F476834

General Info

Members Datasets Scaffolds Average Seq Length
712 275 1424 164

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10002257|Ga0207695_1000225727
Length 178
Sequence MARGPHSVHCLLMPDNSFDVVSQIDMPEVNNAIQQAMKEITTRYDLKDSKSNIELNEKDKKLVLTSSDEFKLKAVTEILGQKLVKRGVPIRNLVYGTINSAHGSTVKQEVTLVSGIATEKAKEIVKAMKDSKLKVQAAIQGDLVRISGKDRDTLQQAIAILRAADFGIELQFINFRTN

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
90 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.19
Metatranscriptomes 2.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.07
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 24.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10002257 3300025913 Bacteria 28858
2 JGI24736J21556_1040945 3300001904 Unclassified 712
3 JGI24737J22298_10086169 3300001990 Bacteria 933
4 Ga0065712_10123382 3300005290 Bacteria 1639
5 Ga0065712_10478414 3300005290 Bacteria 665
6 Ga0070658_10129524 3300005327 Bacteria 2102
7 Ga0070658_10363854 3300005327 Bacteria 1239
8 Ga0070658_10531848 3300005327 Bacteria 1017
9 Ga0070658_10816520 3300005327 Bacteria 810
10 Ga0070658_11471051 3300005327 Unclassified 591
11 Ga0070683_100445764 3300005329 Unclassified 1235
12 Ga0070683_100470543 3300005329 Bacteria 1200
13 Ga0070683_100475220 3300005329 Bacteria 1193
14 Ga0070683_100826875 3300005329 Bacteria 888
15 Ga0070690_100992129 3300005330 Bacteria 661
16 Ga0068869_100005975 3300005334 Bacteria 7697
17 Ga0068869_100197736 3300005334 Unclassified 1584
18 Ga0070666_10136777 3300005335 Unclassified 1705
19 Ga0070666_10496171 3300005335 Bacteria 885
20 Ga0070680_100014540 3300005336 Bacteria 6158
21 Ga0070680_100048185 3300005336 Bacteria 3472
22 Ga0070680_100167675 3300005336 Unclassified 1847
23 Ga0070680_100179439 3300005336 Bacteria 1783
24 Ga0070680_100468440 3300005336 Unclassified 1077
25 Ga0070680_101026451 3300005336 Bacteria 712
26 Ga0070680_101467225 3300005336 Unclassified 591
27 Ga0070660_100088189 3300005339 Bacteria 2443
28 Ga0070660_100198455 3300005339 Bacteria 1627
29 Ga0070660_100443026 3300005339 Unclassified 1077
30 Ga0070660_100532316 3300005339 Bacteria 979
31 Ga0070661_100251700 3300005344 Bacteria 1363
32 Ga0070661_100608230 3300005344 Unclassified 884
33 Ga0070661_100734553 3300005344 Bacteria 806
34 Ga0070692_10376272 3300005345 Bacteria 890
35 Ga0070671_100077834 3300005355 Bacteria 2772
36 Ga0070673_100018349 3300005364 Bacteria 4995
37 Ga0070673_100116325 3300005364 Bacteria 2224
38 Ga0070688_100295391 3300005365 Bacteria 1169
39 Ga0070688_101282314 3300005365 Bacteria 591
40 Ga0070659_100135818 3300005366 Bacteria 2000
41 Ga0070667_100835312 3300005367 Bacteria 856
42 Ga0070667_101476913 3300005367 Bacteria 638
43 Ga0070709_10015570 3300005434 Bacteria 4330
44 Ga0070709_10034594 3300005434 Bacteria 3064
45 Ga0070709_10074254 3300005434 Unclassified 2203
46 Ga0070709_10183174 3300005434 Bacteria 1472
47 Ga0070709_10331580 3300005434 Unclassified 1119
48 Ga0070709_10635967 3300005434 Bacteria 825
49 Ga0070714_100008945 3300005435 Bacteria 7837
50 Ga0070714_100013528 3300005435 Bacteria 6540
51 Ga0070714_100110896 3300005435 Bacteria 2429
52 Ga0070714_100234242 3300005435 Bacteria 1692
53 Ga0070714_100597192 3300005435 Unclassified 1060
54 Ga0070714_100937213 3300005435 Unclassified 841
55 Ga0070714_101192473 3300005435 Bacteria 743
56 Ga0070714_101243548 3300005435 Bacteria 727
57 Ga0070714_101676049 3300005435 Bacteria 621
58 Ga0070713_100002803 3300005436 Bacteria 11397
59 Ga0070713_100046549 3300005436 Bacteria 3560
60 Ga0070713_100075518 3300005436 Unclassified 2858
61 Ga0070713_100099065 3300005436 Bacteria 2521
62 Ga0070713_100204852 3300005436 Bacteria 1783
63 Ga0070713_100286586 3300005436 Bacteria 1512
64 Ga0070713_100307599 3300005436 Bacteria 1461
65 Ga0070713_100669300 3300005436 Unclassified 989
66 Ga0070713_100812545 3300005436 Bacteria 897
67 Ga0070713_101586341 3300005436 Bacteria 635
68 Ga0070710_10033319 3300005437 Bacteria 2797
69 Ga0070710_10526962 3300005437 Unclassified 813
70 Ga0070711_100001117 3300005439 Bacteria 14354
71 Ga0070711_100999612 3300005439 Bacteria 717
72 Ga0070700_100455567 3300005441 Bacteria 974
73 Ga0070694_101238098 3300005444 Unclassified 626
74 Ga0070708_100001333 3300005445 Bacteria 18861
75 Ga0070708_100002056 3300005445 Bacteria 15515
76 Ga0070708_100117293 3300005445 Bacteria 2451
77 Ga0070708_100130650 3300005445 Bacteria 2324
78 Ga0070708_100404659 3300005445 Archaea 1287
79 Ga0070708_100433357 3300005445 Bacteria 1240
80 Ga0070678_100115288 3300005456 Bacteria 2109
81 Ga0070678_100138813 3300005456 Bacteria 1942
82 Ga0070681_10002804 3300005458 Bacteria 16094
83 Ga0070681_10007002 3300005458 Bacteria 10975
84 Ga0070681_10317406 3300005458 Bacteria 1467
85 Ga0070681_10456904 3300005458 Bacteria 1189
86 Ga0070681_10749991 3300005458 Unclassified 893
87 Ga0070681_11030770 3300005458 Bacteria 743
88 Ga0068867_100030981 3300005459 Bacteria 3860
89 Ga0070685_10022947 3300005466 Bacteria 3409
90 Ga0070706_100000434 3300005467 Bacteria 50174
91 Ga0070706_100000964 3300005467 Bacteria 31387
92 Ga0070706_100075258 3300005467 Bacteria 3124
93 Ga0070707_100001324 3300005468 Bacteria 24377
94 Ga0070707_100003717 3300005468 Bacteria 14388
95 Ga0070707_100233065 3300005468 Bacteria 1792
96 Ga0070707_100264188 3300005468 Bacteria 1674
97 Ga0070698_100000491 3300005471 Bacteria 42035
98 Ga0070698_100004164 3300005471 Bacteria 15900
99 Ga0070698_100328989 3300005471 Unclassified 1459
100 Ga0070699_100001228 3300005518 Bacteria 23633
101 Ga0070699_100219135 3300005518 Unclassified 1696
102 Ga0070699_100319495 3300005518 Bacteria 1395
103 Ga0070699_100841612 3300005518 Unclassified 840
104 Ga0070679_100018495 3300005530 Bacteria 6764
105 Ga0070679_100043857 3300005530 Bacteria 4454
106 Ga0070679_100048002 3300005530 Bacteria 4255
107 Ga0070679_100192146 3300005530 Unclassified 2010
108 Ga0070679_100203882 3300005530 Unclassified 1943
109 Ga0070679_100558982 3300005530 Bacteria 1088
110 Ga0070684_100103818 3300005535 Bacteria 2543
111 Ga0070684_100105735 3300005535 Bacteria 2519
112 Ga0070697_100000816 3300005536 Bacteria 23362
113 Ga0070697_100001114 3300005536 Bacteria 20315
114 Ga0070697_100002580 3300005536 Bacteria 13932
115 Ga0070697_100008339 3300005536 Bacteria 8085
116 Ga0070697_100384489 3300005536 Bacteria 1216
117 Ga0070697_100576967 3300005536 Bacteria 987
118 Ga0070697_100820879 3300005536 Bacteria 823
119 Ga0070697_100955318 3300005536 Unclassified 761
120 Ga0070697_101828338 3300005536 Bacteria 543
121 Ga0068853_100003545 3300005539 Bacteria 11939
122 Ga0068853_100156132 3300005539 Unclassified 2056
123 Ga0068853_100438114 3300005539 Unclassified 1228
124 Ga0070672_100227764 3300005543 Bacteria 1565
