103416201 | 249 |
| 425 | 3300025944 | Ga0207661_10364813 | Ga0207661_103648132 | 249 |
| 426 | 3300025945 | Ga0207679_10298706 | Ga0207679_102987062 | 249 |
| 427 | 3300025949 | Ga0207667_10018061 | Ga0207667_100180619 | 249 |
| 428 | 3300025949 | Ga0207667_10274050 | Ga0207667_102740503 | 249 |
| 429 | 3300025949 | Ga0207667_10298458 | Ga0207667_102984583 | 249 |
| 430 | 3300025949 | Ga0207667_10612597 | Ga0207667_106125972 | 249 |
| 431 | 3300025981 | Ga0207640_10481263 | Ga0207640_104812631 | 249 |
| 432 | 3300026041 | Ga0207639_10598686 | Ga0207639_105986862 | 249 |
| 433 | 3300026067 | Ga0207678_10041101 | Ga0207678_100411012 | 249 |
| 434 | 3300026078 | Ga0207702_10155120 | Ga0207702_101551202 | 249 |
| 435 | 3300026078 | Ga0207702_10458614 | Ga0207702_104586142 | 249 |
| 436 | 3300026078 | Ga0207702_10565238 | Ga0207702_105652382 | 249 |
| 437 | 3300026118 | Ga0207675_100443744 | Ga0207675_1004437442 | 249 |
| 438 | 3300026121 | Ga0207683_10010904 | Ga0207683_100109045 | 249 |
| 439 | 3300026142 | Ga0207698_10042683 | Ga0207698_100426832 | 249 |
| 440 | 3300026142 | Ga0207698_10058662 | Ga0207698_100586622 | 249 |
| 441 | 3300027296 | Ga0209389_1000001 | Ga0209389_1000001202 | 249 |
| 442 | 3300027357 | Ga0209589_1000014 | Ga0209589_1000014138 | 249 |
| 443 | 3300027361 | Ga0209489_100014 | Ga0209489_100014138 | 249 |
| 444 | 3300027361 | Ga0209489_119997 | Ga0209489_1199972 | 249 |
| 445 | 3300027363 | Ga0209700_100007 | Ga0209700_100007222 | 249 |
| 446 | 3300027363 | Ga0209700_100024 | Ga0209700_100024138 | 249 |
| 447 | 3300027512 | Ga0209179_1035618 | Ga0209179_10356182 | 249 |
| 448 | 3300028381 | Ga0268264_10000048 | Ga0268264_10000048122 | 249 |
| 449 | 3300030521 | Ga0307511_10022568 | Ga0307511_100225682 | 249 |
| 450 | 3300031247 | Ga0265340_10071372 | Ga0265340_100713721 | 249 |
| 451 | 3300031249 | Ga0265339_10016773 | Ga0265339_100167733 | 249 |
| 452 | 3300031507 | Ga0307509_10074244 | Ga0307509_100742444 | 249 |
| 453 | 3300031507 | Ga0307509_10140206 | Ga0307509_101402063 | 249 |
| 454 | 3300031595 | Ga0265313_10114165 | Ga0265313_101141651 | 249 |
| 455 | 3300031616 | Ga0307508_10000032 | Ga0307508_10000032110 | 249 |
| 456 | 3300031616 | Ga0307508_10076043 | Ga0307508_100760433 | 249 |
| 457 | 3300031711 | Ga0265314_10024001 | Ga0265314_100240014 | 249 |
| 458 | 3300033442 | Ga0315911_1000002 | Ga0315911_1000002190 | 249 |
| 459 | 3300033544 | Ga0316215_1009399 | Ga0316215_10093991 | 249 |
| 460 | 3300035083 | Ga0373926_0017225 | Ga0373926_0017225_487_1272 | 249 |
| 461 | 3300035083 | Ga0373926_0022939 | Ga0373926_0022939_767_1528 | 249 |
| 462 | 3300035086 | Ga0373934_0033956 | Ga0373934_0033956_1022_1807 | 249 |
| 463 | 3300035113 | Ga0373936_0003229 | Ga0373936_0003229_4039_4824 | 249 |
| 464 | 3300035113 | Ga0373936_0021224 | Ga0373936_0021224_1423_2187 | 249 |
| 465 | 3300035113 | Ga0373936_0103265 | Ga0373936_0103265_161_925 | 249 |
| 466 | 3300035116 | Ga0373945_0009107 | Ga0373945_0009107_1933_2718 | 249 |
| 467 | 3300035118 | Ga0373954_0006338 | Ga0373954_0006338_2435_3220 | 249 |
| 468 | 3300035119 | Ga0373956_0011739 | Ga0373956_0011739_1691_2476 | 249 |
| 469 | 3300035170 | Ga0373943_0008120 | Ga0373943_0008120_3784_4569 | 249 |
| 470 | 3300035171 | Ga0373946_0003292 | Ga0373946_0003292_2616_3401 | 249 |
| 471 | 3300035171 | Ga0373946_0159889 | Ga0373946_0159889_244_1008 | 249 |
| 472 | 3300035692 | Ga0373935_0007483 | Ga0373935_0007483_3830_4591 | 249 |
| 473 | 3300035692 | Ga0373935_0014513 | Ga0373935_0014513_2563_3348 | 249 |
| 474 | 3300035692 | Ga0373935_0076609 | Ga0373935_0076609_1122_1886 | 249 |
| 475 | 3300035695 | Ga0373927_0005166 | Ga0373927_0005166_7762_8523 | 249 |
| 476 | 3300035695 | Ga0373927_0017851 | Ga0373927_0017851_225_989 | 249 |
| 477 | 3300035695 | Ga0373927_0020402 | Ga0373927_0020402_3468_4229 | 249 |
| 478 | 3300035695 | Ga0373927_0077200 | Ga0373927_0077200_1241_2005 | 249 |
| 479 | 3300035724 | Ga0373933_0000406 | Ga0373933_0000406_19332_20099 | 249 |
| 480 | 3300035724 | Ga0373933_0096426 | Ga0373933_0096426_528_1313 | 249 |
| 481 | 3300035725 | Ga0373947_0110170 | Ga0373947_0110170_421_1185 | 249 |
| 482 | 3300036401 | Ga0373937_0146362 | Ga0373937_0146362_1195_1980 | 249 |
| 483 | 3300037068 | Ga0373925_0104858 | Ga0373925_0104858_45_806 | 249 |
| 484 | 3300037068 | Ga0373925_0177234 | Ga0373925_0177234_120_884 | 249 |
| 485 | 3300037418 | Ga0395900_0000948 | Ga0395900_0000948_23199_23963 | 249 |
| 486 | 3300037418 | Ga0395900_0048549 | Ga0395900_0048549_2080_2865 | 249 |
| 487 | 3300037466 | Ga0395898_0370698 | Ga0395898_0370698_406_1191 | 249 |
| 488 | 3300037853 | Ga0436364_0519650 | Ga0436364_0519650_1214_1993 | 249 |
| 489 | 3300039437 | Ga0436365_0227213 | Ga0436365_0227213_746_1525 | 249 |
| 490 | 3300039437 | Ga0436365_0230691 | Ga0436365_0230691_24_821 | 249 |
| 491 | 3300039437 | Ga0436365_1558214 | Ga0436365_1558214_932_1699 | 249 |
| 492 | 3300039437 | Ga0436365_1580667 | Ga0436365_1580667_4433_5230 | 249 |
| 493 | 3300039438 | Ga0436360_0655438 | Ga0436360_0655438_2295_3065 | 249 |
| 494 | 3300039447 | Ga0436361_0216778 | Ga0436361_0216778_563_1330 | 249 |
| 495 | 3300039447 | Ga0436361_0248601 | Ga0436361_0248601_681_1451 | 249 |
| 496 | 3300039447 | Ga0436361_0785428 | Ga0436361_0785428_169_972 | 249 |
| 497 | 3300039450 | Ga0436363_0362302 | Ga0436363_0362302_3902_4666 | 249 |
| 498 | 3300039453 | Ga0436362_1193065 | Ga0436362_1193065_923_1693 | 249 |
| 499 | 3300044658 | Ga0466972_0001899 | Ga0466972_0001899_6255_7019 | 249 |
| 500 | 3300044683 | Ga0466965_0126569 | Ga0466965_0126569_449_1213 | 249 |
| 501 | 3300044683 | Ga0466965_0149087 | Ga0466965_0149087_396_1184 | 249 |
| 502 | 3300044684 | Ga0466966_0063523 | Ga0466966_0063523_1282_2046 | 249 |
| 503 | 3300044684 | Ga0466966_0137292 | Ga0466966_0137292_268_1056 | 249 |
| 504 | 3300044693 | Ga0466961_0000050 | Ga0466961_0000050_43625_44389 | 249 |