125 Ga0070695_100110924 3300005545 Unclassified 1861
126 Ga0070696_100088234 3300005546 Bacteria 2204
127 Ga0070696_100172251 3300005546 Unclassified 1601
128 Ga0070693_100439001 3300005547 Unclassified 913
129 Ga0070665_100125691 3300005548 Bacteria 2567
130 Ga0070665_100365852 3300005548 Bacteria 1448
131 Ga0068855_100013569 3300005563 Bacteria 9826
132 Ga0068855_100063619 3300005563 Bacteria 4305
133 Ga0068855_100188112 3300005563 Bacteria 2331
134 Ga0068855_100340483 3300005563 Bacteria 1654
135 Ga0068855_100397031 3300005563 Bacteria 1512
136 Ga0070664_100079375 3300005564 Bacteria 2825
137 Ga0070664_100938051 3300005564 Bacteria 812
138 Ga0068857_100023786 3300005577 Bacteria 5394
139 Ga0068857_100420324 3300005577 Bacteria 1246
140 Ga0068857_100695671 3300005577 Unclassified 966
141 Ga0068857_101281084 3300005577 Bacteria 711
142 Ga0068854_100142878 3300005578 Unclassified 1838
143 Ga0068854_100855300 3300005578 Unclassified 796
144 Ga0068854_101367264 3300005578 Unclassified 639
145 Ga0068856_100002867 3300005614 Bacteria 17647
146 Ga0068856_100006497 3300005614 Bacteria 11465
147 Ga0068856_100034500 3300005614 Bacteria 4956
148 Ga0068856_100075408 3300005614 Unclassified 3341
149 Ga0068856_100451085 3300005614 Bacteria 1307
150 Ga0068856_100584418 3300005614 Unclassified 1138
151 Ga0068856_100588555 3300005614 Unclassified 1134
152 Ga0068856_100600455 3300005614 Bacteria 1122
153 Ga0068856_101089393 3300005614 Unclassified 816
154 Ga0070702_100842455 3300005615 Unclassified 713
155 Ga0068852_100307798 3300005616 Bacteria 1535
156 Ga0068852_101826977 3300005616 Bacteria 630
157 Ga0068859_100358367 3300005617 Bacteria 1553
158 Ga0068859_101107459 3300005617 Unclassified 871
159 Ga0068864_100251925 3300005618 Bacteria 1640
160 Ga0068866_10179619 3300005718 Bacteria 1249
161 Ga0068851_10139892 3300005834 Bacteria 1316
162 Ga0068863_100015005 3300005841 Bacteria 7441
163 Ga0068863_100018549 3300005841 Bacteria 6659
164 Ga0068863_100027179 3300005841 Bacteria 5457
165 Ga0068863_100031125 3300005841 Bacteria 5095
166 Ga0068858_100007300 3300005842 Bacteria 10704
167 Ga0068858_100433370 3300005842 Unclassified 1265
168 Ga0068858_100808766 3300005842 Bacteria 914
169 Ga0068858_100934633 3300005842 Unclassified 849
170 Ga0068858_101029909 3300005842 Unclassified 807
171 Ga0068860_100227615 3300005843 Bacteria 1812
172 Ga0068860_100746541 3300005843 Unclassified 990
173 Ga0068862_100150228 3300005844 Bacteria 2073
174 Ga0068862_100663345 3300005844 Bacteria 1007
175 Ga0081455_10008142 3300005937 Bacteria 10934
176 Ga0081540_1036745 3300005983 Unclassified 2607
177 Ga0070717_10008243 3300006028 Bacteria 7779
178 Ga0070717_10016033 3300006028 Bacteria 5803
179 Ga0070717_10036399 3300006028 Bacteria 3992
180 Ga0070717_10049620 3300006028 Bacteria 3446
181 Ga0070717_10063701 3300006028 Bacteria 3061
182 Ga0070717_10071451 3300006028 Bacteria 2895
183 Ga0070717_10172732 3300006028 Bacteria 1880
184 Ga0070717_10185760 3300006028 Bacteria 1814
185 Ga0070717_10591421 3300006028 Bacteria 1006
186 Ga0070715_10022904 3300006163 Unclassified 2440
187 Ga0070716_100000370 3300006173 Bacteria 18480
188 Ga0070716_100181257 3300006173 Bacteria 1383
189 Ga0070716_100406492 3300006173 Unclassified 980
190 Ga0070716_101052809 3300006173 Bacteria 646
191 Ga0070712_100002677 3300006175 Bacteria 10995
192 Ga0070712_100016973 3300006175 Bacteria 4706
193 Ga0070712_100122698 3300006175 Bacteria 1957
194 Ga0070712_100317370 3300006175 Bacteria 1266
195 Ga0097621_100872971 3300006237 Unclassified 837
196 Ga0068871_100362792 3300006358 Unclassified 1283
197 Ga0068871_101959482 3300006358 Bacteria 557
198 Ga0075431_100095610 3300006847 Bacteria 3067
199 Ga0075431_100262358 3300006847 Bacteria 1753
200 Ga0075433_10925527 3300006852 Unclassified 760
201 Ga0075434_100138208 3300006871 Bacteria 2456
202 Ga0075429_100356477 3300006880 Bacteria 1281
203 Ga0068865_100038329 3300006881 Bacteria 3243
204 Ga0075436_100286777 3300006914 Bacteria 1178
205 Ga0097620_100358348 3300006931 Bacteria 1553
206 Ga0097620_101107399 3300006931 Unclassified 871
207 Ga0075435_100106420 3300007076 Bacteria 2329
208 Ga0075435_100940987 3300007076 Bacteria 754
209 Ga0099794_10115248 3300007265 Unclassified 1349
210 Ga0099794_10232124 3300007265 Unclassified 949
211 Ga0099795_10179974 3300007788 Unclassified 882
212 Ga0105240_10001788 3300009093 Bacteria 36269
213 Ga0105240_10036510 3300009093 Bacteria 6320
214 Ga0105240_10049306 3300009093 Bacteria 5316
215 Ga0105240_10071151 3300009093 Unclassified 4302
216 Ga0105240_10330424 3300009093 Bacteria 1735
217 Ga0105240_10344041 3300009093 Bacteria 1693
218 Ga0105240_10399765 3300009093 Bacteria 1548
219 Ga0105240_11474276 3300009093 Bacteria 714
220 Ga0105245_10012601 3300009098 Bacteria 7360
221 Ga0105245_10162070 3300009098 Bacteria 2123
222 Ga0105245_10763342 3300009098 Unclassified 1003
223 Ga0105247_10233634 3300009101 Bacteria 1250
224 Ga0114129_10129562 3300009147 Bacteria 3467
225 Ga0114129_10162241 3300009147 Bacteria 3052
226 Ga0105241_10004468 3300009174 Bacteria 10344
227 Ga0105241_10152438 3300009174 Unclassified 1892
228 Ga0105241_10633539 3300009174 Bacteria 969
229 Ga0105241_10661721 3300009174 Bacteria 950
230 Ga0105242_10108020 3300009176 Bacteria 2367
231 Ga0105242_10196711 3300009176 Bacteria 1788
232 Ga0105242_10629625 3300009176 Bacteria 1040
233 Ga0105242_10934492 3300009176 Bacteria 870
234 Ga0105248_10181203 3300009177 Bacteria 2374
235 Ga0105248_11079525 3300009177 Bacteria 907
236 Ga0105248_11117245 3300009177 Unclassified 891
237 Ga0105248_11414308 3300009177 Bacteria 787
238 Ga0105237_10007566 3300009545 Bacteria 11874
239 Ga0105237_10038687 3300009545 Bacteria 4816
240 Ga0105237_10146539 3300009545 Bacteria 2356
241 Ga0105237_10550465 3300009545 Bacteria 1160
242 Ga0105237_10605006 3300009545 Unclassified 1103
243 Ga0105237_11040911 3300009545 Bacteria 825
244 Ga0105237_11107334 3300009545 Unclassified 799
245 Ga0105238_10191480 3300009551 Unclassified 2021
246 Ga0105238_10247061 3300009551 Bacteria 1762
247 Ga0105238_10273178 3300009551 Bacteria 1671
248 Ga0105238_10374660 3300009551 Bacteria 1414
249 Ga0105238_10722869 3300009551 Unclassified 1008
250 Ga0105238_10899182 3300009551 Bacteria 904
251 Ga0105249_10328860 3300009553 Bacteria 1542
252 Ga0099796_10147675 3300010159 Bacteria 923
253 Ga0105239_10144815 3300010375 Unclassified 2649
254 Ga0105239_10181461 3300010375 Bacteria 2355
255 Ga0105239_10250632 3300010375 Unclassified 1988
256 Ga0105239_10422070 3300010375 Bacteria 1511
257 Ga0105239_10426852 3300010375 Bacteria 1502
258 Ga0157329_1002664 3300012491 Bacteria 1036
259 Ga0157326_1000115 3300012513 Bacteria 8380