| 505 | 3300044694 | Ga0466963_0156531 | Ga0466963_0156531_789_1553 | 249 |
| 506 | 3300044735 | Ga0466968_0079107 | Ga0466968_0079107_492_1280 | 249 |
| 507 | 3300044735 | Ga0466968_0095810 | Ga0466968_0095810_223_987 | 249 |
| 508 | 3300044765 | Ga0466970_0262392 | Ga0466970_0262392_185_955 | 249 |
| 509 | 3300044842 | Ga0466957_0171864 | Ga0466957_0171864_509_1273 | 249 |
| 510 | 3300044901 | Ga0466960_0118840 | Ga0466960_0118840_300_1064 | 249 |
| 511 | 3300045049 | Ga0466959_0005557 | Ga0466959_0005557_6091_6855 | 249 |
| 512 | 3300045049 | Ga0466959_0016947 | Ga0466959_0016947_1881_2669 | 249 |
| 513 | 3300045049 | Ga0466959_0270002 | Ga0466959_0270002_35_805 | 249 |
| 514 | 3300045836 | Ga0466958_0107646 | Ga0466958_0107646_923_1711 | 249 |
| 515 | 3300045976 | Ga0466967_0095054 | Ga0466967_0095054_1605_2390 | 249 |
| 516 | 3300045976 | Ga0466967_0132737 | Ga0466967_0132737_1179_1943 | 249 |
| 517 | 3300045976 | Ga0466967_0259926 | Ga0466967_0259926_552_1316 | 249 |
| 518 | 3300046454 | Ga0495592_0016464 | Ga0495592_0016464_2310_3095 | 249 |
| 519 | 3300046455 | Ga0495603_0062365 | Ga0495603_0062365_1205_1969 | 249 |
| 520 | 3300046455 | Ga0495603_0306441 | Ga0495603_0306441_75_839 | 249 |
| 521 | 3300046459 | Ga0495629_0004164 | Ga0495629_0004164_7484_8248 | 249 |
| 522 | 3300046459 | Ga0495629_0316027 | Ga0495629_0316027_111_872 | 249 |
| 523 | 3300046463 | Ga0495653_0106668 | Ga0495653_0106668_458_1243 | 249 |
| 524 | 3300046472 | Ga0495580_0004514 | Ga0495580_0004514_3811_4596 | 249 |
| 525 | 3300046472 | Ga0495580_0410943 | Ga0495580_0410943_120_884 | 249 |
| 526 | 3300046473 | Ga0495582_0041115 | Ga0495582_0041115_488_1273 | 249 |
| 527 | 3300046473 | Ga0495582_0064270 | Ga0495582_0064270_1101_1865 | 249 |
| 528 | 3300046473 | Ga0495582_0099343 | Ga0495582_0099343_315_1079 | 249 |
| 529 | 3300046475 | Ga0495639_0004971 | Ga0495639_0004971_3955_4740 | 249 |
| 530 | 3300046477 | Ga0495664_0019517 | Ga0495664_0019517_2118_2903 | 249 |
| 531 | 3300046499 | Ga0495594_0067294 | Ga0495594_0067294_1021_1785 | 249 |
| 532 | 3300046506 | Ga0495583_0074593 | Ga0495583_0074593_79_843 | 249 |
| 533 | 3300046507 | Ga0495606_0061638 | Ga0495606_0061638_1620_2381 | 249 |
| 534 | 3300046507 | Ga0495606_0138159 | Ga0495606_0138159_91_855 | 249 |
| 535 | 3300046514 | Ga0495618_0064109 | Ga0495618_0064109_1187_1972 | 249 |
| 536 | 3300046514 | Ga0495618_0135281 | Ga0495618_0135281_280_1044 | 249 |
| 537 | 3300046517 | Ga0495630_0061693 | Ga0495630_0061693_1038_1823 | 249 |
| 538 | 3300046518 | Ga0495631_0112100 | Ga0495631_0112100_234_1004 | 249 |
| 539 | 3300046526 | Ga0495666_0061310 | Ga0495666_0061310_976_1761 | 249 |
| 540 | 3300046529 | Ga0495652_0063455 | Ga0495652_0063455_1860_2645 | 249 |
| 541 | 3300046529 | Ga0495652_0221291 | Ga0495652_0221291_627_1391 | 249 |
| 542 | 3300046531 | Ga0495665_0012269 | Ga0495665_0012269_3530_4315 | 249 |
| 543 | 3300046533 | Ga0495640_0029778 | Ga0495640_0029778_2078_2863 | 249 |
| 544 | 3300046533 | Ga0495640_0031288 | Ga0495640_0031288_491_1255 | 249 |
| 545 | 3300046536 | Ga0495587_0112409 | Ga0495587_0112409_303_1088 | 249 |
| 546 | 3300046543 | Ga0495645_0093671 | Ga0495645_0093671_1311_2096 | 249 |
| 547 | 3300046543 | Ga0495645_0146919 | Ga0495645_0146919_172_960 | 249 |
| 548 | 3300046559 | Ga0495667_0068906 | Ga0495667_0068906_1193_1978 | 249 |
| 549 | 3300046663 | Ga0495635_0001219 | Ga0495635_0001219_16022_16786 | 249 |
| 550 | 3300046663 | Ga0495635_0010817 | Ga0495635_0010817_686_1471 | 249 |
| 551 | 3300046675 | Ga0495657_0023046 | Ga0495657_0023046_134_898 | 249 |
| 552 | 3300046683 | Ga0495658_0024424 | Ga0495658_0024424_1396_2181 | 249 |
| 553 | 3300046683 | Ga0495658_0061147 | Ga0495658_0061147_1295_2056 | 249 |
| 554 | 3300046689 | Ga0495613_0054981 | Ga0495613_0054981_1769_2554 | 249 |
| 555 | 3300046690 | Ga0495624_0034608 | Ga0495624_0034608_2118_2903 | 249 |
| 556 | 3300046690 | Ga0495624_0039263 | Ga0495624_0039263_2211_2975 | 249 |
| 557 | 3300046690 | Ga0495624_0188699 | Ga0495624_0188699_182_946 | 249 |
| 558 | 3300046694 | Ga0495649_0079714 | Ga0495649_0079714_424_1188 | 249 |
| 559 | 3300047315 | Ga0495581_0021847 | Ga0495581_0021847_2469_3233 | 249 |
| 560 | 3300047315 | Ga0495581_0043324 | Ga0495581_0043324_1596_2381 | 249 |
| 561 | 3300047315 | Ga0495581_0151367 | Ga0495581_0151367_385_1146 | 249 |
| 562 | 3300047317 | Ga0495604_0314615 | Ga0495604_0314615_241_1026 | 249 |
| 563 | 3300047319 | Ga0495674_0216183 | Ga0495674_0216183_641_1405 | 249 |
| 564 | 3300047319 | Ga0495674_0413141 | Ga0495674_0413141_270_1037 | 249 |
| 565 | 3300047319 | Ga0495674_0589442 | Ga0495674_0589442_16_780 | 249 |
| 566 | 3300047320 | Ga0495672_0145806 | Ga0495672_0145806_17_778 | 249 |
| 567 | 3300047321 | Ga0495676_0184673 | Ga0495676_0184673_299_1063 | 249 |
| 568 | 3300047471 | Ga0495684_0019701 | Ga0495684_0019701_2982_3767 | 249 |
| 569 | 3300047673 | Ga0495593_0028308 | Ga0495593_0028308_2240_3025 | 249 |
| 570 | 3300047673 | Ga0495593_0042204 | Ga0495593_0042204_97_861 | 249 |
| 571 | 3300048088 | Ga0495602_0286678 | Ga0495602_0286678_45_806 | 249 |
| 572 | 3300048903 | Ga0496100_0089884 | Ga0496100_0089884_155_919 | 249 |
| 573 | 3300048903 | Ga0496100_0262968 | Ga0496100_0262968_465_1229 | 249 |
| 574 | 3300048903 | Ga0496100_0405975 | Ga0496100_0405975_66_830 | 249 |
| 575 | 3300048903 | Ga0496100_0487555 | Ga0496100_0487555_66_830 | 249 |
| 576 | 3300048904 | Ga0496101_0075626 | Ga0496101_0075626_1298_2062 | 249 |
| 577 | 3300048904 | Ga0496101_0148703 | Ga0496101_0148703_754_1518 | 249 |
| 578 | 3300048905 | Ga0496102_0114298 | Ga0496102_0114298_1235_1999 | 249 |
| 579 | 3300048905 | Ga0496102_0146084 | Ga0496102_0146084_656_1420 | 249 |
| 580 | 3300048905 | Ga0496102_0585047 | Ga0496102_0585047_110_874 | 249 |
| 581 | 3300048906 | Ga0496103_0020025 | Ga0496103_0020025_463_1227 | 249 |