260 Ga0157373_10004065 3300013100 Bacteria 11021
261 Ga0157373_10052565 3300013100 Bacteria 2899
262 Ga0157373_10428922 3300013100 Bacteria 950
263 Ga0157371_10066319 3300013102 Bacteria 2556
264 Ga0157370_10024938 3300013104 Bacteria 5918
265 Ga0157370_10131100 3300013104 Bacteria 2338
266 Ga0157370_10196291 3300013104 Bacteria 1873
267 Ga0157370_10236665 3300013104 Bacteria 1690
268 Ga0157370_10251984 3300013104 Bacteria 1633
269 Ga0157370_10467113 3300013104 Bacteria 1160
270 Ga0157369_10000176 3300013105 Bacteria 89387
271 Ga0157369_10018758 3300013105 Bacteria 7755
272 Ga0157369_10022746 3300013105 Bacteria 6989
273 Ga0157369_10324428 3300013105 Bacteria 1600
274 Ga0157369_10340623 3300013105 Bacteria 1558
275 Ga0157369_10427646 3300013105 Unclassified 1373
276 Ga0157369_10678578 3300013105 Bacteria 1062
277 Ga0157369_10837486 3300013105 Bacteria 944
278 Ga0157369_10850407 3300013105 Bacteria 936
279 Ga0157369_11491910 3300013105 Bacteria 688
280 Ga0157374_10000744 3300013296 Bacteria 28383
281 Ga0157374_10007889 3300013296 Bacteria 9087
282 Ga0157374_10007973 3300013296 Bacteria 9048
283 Ga0157374_10020389 3300013296 Bacteria 5881
284 Ga0157374_10144171 3300013296 Bacteria 2313
285 Ga0157378_10020722 3300013297 Bacteria 5782
286 Ga0163162_10055799 3300013306 Bacteria 3978
287 Ga0163162_10132015 3300013306 Bacteria 2606
288 Ga0163162_10159186 3300013306 Bacteria 2379
289 Ga0163162_11252653 3300013306 Bacteria 842
290 Ga0157372_10007162 3300013307 Bacteria 11870
291 Ga0157372_10030761 3300013307 Bacteria 5874
292 Ga0157372_10096920 3300013307 Bacteria 3362
293 Ga0157372_10224907 3300013307 Bacteria 2176
294 Ga0157372_10763371 3300013307 Unclassified 1124
295 Ga0157372_10879961 3300013307 Bacteria 1039
296 Ga0157372_10883086 3300013307 Bacteria 1037
297 Ga0157372_11001580 3300013307 Unclassified 968
298 Ga0157372_11853596 3300013307 Bacteria 693
299 Ga0163163_10043562 3300014325 Bacteria 4400
300 Ga0163163_10085126 3300014325 Bacteria 3169
301 Ga0163163_11477847 3300014325 Bacteria 741
302 Ga0157379_10060614 3300014968 Bacteria 3383
303 Ga0157379_10181543 3300014968 Bacteria 1901
304 Ga0157376_10062888 3300014969 Unclassified 3125
305 Ga0157376_10089347 3300014969 Bacteria 2664
306 Ga0157376_10100371 3300014969 Bacteria 2527
307 Ga0163161_10714117 3300017792 Bacteria 836
308 Ga0197907_10232491 3300020069 Unclassified 794
309 Ga0197907_11451980 3300020069 Bacteria 633
310 Ga0206356_11472961 3300020070 Unclassified 626
311 Ga0206349_1931184 3300020075 Unclassified 696
312 Ga0206351_10266289 3300020077 Unclassified 1260
313 Ga0206352_10043527 3300020078 Unclassified 1232
314 Ga0206350_10024126 3300020080 Unclassified 910
315 Ga0206350_10024493 3300020080 Unclassified 522
316 Ga0206350_10491217 3300020080 Bacteria 754
317 Ga0206350_11038258 3300020080 Unclassified 624
318 Ga0206354_11560833 3300020081 Bacteria 902
319 Ga0154015_1615104 3300020610 Unclassified 1703
320 Ga0213873_10058865 3300021358 Bacteria 1035
321 Ga0213872_10001445 3300021361 Bacteria 15460
322 Ga0213874_10025079 3300021377 Bacteria 1678
323 Ga0213876_10003207 3300021384 Bacteria 9392
324 Ga0213876_10123083 3300021384 Bacteria 1378
325 Ga0213876_10152067 3300021384 Bacteria 1230
326 Ga0213876_10284712 3300021384 Bacteria 878
327 Ga0213875_10023638 3300021388 Bacteria 2935
328 Ga0213875_10054791 3300021388 Bacteria 1867
329 Ga0213875_10075336 3300021388 Bacteria 1574
330 Ga0213875_10109619 3300021388 Bacteria 1289
331 Ga0213875_10177384 3300021388 Unclassified 1001
332 Ga0213875_10334247 3300021388 Unclassified 719
333 Ga0213871_10105552 3300021441 Bacteria 828
334 Ga0224712_10013532 3300022467 Unclassified 2601
335 Ga0224712_10542530 3300022467 Unclassified 565
336 Ga0224572_1054568 3300024225 Unclassified 743
337 Ga0207692_10093933 3300025898 Bacteria 1632
338 Ga0207692_10156358 3300025898 Bacteria 1310
339 Ga0207692_10318521 3300025898 Bacteria 951
340 Ga0207692_10872666 3300025898 Unclassified 591
341 Ga0207642_10056320 3300025899 Bacteria 1803
342 Ga0207688_10208370 3300025901 Bacteria 1174
343 Ga0207680_10788103 3300025903 Bacteria 681
344 Ga0207647_10026279 3300025904 Bacteria 3811
345 Ga0207647_10111333 3300025904 Bacteria 1618
346 Ga0207647_10393333 3300025904 Bacteria 782
347 Ga0207685_10366137 3300025905 Unclassified 731
348 Ga0207685_10386710 3300025905 Bacteria 714
349 Ga0207685_10697087 3300025905 Bacteria 552
350 Ga0207699_10054720 3300025906 Bacteria 2371
351 Ga0207699_10118788 3300025906 Bacteria 1706
352 Ga0207699_10170971 3300025906 Bacteria 1454
353 Ga0207699_10243195 3300025906 Bacteria 1237
354 Ga0207699_10269544 3300025906 Bacteria 1179
355 Ga0207699_10329566 3300025906 Bacteria 1073
356 Ga0207699_10651767 3300025906 Bacteria 769
357 Ga0207705_10025641 3300025909 Bacteria 4206
358 Ga0207705_10385939 3300025909 Bacteria 1082
359 Ga0207705_10425881 3300025909 Unclassified 1028
360 Ga0207705_10426177 3300025909 Bacteria 1027
361 Ga0207705_11210577 3300025909 Unclassified 579
362 Ga0207684_10001135 3300025910 Bacteria 29768
363 Ga0207684_10003936 3300025910 Bacteria 14212
364 Ga0207684_10013009 3300025910 Bacteria 7205
365 Ga0207654_10006411 3300025911 Bacteria 5923
366 Ga0207654_10037436 3300025911 Unclassified 2716
367 Ga0207654_10141219 3300025911 Unclassified 1536
368 Ga0207654_10882489 3300025911 Bacteria 648
369 Ga0207707_10009254 3300025912 Bacteria 8547
370 Ga0207707_10040954 3300025912 Bacteria 4045
371 Ga0207707_10105256 3300025912 Unclassified 2466
372 Ga0207707_10246691 3300025912 Unclassified 1551
373 Ga0207695_10017479 3300025913 Bacteria 8346
374 Ga0207695_10275838 3300025913 Bacteria 1576
375 Ga0207695_10471369 3300025913 Bacteria 1138
376 Ga0207695_10691081 3300025913 Bacteria 901
377 Ga0207671_10111311 3300025914 Bacteria 2083
378 Ga0207671_10226909 3300025914 Bacteria 1464
379 Ga0207693_10002889 3300025915 Bacteria 14863
380 Ga0207693_10003362 3300025915 Bacteria 13659
381 Ga0207663_10002318 3300025916 Bacteria 9127
382 Ga0207663_10019697 3300025916 Bacteria 3807
383 Ga0207663_10225304 3300025916 Bacteria 1366
384 Ga0207663_10341271 3300025916 Bacteria 1131
385 Ga0207663_10689335 3300025916 Unclassified 808
386 Ga0207660_10004672 3300025917 Bacteria 8917
387 Ga0207660_10023928 3300025917 Unclassified 4130
388 Ga0207660_10630540 3300025917 Unclassified 874
389 Ga0207660_10676585 3300025917 Bacteria 842
390 Ga0207660_10908403 3300025917 Bacteria 718
391 Ga0207660_11338151 3300025917 Unclassified 581
392 Ga0207657_10195945 3300025919 Bacteria 1627
393 Ga0207657_10224040 3300025919 Unclassified 1506
394 Ga0207657_10455292 3300025919 Bacteria 1004
395 Ga0207657_10514166 3300025919 Bacteria 937
396 Ga0207649_10207541 3300025920 Unclassified 1388