| 582 | 3300048907 | Ga0496104_0098246 | Ga0496104_0098246_1941_2705 | 249 |
| 583 | 3300048908 | Ga0496105_0016130 | Ga0496105_0016130_2646_3410 | 249 |
| 584 | 3300048908 | Ga0496105_0063988 | Ga0496105_0063988_485_1249 | 249 |
| 585 | 3300048909 | Ga0496106_0000240 | Ga0496106_0000240_29625_30386 | 249 |
| 586 | 3300048910 | Ga0496107_0050244 | Ga0496107_0050244_1209_1973 | 249 |
| 587 | 3300048911 | Ga0496108_0015092 | Ga0496108_0015092_4766_5530 | 249 |
| 588 | 3300048913 | Ga0496110_0034780 | Ga0496110_0034780_3036_3800 | 249 |
| 589 | 3300048914 | Ga0496111_0101097 | Ga0496111_0101097_590_1354 | 249 |
| 590 | 3300048915 | Ga0496112_0004764 | Ga0496112_0004764_2477_3241 | 249 |
| 591 | 3300048915 | Ga0496112_0661452 | Ga0496112_0661452_97_873 | 249 |
| 592 | 3300048916 | Ga0496113_0005360 | Ga0496113_0005360_2790_3554 | 249 |
| 593 | 3300048916 | Ga0496113_0183206 | Ga0496113_0183206_551_1315 | 249 |
| 594 | 3300048916 | Ga0496113_0439440 | Ga0496113_0439440_73_849 | 249 |
| 595 | 3300048917 | Ga0496114_0066871 | Ga0496114_0066871_1760_2524 | 249 |
| 596 | 3300048917 | Ga0496114_0286060 | Ga0496114_0286060_592_1356 | 249 |
| 597 | 3300048917 | Ga0496114_0684180 | Ga0496114_0684180_79_843 | 249 |
| 598 | 3300048918 | Ga0496115_0004354 | Ga0496115_0004354_666_1430 | 249 |
| 599 | 3300048918 | Ga0496115_0365512 | Ga0496115_0365512_119_883 | 249 |
| 600 | 3300048918 | Ga0496115_0394969 | Ga0496115_0394969_245_1009 | 249 |
| 601 | 3300048920 | Ga0496117_0059196 | Ga0496117_0059196_1139_1900 | 249 |
| 602 | 3300048920 | Ga0496117_0272441 | Ga0496117_0272441_11_781 | 249 |
| 603 | 3300048921 | Ga0496118_0014922 | Ga0496118_0014922_4949_5710 | 249 |
| 604 | 3300048921 | Ga0496118_0036957 | Ga0496118_0036957_1391_2161 | 249 |
| 605 | 3300048921 | Ga0496118_0137954 | Ga0496118_0137954_16_780 | 249 |
| 606 | 3300048922 | Ga0496119_0007401 | Ga0496119_0007401_6407_7171 | 249 |
| 607 | 3300048922 | Ga0496119_0053987 | Ga0496119_0053987_1646_2407 | 249 |
| 608 | 3300048923 | Ga0496120_0042313 | Ga0496120_0042313_456_1220 | 249 |
| 609 | 3300048924 | Ga0496121_0004398 | Ga0496121_0004398_13510_14271 | 249 |
| 610 | 3300048924 | Ga0496121_0080720 | Ga0496121_0080720_865_1650 | 249 |
| 611 | 3300048924 | Ga0496121_0195417 | Ga0496121_0195417_16_786 | 249 |
| 612 | 3300048925 | Ga0496122_0060463 | Ga0496122_0060463_216_980 | 249 |
| 613 | 3300048928 | Ga0496125_0057016 | Ga0496125_0057016_281_1045 | 249 |
| 614 | 3300048928 | Ga0496125_0063668 | Ga0496125_0063668_1927_2694 | 249 |
| 615 | 3300048928 | Ga0496125_0072103 | Ga0496125_0072103_1827_2597 | 249 |
| 616 | 3300048928 | Ga0496125_0115698 | Ga0496125_0115698_272_1033 | 249 |
| 617 | 3300048929 | Ga0496126_0005072 | Ga0496126_0005072_2641_3405 | 249 |
| 618 | 3300048929 | Ga0496126_0007510 | Ga0496126_0007510_4429_5193 | 249 |
| 619 | 3300048929 | Ga0496126_0096139 | Ga0496126_0096139_926_1690 | 249 |