397 Ga0207652_10070897 3300025921 Unclassified 3027
398 Ga0207652_10106060 3300025921 Bacteria 2487
399 Ga0207652_10168836 3300025921 Unclassified 1963
400 Ga0207652_10423306 3300025921 Unclassified 1201
401 Ga0207646_10005017 3300025922 Bacteria 14095
402 Ga0207646_10021574 3300025922 Bacteria 5947
403 Ga0207646_10074849 3300025922 Bacteria 3025
404 Ga0207646_10216551 3300025922 Unclassified 1730
405 Ga0207694_10135569 3300025924 Bacteria 1977
406 Ga0207694_10211129 3300025924 Bacteria 1581
407 Ga0207694_10408560 3300025924 Bacteria 1130
408 Ga0207694_10608031 3300025924 Bacteria 919
409 Ga0207694_10721244 3300025924 Bacteria 841
410 Ga0207687_10064945 3300025927 Bacteria 2590
411 Ga0207687_10134678 3300025927 Bacteria 1867
412 Ga0207687_10814233 3300025927 Bacteria 797
413 Ga0207687_11198572 3300025927 Unclassified 652
414 Ga0207700_10011606 3300025928 Bacteria 5627
415 Ga0207700_10024926 3300025928 Bacteria 4146
416 Ga0207700_10347052 3300025928 Bacteria 1292
417 Ga0207700_10383412 3300025928 Bacteria 1229
418 Ga0207700_10582116 3300025928 Bacteria 995
419 Ga0207664_10026573 3300025929 Bacteria 4377
420 Ga0207664_10115734 3300025929 Bacteria 2236
421 Ga0207664_10336576 3300025929 Bacteria 1334
422 Ga0207664_10760635 3300025929 Bacteria 871
423 Ga0207664_10954417 3300025929 Unclassified 769
424 Ga0207664_10980150 3300025929 Bacteria 758
425 Ga0207644_10018557 3300025931 Bacteria 4709
426 Ga0207644_10538074 3300025931 Bacteria 966
427 Ga0207690_10181029 3300025932 Bacteria 1587
428 Ga0207706_10110483 3300025933 Bacteria 2418
429 Ga0207706_10405783 3300025933 Bacteria 1181
430 Ga0207706_10742462 3300025933 Unclassified 837
431 Ga0207686_10081501 3300025934 Bacteria 2113
432 Ga0207686_10231331 3300025934 Bacteria 1340
433 Ga0207686_10896486 3300025934 Bacteria 715
434 Ga0207704_10342338 3300025938 Bacteria 1161
435 Ga0207665_10000159 3300025939 Bacteria 45540
436 Ga0207665_10009234 3300025939 Bacteria 6474
437 Ga0207665_10098008 3300025939 Bacteria 2042
438 Ga0207665_10535998 3300025939 Unclassified 908
439 Ga0207665_10613496 3300025939 Bacteria 850
440 Ga0207665_10650797 3300025939 Bacteria 826
441 Ga0207711_10194036 3300025941 Bacteria 1852
442 Ga0207689_10006096 3300025942 Bacteria 10663
443 Ga0207689_10219074 3300025942 Unclassified 1572
444 Ga0207661_10067257 3300025944 Bacteria 2914
445 Ga0207661_10112429 3300025944 Bacteria 2305
446 Ga0207661_10530297 3300025944 Unclassified 1077
447 Ga0207661_11614003 3300025944 Unclassified 593
448 Ga0207679_10235040 3300025945 Bacteria 1550
449 Ga0207679_10904777 3300025945 Bacteria 807
450 Ga0207667_10037948 3300025949 Bacteria 5148
451 Ga0207667_10042066 3300025949 Bacteria 4859
452 Ga0207667_10055870 3300025949 Bacteria 4149
453 Ga0207667_10082964 3300025949 Bacteria 3319
454 Ga0207667_10123500 3300025949 Bacteria 2667
455 Ga0207667_10382831 3300025949 Bacteria 1433
456 Ga0207667_10576864 3300025949 Unclassified 1136
457 Ga0207651_10095848 3300025960 Bacteria 2186
458 Ga0207651_10158755 3300025960 Bacteria 1770
459 Ga0207640_10542465 3300025981 Bacteria 976
460 Ga0207658_10358953 3300025986 Unclassified 1271
461 Ga0207658_10653195 3300025986 Bacteria 948
462 Ga0207703_10003336 3300026035 Bacteria 13480
463 Ga0207703_11533610 3300026035 Bacteria 641
464 Ga0207639_10002681 3300026041 Bacteria 11950
465 Ga0207639_10350741 3300026041 Bacteria 1318
466 Ga0207678_10736556 3300026067 Unclassified 869
467 Ga0207708_10844199 3300026075 Bacteria 790
468 Ga0207702_10009022 3300026078 Bacteria 8398
469 Ga0207702_10009187 3300026078 Bacteria 8311
470 Ga0207702_10026780 3300026078 Bacteria 4787
471 Ga0207702_10027019 3300026078 Unclassified 4766
472 Ga0207702_10099802 3300026078 Bacteria 2560
473 Ga0207702_10241398 3300026078 Unclassified 1693
474 Ga0207702_10252836 3300026078 Unclassified 1656
475 Ga0207702_10489388 3300026078 Unclassified 1198
476 Ga0207702_10613831 3300026078 Bacteria 1068
477 Ga0207702_11159349 3300026078 Bacteria 767
478 Ga0207702_11285737 3300026078 Bacteria 726
479 Ga0207641_10019852 3300026088 Bacteria 5516
480 Ga0207641_10052010 3300026088 Unclassified 3468
481 Ga0207641_10073999 3300026088 Bacteria 2937
482 Ga0207641_10740832 3300026088 Bacteria 970
483 Ga0207641_11861907 3300026088 Bacteria 603
484 Ga0207648_10029434 3300026089 Bacteria 4870
485 Ga0207676_10682691 3300026095 Bacteria 993
486 Ga0207674_10040534 3300026116 Bacteria 4823
487 Ga0207674_10121765 3300026116 Bacteria 2576
488 Ga0207674_11478378 3300026116 Bacteria 649
489 Ga0207675_100525564 3300026118 Bacteria 1180
490 Ga0207683_10202869 3300026121 Bacteria 1803
491 Ga0207698_10015132 3300026142 Bacteria 5157
492 Ga0207698_11204633 3300026142 Unclassified 771
493 Ga0209588_1163109 3300027671 Bacteria 703
494 Ga0268266_10704974 3300028379 Bacteria 973
495 Ga0268265_10156189 3300028380 Bacteria 1931
496 Ga0268265_11494814 3300028380 Bacteria 679
497 Ga0268264_10219737 3300028381 Bacteria 1749
498 Ga0268264_11050938 3300028381 Unclassified 822
499 Ga0265338_10013026 3300028800 Bacteria 9430
500 Ga0265338_10046375 3300028800 Bacteria 3983
501 Ga0265338_10149743 3300028800 Bacteria 1814
502 Ga0265338_10206419 3300028800 Bacteria 1478
503 Ga0265338_10418893 3300028800 Bacteria 952
504 Ga0265760_10000376 3300031090 Bacteria 12478
505 Ga0265760_10140829 3300031090 Unclassified 785
506 Ga0265328_10099235 3300031239 Unclassified 1078
507 Ga0265325_10029009 3300031241 Bacteria 2977
508 Ga0265325_10030361 3300031241 Unclassified 2898
509 Ga0265325_10034826 3300031241 Bacteria 2677
510 Ga0265340_10038584 3300031247 Bacteria 2362
511 Ga0265339_10026135 3300031249 Bacteria 3345
512 Ga0265316_10016104 3300031344 Bacteria 6502
513 Ga0265316_10027667 3300031344 Bacteria 4690
514 Ga0265314_10085635 3300031711 Bacteria 2065
515 Ga0373926_0003562 3300035083 Bacteria 5044
516 Ga0373926_0167301 3300035083 Bacteria 841
517 Ga0373926_0352454 3300035083 Bacteria 578
518 Ga0373944_0013200 3300035089 Unclassified 2287
519 Ga0373923_0220046 3300035111 Bacteria 882
520 Ga0373932_0187929 3300035112 Bacteria 728
521 Ga0373936_0004608 3300035113 Bacteria 5217
522 Ga0373945_0008890 3300035116 Unclassified 3282
523 Ga0373945_0177312 3300035116 Bacteria 876
524 Ga0373954_0013107 3300035118 Bacteria 3691
525 Ga0373956_0051164 3300035119 Bacteria 1856
526 Ga0373957_0005203 3300035120 Bacteria 4022
527 Ga0373960_0080939 3300035121 Bacteria 1022
528 Ga0373946_0066226 3300035171 Unclassified 1548
529 Ga0373924_0000304 3300035410 Bacteria 15161
530 Ga0373924_0055830 3300035410 Bacteria 1644
531 Ga0373931_0256028 3300035691 Bacteria 1066
532 Ga0373931_0676172 3300035691 Unclassified 680
533 Ga0373935_0265383 3300035692 Bacteria 1205
534 Ga0373935_0551877 3300035692 Bacteria 840