| 620 | 3300048929 | Ga0496126_0104813 | Ga0496126_0104813_1456_2220 | 249 |
| 621 | 3300048929 | Ga0496126_0124793 | Ga0496126_0124793_937_1698 | 249 |
| 622 | 3300048929 | Ga0496126_0218933 | Ga0496126_0218933_39_800 | 249 |
| 623 | 3300048929 | Ga0496126_0250775 | Ga0496126_0250775_229_990 | 249 |
| 624 | 3300048929 | Ga0496126_0360391 | Ga0496126_0360391_369_1145 | 249 |
| 625 | 3300049568 | Ga0501031_0001217 | Ga0501031_0001217_6126_6887 | 249 |
| 626 | 3300049569 | Ga0501032_0011357 | Ga0501032_0011357_4894_5655 | 249 |
| 627 | 3300049569 | Ga0501032_0028163 | Ga0501032_0028163_610_1371 | 249 |
| 628 | 3300049569 | Ga0501032_0036558 | Ga0501032_0036558_2463_3224 | 249 |
| 629 | 3300049570 | Ga0501033_0000667 | Ga0501033_0000667_11092_11853 | 249 |
| 630 | 3300049570 | Ga0501033_0004962 | Ga0501033_0004962_5934_6695 | 249 |
| 631 | 3300049570 | Ga0501033_0039325 | Ga0501033_0039325_971_1732 | 249 |
| 632 | 3300049571 | Ga0501034_0001924 | Ga0501034_0001924_14458_15219 | 249 |
| 633 | 3300049571 | Ga0501034_0163614 | Ga0501034_0163614_129_890 | 249 |
| 634 | 3300049572 | Ga0501036_0001359 | Ga0501036_0001359_11084_11845 | 249 |
| 635 | 3300049572 | Ga0501036_0077813 | Ga0501036_0077813_36_797 | 249 |
| 636 | 3300049573 | Ga0501037_0000715 | Ga0501037_0000715_14850_15611 | 249 |
| 637 | 3300049573 | Ga0501037_0068347 | Ga0501037_0068347_1398_2159 | 249 |
| 638 | 3300049574 | Ga0501038_0000342 | Ga0501038_0000342_2400_3161 | 249 |
| 639 | 3300049574 | Ga0501038_0021064 | Ga0501038_0021064_5007_5768 | 249 |
| 640 | 3300049575 | Ga0501039_0001565 | Ga0501039_0001565_10778_11539 | 249 |
| 641 | 3300049575 | Ga0501039_0032158 | Ga0501039_0032158_1990_2751 | 249 |
| 642 | 3300049575 | Ga0501039_0132064 | Ga0501039_0132064_1075_1836 | 249 |
| 643 | 3300049576 | Ga0501040_0020439 | Ga0501040_0020439_328_1089 | 249 |
| 644 | 3300049578 | Ga0501042_0021464 | Ga0501042_0021464_2439_3200 | 249 |
| 645 | 3300049579 | Ga0501043_0000120 | Ga0501043_0000120_63802_64563 | 249 |
| 646 | 3300049579 | Ga0501043_0003554 | Ga0501043_0003554_2467_3228 | 249 |
| 647 | 3300049580 | Ga0501046_0001506 | Ga0501046_0001506_13387_14148 | 249 |
| 648 | 3300049580 | Ga0501046_0082098 | Ga0501046_0082098_707_1468 | 249 |
| 649 | 3300049581 | Ga0501047_0000697 | Ga0501047_0000697_28114_28875 | 249 |
| 650 | 3300049581 | Ga0501047_0008066 | Ga0501047_0008066_4647_5408 | 249 |
| 651 | 3300049581 | Ga0501047_0033590 | Ga0501047_0033590_1118_1900 | 249 |
| 652 | 3300049581 | Ga0501047_0095041 | Ga0501047_0095041_1064_1825 | 249 |
| 653 | 3300049581 | Ga0501047_0440625 | Ga0501047_0440625_157_921 | 249 |
| 654 | 3300049582 | Ga0501048_0000288 | Ga0501048_0000288_11170_11931 | 249 |
| 655 | 3300049582 | Ga0501048_0014507 | Ga0501048_0014507_4778_5539 | 249 |
| 656 | 3300049583 | Ga0501067_0000682 | Ga0501067_0000682_14344_15105 | 249 |
| 657 | 3300049583 | Ga0501067_0074226 | Ga0501067_0074226_707_1468 | 249 |