535 Ga0373927_0002071 3300035695 Bacteria 14816
536 Ga0373927_0059797 3300035695 Unclassified 2465
537 Ga0373927_0118480 3300035695 Unclassified 1727
538 Ga0373927_0320959 3300035695 Bacteria 1020
539 Ga0373933_0066516 3300035724 Bacteria 2184
540 Ga0373933_0236296 3300035724 Bacteria 1175
541 Ga0373933_0345210 3300035724 Unclassified 967
542 Ga0373947_0016110 3300035725 Bacteria 4296
543 Ga0373947_0381214 3300035725 Bacteria 949
544 Ga0373937_0001266 3300036401 Bacteria 21178
545 Ga0373937_0010333 3300036401 Bacteria 8149
546 Ga0373937_0022576 3300036401 Bacteria 5660
547 Ga0373937_0072292 3300036401 Bacteria 3181
548 Ga0373937_0084818 3300036401 Bacteria 2931
549 Ga0373937_0247640 3300036401 Unclassified 1680
550 Ga0373937_0557946 3300036401 Bacteria 1088
551 Ga0373937_0913373 3300036401 Unclassified 827
552 Ga0373925_0026022 3300037068 Bacteria 4278
553 Ga0373925_0156706 3300037068 Unclassified 1791
554 Ga0373925_0179380 3300037068 Unclassified 1675
555 Ga0373925_0514156 3300037068 Bacteria 983
556 Ga0373925_0754936 3300037068 Bacteria 802
557 Ga0395899_0145885 3300037312 Bacteria 1681
558 Ga0395900_0060163 3300037418 Bacteria 3910
559 Ga0395900_0245511 3300037418 Bacteria 1794
560 Ga0395900_0909235 3300037418 Bacteria 803
561 Ga0395900_1076118 3300037418 Bacteria 722
562 Ga0395898_0986350 3300037466 Bacteria 779
563 Ga0436364_0414552 3300037853 Bacteria 2412
564 Ga0436364_0476732 3300037853 Bacteria 5854
565 Ga0436364_0694061 3300037853 Bacteria 5424
566 Ga0436364_0992254 3300037853 Unclassified 1113
567 Ga0436364_1098164 3300037853 Bacteria 3472
568 Ga0436364_1241905 3300037853 Bacteria 7222
569 Ga0436364_1432658 3300037853 Bacteria 2768
570 Ga0436364_1565351 3300037853 Unclassified 814
571 Ga0436365_0258655 3300039437 Bacteria 9587
572 Ga0436365_0314914 3300039437 Bacteria 12163
573 Ga0436365_0547771 3300039437 Bacteria 4269
574 Ga0436365_0688717 3300039437 Bacteria 1617
575 Ga0436365_0779833 3300039437 Bacteria 5754
576 Ga0436365_1189479 3300039437 Bacteria 1315
577 Ga0436360_0569503 3300039438 Bacteria 950
578 Ga0436360_0860172 3300039438 Unclassified 1151
579 Ga0436360_1310473 3300039438 Bacteria 1399
580 Ga0436361_0182389 3300039447 Bacteria 15481
581 Ga0436361_0676841 3300039447 Bacteria 1201
582 Ga0436363_0078300 3300039450 Bacteria 980
583 Ga0436363_0498641 3300039450 Bacteria 1319
584 Ga0436363_1159801 3300039450 Bacteria 3658
585 Ga0436363_1593994 3300039450 Bacteria 4147
586 Ga0436362_0400574 3300039453 Bacteria 3693
587 Ga0436362_1183358 3300039453 Bacteria 1227
588 Ga0436362_1241382 3300039453 Bacteria 8570
589 Ga0451791_1527395 3300041451 Unclassified 799
590 Ga0439432_140573 3300042006 Bacteria 710
591 Ga0451577_0001621 3300042876 Bacteria 29253
592 Ga0451577_0138779 3300042876 Unclassified 2184
593 Ga0451577_0630977 3300042876 Bacteria 972
594 Ga0453683_0017145 3300044673 Bacteria 4667
595 Ga0466966_0046294 3300044684 Unclassified 2778
596 Ga0466963_0044119 3300044694 Bacteria 2934
597 Ga0466963_0568033 3300044694 Unclassified 801
598 Ga0466964_0059756 3300044706 Unclassified 1584
599 Ga0453684_0002322 3300044712 Bacteria 46658
600 Ga0453684_0489457 3300044712 Bacteria 1364
601 Ga0453684_2284106 3300044712 Unclassified 538
602 Ga0466970_0392036 3300044765 Bacteria 792
603 Ga0466957_1005211 3300044842 Bacteria 599
604 Ga0466959_0092905 3300045049 Unclassified 2166
605 Ga0466959_0173041 3300045049 Bacteria 1514
606 Ga0451576_0097795 3300045051 Bacteria 3052
607 Ga0451576_0625590 3300045051 Bacteria 1131
608 Ga0451576_2083273 3300045051 Unclassified 584
609 Ga0466958_0285918 3300045836 Bacteria 1057
610 Ga0466958_0472972 3300045836 Unclassified 812
611 Ga0466958_0496561 3300045836 Unclassified 792
612 Ga0466967_0000985 3300045976 Bacteria 15477
613 Ga0466967_0206955 3300045976 Unclassified 1860
614 Ga0466967_0227830 3300045976 Bacteria 1773
615 Ga0466967_0405573 3300045976 Bacteria 1327
616 Ga0495603_0616127 3300046455 Unclassified 621
617 Ga0495651_0093780 3300046462 Bacteria 2247
618 Ga0495580_0000809 3300046472 Bacteria 27092
619 Ga0495580_0000971 3300046472 Bacteria 25127
620 Ga0495580_0007053 3300046472 Bacteria 9057
621 Ga0495580_0067207 3300046472 Bacteria 2508
622 Ga0495580_0089427 3300046472 Bacteria 2144
623 Ga0495580_0093616 3300046472 Bacteria 2091
624 Ga0495580_0161357 3300046472 Bacteria 1551
625 Ga0495580_0169979 3300046472 Bacteria 1507
626 Ga0495580_0260252 3300046472 Bacteria 1187
627 Ga0495580_0415786 3300046472 Bacteria 905
628 Ga0495580_0438830 3300046472 Bacteria 877
629 Ga0495582_0028864 3300046473 Bacteria 3045
630 Ga0495582_0112596 3300046473 Bacteria 1529
631 Ga0495639_0062543 3300046475 Bacteria 1708
632 Ga0495639_0398748 3300046475 Bacteria 695
633 Ga0495594_0551132 3300046499 Bacteria 654
634 Ga0495608_0328362 3300046511 Unclassified 944
635 Ga0495628_0206801 3300046516 Bacteria 1477
636 Ga0495642_0108296 3300046528 Bacteria 1187
637 Ga0495665_0128548 3300046531 Unclassified 1326
638 Ga0495640_0304867 3300046533 Unclassified 989
639 Ga0495645_0317815 3300046543 Bacteria 1012
640 Ga0495667_0090864 3300046559 Unclassified 1978
641 Ga0495635_0291322 3300046663 Unclassified 1095
642 Ga0495658_0208699 3300046683 Unclassified 1220
643 Ga0495669_0023499 3300046684 Bacteria 2684
644 Ga0495669_0356525 3300046684 Bacteria 707
645 Ga0495581_0090263 3300047315 Unclassified 1777
646 Ga0495604_0549859 3300047317 Bacteria 744
647 Ga0495684_0528795 3300047471 Bacteria 806
648 Ga0495593_0105299 3300047673 Unclassified 1444
649 Ga0496101_0325220 3300048904 Bacteria 1207
650 Ga0496101_0343367 3300048904 Bacteria 1173
651 Ga0496102_0256642 3300048905 Bacteria 1648
652 Ga0496102_0270576 3300048905 Bacteria 1602
653 Ga0496102_0865800 3300048905 Bacteria 826
654 Ga0496104_0239132 3300048907 Bacteria 1728
655 Ga0496104_0246311 3300048907 Bacteria 1700
656 Ga0496104_0266023 3300048907 Unclassified 1627
657 Ga0496104_0271636 3300048907 Bacteria 1608
658 Ga0496104_0577318 3300048907 Bacteria 1035
659 Ga0496105_0010424 3300048908 Bacteria 7310
660 Ga0496105_0134187 3300048908 Unclassified 2040
661 Ga0496108_0388919 3300048911 Bacteria 1218
662 Ga0496108_1010401 3300048911 Unclassified 710
663 Ga0496109_0110633 3300048912 Bacteria 2554
664 Ga0496110_0352402 3300048913 Unclassified 1341
665 Ga0496112_0003730 3300048915 Bacteria 12721
666 Ga0496112_0019164 3300048915 Bacteria 6452
667 Ga0496112_0069108 3300048915 Bacteria 3489
668 Ga0496112_0074390 3300048915 Unclassified 3359
669 Ga0496112_0080454 3300048915 Unclassified 3222
670 Ga0496112_0096215 3300048915 Bacteria 2931
671 Ga0496113_0002032 3300048916 Bacteria 11618
672 Ga0496113_0015986 3300048916 Bacteria 5176
673 Ga0496113_0457201 3300048916 Bacteria 1026
674 Ga0496113_0836775 3300048916 Unclassified 730
675 Ga0496115_0002633 3300048918 Bacteria 12890
676 Ga0496115_0588264 3300048918 Bacteria 886
677 Ga0501299_171243 3300049522 Bacteria 561
678 Ga0501032_0437928 3300049569 Bacteria 838
679 Ga0501033_0037457 3300049570 Unclassified 3630
680 Ga0501034_0035583 3300049571 Bacteria 5048
681 Ga0501034_0515080 3300049571 Unclassified 1109
682 Ga0501043_0231180 3300049579 Bacteria 1428
683 Ga0501046_0503070 3300049580 Bacteria 868
684 Ga0501047_0059129 3300049581 Unclassified 3701
685 Ga0501047_0074038 3300049581 Bacteria 3279
686 Ga0501047_0113836 3300049581 Unclassified 2587
687 Ga0501047_0129917 3300049581 Bacteria 2400
688 Ga0501070_0002154 3300049586 Bacteria 17307
689 Ga0501070_0046568 3300049586 Bacteria 3606
690 Ga0501073_0678375 3300049589 Bacteria 711
691 Ga0501035_0056347 3300049822 Bacteria 3507
692 Ga0501035_0122236 3300049822 Bacteria 2275
693 Ga0501044_0032698 3300049823 Bacteria 5467
694 Ga0501044_0034174 3300049823 Bacteria 5335
695 Ga0501044_0076871 3300049823 Unclassified 3387
696 Ga0501044_0196315 3300049823 Bacteria 1978
697 nmdc:mga05p37_204513_c1 3300050507 Unclassified 2389
698 nmdc:mga06r32_281638_c1 3300050510 Bacteria 1649
699 nmdc:mga0n895_1010221_c1 3300050512 Bacteria 812
700 nmdc:mga0n895_110542_c1 3300050512 Bacteria 2764
701 nmdc:mga0rr50_92634_c1 3300050513 Bacteria 2356
702 nmdc:mga08x19_352317_c1 3300050514 Bacteria 1028
703 nmdc:mga08x19_521447_c1 3300050514 Bacteria 840
704 nmdc:mga0a205_897476_c1 3300050515 Unclassified 733
705 Ga0495601_0234299 3300053077 Bacteria 1199
706 Ga0495601_0394924 3300053077 Unclassified 897
707 Ga0495619_0129853 3300053085 Bacteria 1731
708 Ga0587093_033276 3300059478 Unclassified 752
709 Ga0587073_0230891 3300059492 Bacteria 570
710 Ga0587085_040741 3300059506 Unclassified 808
711 Ga0587075_075114 3300059644 Bacteria 635
712 Ga0501082_1468976 3300060353 Bacteria 595
713 Ga0207695_10002257
714 JGI24736J21556_1040945
715 JGI24737J22298_10086169
716 Ga0065712_10123382
717 Ga0065712_10478414
718 Ga0070658_10129524
719 Ga0070658_10363854
720 Ga0070658_10531848
721 Ga0070658_10816520
722 Ga0070658_11471051
723 Ga0070683_100445764
724 Ga0070683_100470543
725 Ga0070683_100475220
726 Ga0070683_100826875
727 Ga0070690_100992129
728 Ga0068869_100005975
729 Ga0068869_100197736
730 Ga0070666_10136777
731 Ga0070666_10496171
732 Ga0070680_100014540
733 Ga0070680_100048185
734 Ga0070680_100167675
735 Ga0070680_100179439
736 Ga0070680_100468440
737 Ga0070680_101026451
738 Ga0070680_101467225
739 Ga0070660_100088189
740 Ga0070660_100198455
741 Ga0070660_100443026
742 Ga0070660_100532316
743 Ga0070661_100251700
744 Ga0070661_100608230
745 Ga0070661_100734553
746 Ga0070692_10376272
747 Ga0070671_100077834
748 Ga0070673_100018349
749 Ga0070673_100116325
750 Ga0070688_100295391
751 Ga0070688_101282314
752 Ga0070659_100135818
753 Ga0070667_100835312
754 Ga0070667_101476913
755 Ga0070709_10015570
756 Ga0070709_10034594
757 Ga0070709_10074254
758 Ga0070709_10183174
759 Ga0070709_10331580
760 Ga0070709_10635967
761 Ga0070714_100008945
762 Ga0070714_100013528
763 Ga0070714_100110896
764 Ga0070714_100234242
765 Ga0070714_100597192
766 Ga0070714_100937213
767 Ga0070714_101192473
768 Ga0070714_101243548
769 Ga0070714_101676049
770 Ga0070713_100002803
771 Ga0070713_100046549
772 Ga0070713_100075518
773 Ga0070713_100099065
774 Ga0070713_100204852
775 Ga0070713_100286586
776 Ga0070713_100307599
777 Ga0070713_100669300
778 Ga0070713_100812545
779 Ga0070713_101586341
780 Ga0070710_10033319
781 Ga0070710_10526962
782 Ga0070711_100001117
783 Ga0070711_100999612
784 Ga0070700_100455567
785 Ga0070694_101238098
786 Ga0070708_100001333
787 Ga0070708_100002056
788 Ga0070708_100117293
789 Ga0070708_100130650
790 Ga0070708_100404659
791 Ga0070708_100433357
792 Ga0070678_100115288
793 Ga0070678_100138813
794 Ga0070681_10002804
795 Ga0070681_10007002
796 Ga0070681_10317406
797 Ga0070681_10456904
798 Ga0070681_10749991
799 Ga0070681_11030770
800 Ga0068867_100030981
801 Ga0070685_10022947
802 Ga0070706_100000434
803 Ga0070706_100000964
804 Ga0070706_100075258
805 Ga0070707_100001324
806 Ga0070707_100003717
807 Ga0070707_100233065
808 Ga0070707_100264188
809 Ga0070698_100000491
810 Ga0070698_100004164
811 Ga0070698_100328989
812 Ga0070699_100001228
813 Ga0070699_100219135
814 Ga0070699_100319495
815 Ga0070699_100841612
816 Ga0070679_100018495
817 Ga0070679_100043857
818 Ga0070679_100048002
819 Ga0070679_100192146
820 Ga0070679_100203882
821 Ga0070679_100558982
822 Ga0070684_100103818
823 Ga0070684_100105735
824 Ga0070697_100000816
825 Ga0070697_100001114
826 Ga0070697_100002580
827 Ga0070697_100008339
828 Ga0070697_100384489
829 Ga0070697_100576967
830 Ga0070697_100820879
831 Ga0070697_100955318
832 Ga0070697_101828338
833 Ga0068853_100003545
834 Ga0068853_100156132
835 Ga0068853_100438114
836 Ga0070672_100227764
837 Ga0070695_100110924
838 Ga0070696_100088234
839 Ga0070696_100172251
840 Ga0070693_100439001
841 Ga0070665_100125691
842 Ga0070665_100365852
843 Ga0068855_100013569
844 Ga0068855_100063619
845 Ga0068855_100188112
846 Ga0068855_100340483
847 Ga0068855_100397031
848 Ga0070664_100079375
849 Ga0070664_100938051
850 Ga0068857_100023786
851 Ga0068857_100420324
852 Ga0068857_100695671
853 Ga0068857_101281084
854 Ga0068854_100142878
855 Ga0068854_100855300
856 Ga0068854_101367264
857 Ga0068856_100002867
858 Ga0068856_100006497
859 Ga0068856_100034500
860 Ga0068856_100075408
861 Ga0068856_100451085
862 Ga0068856_100584418
863 Ga0068856_100588555
864 Ga0068856_100600455
865 Ga0068856_101089393
866 Ga0070702_100842455
867 Ga0068852_100307798
868 Ga0068852_101826977
869 Ga0068859_100358367
870 Ga0068859_101107459
871 Ga0068864_100251925
872 Ga0068866_10179619
873 Ga0068851_10139892
874 Ga0068863_100015005
875 Ga0068863_100018549
876 Ga0068863_100027179
877 Ga0068863_100031125
878 Ga0068858_100007300
879 Ga0068858_100433370
880 Ga0068858_100808766
881 Ga0068858_100934633
882 Ga0068858_101029909
883 Ga0068860_100227615
884 Ga0068860_100746541
885 Ga0068862_100150228
886 Ga0068862_100663345
887 Ga0081455_10008142
888 Ga0081540_1036745
889 Ga0070717_10008243
890 Ga0070717_10016033
891 Ga0070717_10036399
892 Ga0070717_10049620
893 Ga0070717_10063701
894 Ga0070717_10071451
895 Ga0070717_10172732
896 Ga0070717_10185760
897 Ga0070717_10591421
898 Ga0070715_10022904
899 Ga0070716_100000370
900 Ga0070716_100181257
901 Ga0070716_100406492
902 Ga0070716_101052809
903 Ga0070712_100002677
904 Ga0070712_100016973
905 Ga0070712_100122698
906 Ga0070712_100317370
907 Ga0097621_100872971
908 Ga0068871_100362792
909 Ga0068871_101959482
910 Ga0075431_100095610
911 Ga0075431_100262358
912 Ga0075433_10925527
913 Ga0075434_100138208
914 Ga0075429_100356477
915 Ga0068865_100038329
916 Ga0075436_100286777
917 Ga0097620_100358348
918 Ga0097620_101107399
919 Ga0075435_100106420
920 Ga0075435_100940987
921 Ga0099794_10115248
922 Ga0099794_10232124
923 Ga0099795_10179974
924 Ga0105240_10001788
925 Ga0105240_10036510
926 Ga0105240_10049306
927 Ga0105240_10071151
928 Ga0105240_10330424
929 Ga0105240_10344041
930 Ga0105240_10399765
931 Ga0105240_11474276
932 Ga0105245_10012601
933 Ga0105245_10162070
934 Ga0105245_10763342
935 Ga0105247_10233634
936 Ga0114129_10129562
937 Ga0114129_10162241
938 Ga0105241_10004468
939 Ga0105241_10152438
940 Ga0105241_10633539
941 Ga0105241_10661721
942 Ga0105242_10108020
943 Ga0105242_10196711
944 Ga0105242_10629625
945 Ga0105242_10934492
946 Ga0105248_10181203
947 Ga0105248_11079525
948 Ga0105248_11117245
949 Ga0105248_11414308
950 Ga0105237_10007566
951 Ga0105237_10038687
952 Ga0105237_10146539
953 Ga0105237_10550465
954 Ga0105237_10605006
955 Ga0105237_11040911
956 Ga0105237_11107334
957 Ga0105238_10191480
958 Ga0105238_10247061
959 Ga0105238_10273178
960 Ga0105238_10374660
961 Ga0105238_10722869
962 Ga0105238_10899182
963 Ga0105249_10328860
964 Ga0099796_10147675
965 Ga0105239_10144815
966 Ga0105239_10181461
967 Ga0105239_10250632
968 Ga0105239_10422070
969 Ga0105239_10426852
970 Ga0157329_1002664
971 Ga0157326_1000115
972 Ga0157373_10004065
973 Ga0157373_10052565
974 Ga0157373_10428922
975 Ga0157371_10066319
976 Ga0157370_10024938
977 Ga0157370_10131100
978 Ga0157370_10196291
979 Ga0157370_10236665
980 Ga0157370_10251984
981 Ga0157370_10467113
982 Ga0157369_10000176
983 Ga0157369_10018758
984 Ga0157369_10022746
985 Ga0157369_10324428
986 Ga0157369_10340623
987 Ga0157369_10427646
988 Ga0157369_10678578
989 Ga0157369_10837486
990 Ga0157369_10850407
991 Ga0157369_11491910
992 Ga0157374_10000744
993 Ga0157374_10007889
994 Ga0157374_10007973
995 Ga0157374_10020389
996 Ga0157374_10144171
997 Ga0157378_10020722
998 Ga0163162_10055799
999 Ga0163162_10132015
1000 Ga0163162_10159186
1001 Ga0163162_11252653
1002 Ga0157372_10007162
1003 Ga0157372_10030761
1004 Ga0157372_10096920
1005 Ga0157372_10224907
1006 Ga0157372_10763371
1007 Ga0157372_10879961
1008 Ga0157372_10883086
1009 Ga0157372_11001580
1010 Ga0157372_11853596
1011 Ga0163163_10043562
1012 Ga0163163_10085126
1013 Ga0163163_11477847
1014 Ga0157379_10060614
1015 Ga0157379_10181543
1016 Ga0157376_10062888
1017 Ga0157376_10089347
1018 Ga0157376_10100371
1019 Ga0163161_10714117
1020 Ga0197907_10232491
1021 Ga0197907_11451980
1022 Ga0206356_11472961
1023 Ga0206349_1931184
1024 Ga0206351_10266289
1025 Ga0206352_10043527
1026 Ga0206350_10024126
1027 Ga0206350_10024493
1028 Ga0206350_10491217
1029 Ga0206350_11038258
1030 Ga0206354_11560833
1031 Ga0154015_1615104
1032 Ga0213873_10058865
1033 Ga0213872_10001445
1034 Ga0213874_10025079
1035 Ga0213876_10003207
1036 Ga0213876_10123083
1037 Ga0213876_10152067
1038 Ga0213876_10284712
1039 Ga0213875_10023638
1040 Ga0213875_10054791
1041 Ga0213875_10075336
1042 Ga0213875_10109619
1043 Ga0213875_10177384
1044 Ga0213875_10334247
1045 Ga0213871_10105552
1046 Ga0224712_10013532
1047 Ga0224712_10542530
1048 Ga0224572_1054568
1049 Ga0207692_10093933
1050 Ga0207692_10156358
1051 Ga0207692_10318521
1052 Ga0207692_10872666
1053 Ga0207642_10056320
1054 Ga0207688_10208370
1055 Ga0207680_10788103
1056 Ga0207647_10026279
1057 Ga0207647_10111333
1058 Ga0207647_10393333
1059 Ga0207685_10366137
1060 Ga0207685_10386710
1061 Ga0207685_10697087
1062 Ga0207699_10054720
1063 Ga0207699_10118788
1064 Ga0207699_10170971
1065 Ga0207699_10243195
1066 Ga0207699_10269544
1067 Ga0207699_10329566
1068 Ga0207699_10651767
1069 Ga0207705_10025641
1070 Ga0207705_10385939
1071 Ga0207705_10425881
1072 Ga0207705_10426177
1073 Ga0207705_11210577
1074 Ga0207684_10001135
1075 Ga0207684_10003936
1076 Ga0207684_10013009
1077 Ga0207654_10006411
1078 Ga0207654_10037436
1079 Ga0207654_10141219
1080 Ga0207654_10882489
1081 Ga0207707_10009254
1082 Ga0207707_10040954
1083 Ga0207707_10105256
1084 Ga0207707_10246691
1085 Ga0207695_10017479
1086 Ga0207695_10275838
1087 Ga0207695_10471369
1088 Ga0207695_10691081
1089 Ga0207671_10111311
1090 Ga0207671_10226909
1091 Ga0207693_10002889
1092 Ga0207693_10003362
1093 Ga0207663_10002318
1094 Ga0207663_10019697
1095 Ga0207663_10225304
1096 Ga0207663_10341271
1097 Ga0207663_10689335
1098 Ga0207660_10004672
1099 Ga0207660_10023928
1100 Ga0207660_10630540
1101 Ga0207660_10676585
1102 Ga0207660_10908403
1103 Ga0207660_11338151
1104 Ga0207657_10195945
1105 Ga0207657_10224040
1106 Ga0207657_10455292
1107 Ga0207657_10514166
1108 Ga0207649_10207541
1109 Ga0207652_10070897
1110 Ga0207652_10106060
1111 Ga0207652_10168836
1112 Ga0207652_10423306
1113 Ga0207646_10005017
1114 Ga0207646_10021574
1115 Ga0207646_10074849
1116 Ga0207646_10216551
1117 Ga0207694_10135569
1118 Ga0207694_10211129
1119 Ga0207694_10408560
1120 Ga0207694_10608031
1121 Ga0207694_10721244
1122 Ga0207687_10064945
1123 Ga0207687_10134678
1124 Ga0207687_10814233
1125 Ga0207687_11198572
1126 Ga0207700_10011606
1127 Ga0207700_10024926
1128 Ga0207700_10347052
1129 Ga0207700_10383412
1130 Ga0207700_10582116
1131 Ga0207664_10026573
1132 Ga0207664_10115734
1133 Ga0207664_10336576
1134 Ga0207664_10760635
1135 Ga0207664_10954417
1136 Ga0207664_10980150
1137 Ga0207644_10018557
1138 Ga0207644_10538074
1139 Ga0207690_10181029
1140 Ga0207706_10110483
1141 Ga0207706_10405783
1142 Ga0207706_10742462
1143 Ga0207686_10081501
1144 Ga0207686_10231331
1145 Ga0207686_10896486
1146 Ga0207704_10342338
1147 Ga0207665_10000159
1148 Ga0207665_10009234
1149 Ga0207665_10098008
1150 Ga0207665_10535998
1151 Ga0207665_10613496
1152 Ga0207665_10650797
1153 Ga0207711_10194036
1154 Ga0207689_10006096
1155 Ga0207689_10219074
1156 Ga0207661_10067257
1157 Ga0207661_10112429
1158 Ga0207661_10530297
1159 Ga0207661_11614003
1160 Ga0207679_10235040
1161 Ga0207679_10904777
1162 Ga0207667_10037948
1163 Ga0207667_10042066
1164 Ga0207667_10055870
1165 Ga0207667_10082964
1166 Ga0207667_10123500
1167 Ga0207667_10382831
1168 Ga0207667_10576864
1169 Ga0207651_10095848
1170 Ga0207651_10158755
1171 Ga0207640_10542465
1172 Ga0207658_10358953
1173 Ga0207658_10653195
1174 Ga0207703_10003336
1175 Ga0207703_11533610
1176 Ga0207639_10002681
1177 Ga0207639_10350741
1178 Ga0207678_10736556
1179 Ga0207708_10844199
1180 Ga0207702_10009022
1181 Ga0207702_10009187
1182 Ga0207702_10026780
1183 Ga0207702_10027019
1184 Ga0207702_10099802
1185 Ga0207702_10241398
1186 Ga0207702_10252836
1187 Ga0207702_10489388
1188 Ga0207702_10613831
1189 Ga0207702_11159349
1190 Ga0207702_11285737
1191 Ga0207641_10019852
1192 Ga0207641_10052010
1193 Ga0207641_10073999
1194 Ga0207641_10740832