| 658 | 3300049584 | Ga0501068_0124562 | Ga0501068_0124562_421_1182 | 249 |
| 659 | 3300049586 | Ga0501070_0003047 | Ga0501070_0003047_11092_11853 | 249 |
| 660 | 3300049586 | Ga0501070_0150319 | Ga0501070_0150319_582_1343 | 249 |
| 661 | 3300049586 | Ga0501070_0237769 | Ga0501070_0237769_325_1086 | 249 |
| 662 | 3300049588 | Ga0501072_0000936 | Ga0501072_0000936_5156_5917 | 249 |
| 663 | 3300049589 | Ga0501073_0000091 | Ga0501073_0000091_45177_45938 | 249 |
| 664 | 3300049589 | Ga0501073_0073507 | Ga0501073_0073507_1213_1974 | 249 |
| 665 | 3300049590 | Ga0501074_0004116 | Ga0501074_0004116_7676_8437 | 249 |
| 666 | 3300049592 | Ga0501076_0049798 | Ga0501076_0049798_1782_2543 | 249 |
| 667 | 3300049741 | Ga0501079_0001942 | Ga0501079_0001942_11947_12708 | 249 |
| 668 | 3300049741 | Ga0501079_0042558 | Ga0501079_0042558_2167_2928 | 249 |
| 669 | 3300049742 | Ga0501080_0007154 | Ga0501080_0007154_6911_7672 | 249 |
| 670 | 3300049742 | Ga0501080_0059524 | Ga0501080_0059524_73_855 | 249 |
| 671 | 3300049744 | Ga0501083_0000470 | Ga0501083_0000470_19491_20252 | 249 |
| 672 | 3300049744 | Ga0501083_0080926 | Ga0501083_0080926_1074_1835 | 249 |
| 673 | 3300049822 | Ga0501035_0000452 | Ga0501035_0000452_29323_30084 | 249 |
| 674 | 3300049822 | Ga0501035_0126221 | Ga0501035_0126221_1056_1817 | 249 |
| 675 | 3300049823 | Ga0501044_0000274 | Ga0501044_0000274_15838_16599 | 249 |
| 676 | 3300049823 | Ga0501044_0081070 | Ga0501044_0081070_1036_1797 | 249 |
| 677 | 3300049823 | Ga0501044_0114224 | Ga0501044_0114224_420_1181 | 249 |
| 678 | 3300049823 | Ga0501044_0200130 | Ga0501044_0200130_766_1548 | 249 |
| 679 | 3300049823 | Ga0501044_0365053 | Ga0501044_0365053_537_1298 | 249 |
| 680 | 3300053077 | Ga0495601_0062094 | Ga0495601_0062094_1316_2101 | 249 |
| 681 | 3300053077 | Ga0495601_0120162 | Ga0495601_0120162_352_1140 | 249 |
| 682 | 3300053078 | Ga0495612_0004388 | Ga0495612_0004388_3108_3893 | 249 |
| 683 | 3300053080 | Ga0500635_0002076 | Ga0500635_0002076_4118_4879 | 249 |
| 684 | 3300053091 | Ga0500647_0024301 | Ga0500647_0024301_1873_2637 | 249 |
| 685 | 3300053094 | Ga0500566_0001048 | Ga0500566_0001048_13157_13921 | 249 |
| 686 | 3300053094 | Ga0500566_0021105 | Ga0500566_0021105_402_1166 | 249 |
| 687 | 3300053094 | Ga0500566_0152949 | Ga0500566_0152949_65_829 | 249 |
| 688 | 3300053095 | Ga0500640_000214 | Ga0500640_000214_7964_8728 | 249 |
| 689 | 3300053097 | Ga0500648_202869 | Ga0500648_202869_195_956 | 249 |
| 690 | 3300053111 | Ga0500572_000025 | Ga0500572_000025_17817_18581 | 249 |
| 691 | 3300053111 | Ga0500572_000175 | Ga0500572_000175_3067_3831 | 249 |
| 692 | 3300053115 | Ga0500591_053485 | Ga0500591_053485_957_1721 | 249 |
| 693 | 3300053119 | Ga0500595_000715 | Ga0500595_000715_4696_5460 | 249 |
| 694 | 3300053119 | Ga0500595_015655 | Ga0500595_015655_587_1351 | 249 |
| 695 | 3300053122 | Ga0500608_006744 | Ga0500608_006744_783_1547 | 249 |
| 696 | 3300053123 | Ga0500614_001781 | Ga0500614_001781_942_1706 | 249 |