1195 Ga0207641_11861907
1196 Ga0207648_10029434
1197 Ga0207676_10682691
1198 Ga0207674_10040534
1199 Ga0207674_10121765
1200 Ga0207674_11478378
1201 Ga0207675_100525564
1202 Ga0207683_10202869
1203 Ga0207698_10015132
1204 Ga0207698_11204633
1205 Ga0209588_1163109
1206 Ga0268266_10704974
1207 Ga0268265_10156189
1208 Ga0268265_11494814
1209 Ga0268264_10219737
1210 Ga0268264_11050938
1211 Ga0265338_10013026
1212 Ga0265338_10046375
1213 Ga0265338_10149743
1214 Ga0265338_10206419
1215 Ga0265338_10418893
1216 Ga0265760_10000376
1217 Ga0265760_10140829
1218 Ga0265328_10099235
1219 Ga0265325_10029009
1220 Ga0265325_10030361
1221 Ga0265325_10034826
1222 Ga0265340_10038584
1223 Ga0265339_10026135
1224 Ga0265316_10016104
1225 Ga0265316_10027667
1226 Ga0265314_10085635
1227 Ga0373926_0003562
1228 Ga0373926_0167301
1229 Ga0373926_0352454
1230 Ga0373944_0013200
1231 Ga0373923_0220046
1232 Ga0373932_0187929
1233 Ga0373936_0004608
1234 Ga0373945_0008890
1235 Ga0373945_0177312
1236 Ga0373954_0013107
1237 Ga0373956_0051164
1238 Ga0373957_0005203
1239 Ga0373960_0080939
1240 Ga0373946_0066226
1241 Ga0373924_0000304
1242 Ga0373924_0055830
1243 Ga0373931_0256028
1244 Ga0373931_0676172
1245 Ga0373935_0265383
1246 Ga0373935_0551877
1247 Ga0373927_0002071
1248 Ga0373927_0059797
1249 Ga0373927_0118480
1250 Ga0373927_0320959
1251 Ga0373933_0066516
1252 Ga0373933_0236296
1253 Ga0373933_0345210
1254 Ga0373947_0016110
1255 Ga0373947_0381214
1256 Ga0373937_0001266
1257 Ga0373937_0010333
1258 Ga0373937_0022576
1259 Ga0373937_0072292
1260 Ga0373937_0084818
1261 Ga0373937_0247640
1262 Ga0373937_0557946
1263 Ga0373937_0913373
1264 Ga0373925_0026022
1265 Ga0373925_0156706
1266 Ga0373925_0179380
1267 Ga0373925_0514156
1268 Ga0373925_0754936
1269 Ga0395899_0145885
1270 Ga0395900_0060163
1271 Ga0395900_0245511
1272 Ga0395900_0909235
1273 Ga0395900_1076118
1274 Ga0395898_0986350
1275 Ga0436364_0414552
1276 Ga0436364_0476732
1277 Ga0436364_0694061
1278 Ga0436364_0992254
1279 Ga0436364_1098164
1280 Ga0436364_1241905
1281 Ga0436364_1432658
1282 Ga0436364_1565351
1283 Ga0436365_0258655
1284 Ga0436365_0314914
1285 Ga0436365_0547771
1286 Ga0436365_0688717
1287 Ga0436365_0779833
1288 Ga0436365_1189479
1289 Ga0436360_0569503
1290 Ga0436360_0860172
1291 Ga0436360_1310473
1292 Ga0436361_0182389
1293 Ga0436361_0676841
1294 Ga0436363_0078300
1295 Ga0436363_0498641
1296 Ga0436363_1159801
1297 Ga0436363_1593994
1298 Ga0436362_0400574
1299 Ga0436362_1183358
1300 Ga0436362_1241382
1301 Ga0451791_1527395
1302 Ga0439432_140573
1303 Ga0451577_0001621
1304 Ga0451577_0138779
1305 Ga0451577_0630977
1306 Ga0453683_0017145
1307 Ga0466966_0046294
1308 Ga0466963_0044119
1309 Ga0466963_0568033
1310 Ga0466964_0059756
1311 Ga0453684_0002322
1312 Ga0453684_0489457
1313 Ga0453684_2284106
1314 Ga0466970_0392036
1315 Ga0466957_1005211
1316 Ga0466959_0092905
1317 Ga0466959_0173041
1318 Ga0451576_0097795
1319 Ga0451576_0625590
1320 Ga0451576_2083273
1321 Ga0466958_0285918
1322 Ga0466958_0472972
1323 Ga0466958_0496561
1324 Ga0466967_0000985
1325 Ga0466967_0206955
1326 Ga0466967_0227830
1327 Ga0466967_0405573
1328 Ga0495603_0616127
1329 Ga0495651_0093780
1330 Ga0495580_0000809
1331 Ga0495580_0000971
1332 Ga0495580_0007053
1333 Ga0495580_0067207
1334 Ga0495580_0089427
1335 Ga0495580_0093616
1336 Ga0495580_0161357
1337 Ga0495580_0169979
1338 Ga0495580_0260252
1339 Ga0495580_0415786
1340 Ga0495580_0438830
1341 Ga0495582_0028864
1342 Ga0495582_0112596
1343 Ga0495639_0062543
1344 Ga0495639_0398748
1345 Ga0495594_0551132
1346 Ga0495608_0328362
1347 Ga0495628_0206801
1348 Ga0495642_0108296
1349 Ga0495665_0128548
1350 Ga0495640_0304867
1351 Ga0495645_0317815
1352 Ga0495667_0090864
1353 Ga0495635_0291322
1354 Ga0495658_0208699
1355 Ga0495669_0023499
1356 Ga0495669_0356525
1357 Ga0495581_0090263
1358 Ga0495604_0549859
1359 Ga0495684_0528795
1360 Ga0495593_0105299
1361 Ga0496101_0325220
1362 Ga0496101_0343367
1363 Ga0496102_0256642
1364 Ga0496102_0270576
1365 Ga0496102_0865800
1366 Ga0496104_0239132
1367 Ga0496104_0246311
1368 Ga0496104_0266023
1369 Ga0496104_0271636
1370 Ga0496104_0577318
1371 Ga0496105_0010424
1372 Ga0496105_0134187
1373 Ga0496108_0388919
1374 Ga0496108_1010401
1375 Ga0496109_0110633
1376 Ga0496110_0352402
1377 Ga0496112_0003730
1378 Ga0496112_0019164
1379 Ga0496112_0069108
1380 Ga0496112_0074390
1381 Ga0496112_0080454
1382 Ga0496112_0096215
1383 Ga0496113_0002032
1384 Ga0496113_0015986
1385 Ga0496113_0457201
1386 Ga0496113_0836775
1387 Ga0496115_0002633
1388 Ga0496115_0588264
1389 Ga0501299_171243
1390 Ga0501032_0437928
1391 Ga0501033_0037457
1392 Ga0501034_0035583
1393 Ga0501034_0515080
1394 Ga0501043_0231180
1395 Ga0501046_0503070
1396 Ga0501047_0059129
1397 Ga0501047_0074038
1398 Ga0501047_0113836
1399 Ga0501047_0129917
1400 Ga0501070_0002154
1401 Ga0501070_0046568
1402 Ga0501073_0678375
1403 Ga0501035_0056347
1404 Ga0501035_0122236
1405 Ga0501044_0032698
1406 Ga0501044_0034174
1407 Ga0501044_0076871
1408 Ga0501044_0196315
1409 nmdc:mga05p37_204513_c1
1410 nmdc:mga06r32_281638_c1
1411 nmdc:mga0n895_1010221_c1
1412 nmdc:mga0n895_110542_c1
1413 nmdc:mga0rr50_92634_c1
1414 nmdc:mga08x19_352317_c1
1415 nmdc:mga08x19_521447_c1
1416 nmdc:mga0a205_897476_c1
1417 Ga0495601_0234299
1418 Ga0495601_0394924
1419 Ga0495619_0129853
1420 Ga0587093_033276
1421 Ga0587073_0230891
1422 Ga0587085_040741
1423 Ga0587075_075114
1424 Ga0501082_1468976

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

16

176

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9274 1 163
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9166 1 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8448 5 163
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8265 5 163
2n2u-assembly1.cif.gz_A solution nmr structure of de novo designed ferredoxin fold protein sfr3, northeast structural genomics consortium (nesg) target or358 0.6891 104 161
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.987 102 163 3.30.70.860
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9489 11 96 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9326 11 101 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.928 11 96 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9229 11 101 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A537XNU2-F1-model_v4 DUF520 family protein 0.9946 102 163 GO:0000166
GO:0005829
AF-A0A520IEZ1-F1-model_v4 DUF520 family protein 0.9927 102 163 GO:0000166
GO:0005829
AF-A0A1V6BKQ7-F1-model_v4 Putative nucleotide-binding protein 0.9895 100 163 GO:0000166
GO:0005829
AF-A0A2V9P8Z4-F1-model_v4 UPF0234 protein DMG95_08200 0.9894 1 165 GO:0000166
GO:0005829
AF-A0A1Z8TXT2-F1-model_v4 Uncharacterized protein 0.9865 100 163 GO:0000166
GO:0005829

Map