| 697 | 3300053136 | Ga0500559_0000289 | Ga0500559_0000289_27390_28154 | 249 |
| 698 | 3300053136 | Ga0500559_0021044 | Ga0500559_0021044_880_1641 | 249 |
| 699 | 3300053136 | Ga0500559_0028447 | Ga0500559_0028447_850_1614 | 249 |
| 700 | 3300053140 | Ga0500573_0025499 | Ga0500573_0025499_1064_1825 | 249 |
| 701 | 3300053150 | Ga0500603_002027 | Ga0500603_002027_1033_1797 | 249 |
| 702 | 3300053159 | Ga0500630_000213 | Ga0500630_000213_1722_2486 | 249 |
| 703 | 3300053162 | Ga0500638_001677 | Ga0500638_001677_5890_6666 | 249 |
| 704 | 3300053163 | Ga0500639_000239 | Ga0500639_000239_9403_10167 | 249 |
| 705 | 3300053163 | Ga0500639_006810 | Ga0500639_006810_3059_3823 | 249 |
| 706 | 3300053177 | Ga0500636_0047846 | Ga0500636_0047846_1078_1845 | 249 |
| 707 | 3300053177 | Ga0500636_0085360 | Ga0500636_0085360_450_1211 | 249 |
| 708 | 3300053178 | Ga0500637_0000265 | Ga0500637_0000265_15473_16237 | 249 |
| 709 | 3300053178 | Ga0500637_0060102 | Ga0500637_0060102_460_1236 | 249 |
| 710 | 3300053735 | Ga0500596_002172 | Ga0500596_002172_1690_2451 | 249 |
| 711 | 3300054114 | Ga0501084_0004871 | Ga0501084_0004871_5189_5950 | 249 |
| 712 | 3300055283 | Ga0500661_003010 | Ga0500661_003010_283_1047 | 249 |
| 713 | 3300060353 | Ga0501082_0041409 | Ga0501082_0041409_1935_2696 | 249 |
| 714 | 3300060353 | Ga0501082_0167518 | Ga0501082_0167518_892_1653 | 249 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7t3b-assembly1.cif.gz_G | gator1-rag-ragulator - gap complex | 0.8099 | 201 | 239 |
| 3hug-assembly6.cif.gz_P | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.8029 | 6 | 54 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.7831 | 8 | 55 |
| 3l7h-assembly1.cif.gz_A | insights into dynein assembly from a dynein intermediate chain light chain roadblock structure | 0.7802 | 201 | 224 |
| 7uxh-assembly1.cif.gz_Y | cryo-em structure of the mtorc1-tfeb-rag-ragulator complex | 0.7694 | 201 | 239 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugP00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.8029 | 6 | 54 | 1.10.10.1320 |
| af_Q4D9D6_71_184_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7976 | 200 | 224 | 3.30.450.50 |
| af_Q54F59_1_120_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.7969 | 201 | 227 | 3.30.450.30 |
| af_A0A1D5RLS7_1_125_3.30.450.50 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain | 0.7936 | 200 | 228 | 3.30.450.50 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.7831 | 8 | 55 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R6CQM4-F1-model_v4 | Anti-sigma factor | 0.977 | 160 | 249 |
|
| AF-A0A531M551-F1-model_v4 | Anti-sigma factor | 0.9744 | 158 | 243 |
|
| AF-A0A2V8TLS2-F1-model_v4 | Anti-sigma factor | 0.9613 | 114 | 237 |
|
| AF-A0A4R6CQM4-F1-model_v4 | Anti-sigma factor | 0.9562 | 160 | 249 |
|
| AF-A0A538RRT3-F1-model_v4 | Anti-sigma factor | 0.9541 | 154 | 242 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar