F476834
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 275 | 1424 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10002257|Ga0207695_1000225727 |
| Length | 178 |
| Sequence | MARGPHSVHCLLMPDNSFDVVSQIDMPEVNNAIQQAMKEITTRYDLKDSKSNIELNEKDKKLVLTSSDEFKLKAVTEILGQKLVKRGVPIRNLVYGTINSAHGSTVKQEVTLVSGIATEKAKEIVKAMKDSKLKVQAAIQGDLVRISGKDRDTLQQAIAILRAADFGIELQFINFRTN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 90 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 208 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 209 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.19 |
| Metatranscriptomes | 2.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.07 |
| Rhizosphere | 91.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10002257 | 3300025913 | Bacteria | 28858 |
| 2 | JGI24736J21556_1040945 | 3300001904 | Unclassified | 712 |
| 3 | JGI24737J22298_10086169 | 3300001990 | Bacteria | 933 |
| 4 | Ga0065712_10123382 | 3300005290 | Bacteria | 1639 |
| 5 | Ga0065712_10478414 | 3300005290 | Bacteria | 665 |
| 6 | Ga0070658_10129524 | 3300005327 | Bacteria | 2102 |
| 7 | Ga0070658_10363854 | 3300005327 | Bacteria | 1239 |
| 8 | Ga0070658_10531848 | 3300005327 | Bacteria | 1017 |
| 9 | Ga0070658_10816520 | 3300005327 | Bacteria | 810 |
| 10 | Ga0070658_11471051 | 3300005327 | Unclassified | 591 |
| 11 | Ga0070683_100445764 | 3300005329 | Unclassified | 1235 |
| 12 | Ga0070683_100470543 | 3300005329 | Bacteria | 1200 |
| 13 | Ga0070683_100475220 | 3300005329 | Bacteria | 1193 |
| 14 | Ga0070683_100826875 | 3300005329 | Bacteria | 888 |
| 15 | Ga0070690_100992129 | 3300005330 | Bacteria | 661 |
| 16 | Ga0068869_100005975 | 3300005334 | Bacteria | 7697 |
| 17 | Ga0068869_100197736 | 3300005334 | Unclassified | 1584 |
| 18 | Ga0070666_10136777 | 3300005335 | Unclassified | 1705 |
| 19 | Ga0070666_10496171 | 3300005335 | Bacteria | 885 |
| 20 | Ga0070680_100014540 | 3300005336 | Bacteria | 6158 |
| 21 | Ga0070680_100048185 | 3300005336 | Bacteria | 3472 |
| 22 | Ga0070680_100167675 | 3300005336 | Unclassified | 1847 |
| 23 | Ga0070680_100179439 | 3300005336 | Bacteria | 1783 |
| 24 | Ga0070680_100468440 | 3300005336 | Unclassified | 1077 |
| 25 | Ga0070680_101026451 | 3300005336 | Bacteria | 712 |
| 26 | Ga0070680_101467225 | 3300005336 | Unclassified | 591 |
| 27 | Ga0070660_100088189 | 3300005339 | Bacteria | 2443 |
| 28 | Ga0070660_100198455 | 3300005339 | Bacteria | 1627 |
| 29 | Ga0070660_100443026 | 3300005339 | Unclassified | 1077 |
| 30 | Ga0070660_100532316 | 3300005339 | Bacteria | 979 |
| 31 | Ga0070661_100251700 | 3300005344 | Bacteria | 1363 |
| 32 | Ga0070661_100608230 | 3300005344 | Unclassified | 884 |
| 33 | Ga0070661_100734553 | 3300005344 | Bacteria | 806 |
| 34 | Ga0070692_10376272 | 3300005345 | Bacteria | 890 |
| 35 | Ga0070671_100077834 | 3300005355 | Bacteria | 2772 |
| 36 | Ga0070673_100018349 | 3300005364 | Bacteria | 4995 |
| 37 | Ga0070673_100116325 | 3300005364 | Bacteria | 2224 |
| 38 | Ga0070688_100295391 | 3300005365 | Bacteria | 1169 |
| 39 | Ga0070688_101282314 | 3300005365 | Bacteria | 591 |
| 40 | Ga0070659_100135818 | 3300005366 | Bacteria | 2000 |
| 41 | Ga0070667_100835312 | 3300005367 | Bacteria | 856 |
| 42 | Ga0070667_101476913 | 3300005367 | Bacteria | 638 |
| 43 | Ga0070709_10015570 | 3300005434 | Bacteria | 4330 |
| 44 | Ga0070709_10034594 | 3300005434 | Bacteria | 3064 |
| 45 | Ga0070709_10074254 | 3300005434 | Unclassified | 2203 |
| 46 | Ga0070709_10183174 | 3300005434 | Bacteria | 1472 |
| 47 | Ga0070709_10331580 | 3300005434 | Unclassified | 1119 |
| 48 | Ga0070709_10635967 | 3300005434 | Bacteria | 825 |
| 49 | Ga0070714_100008945 | 3300005435 | Bacteria | 7837 |
| 50 | Ga0070714_100013528 | 3300005435 | Bacteria | 6540 |
| 51 | Ga0070714_100110896 | 3300005435 | Bacteria | 2429 |
| 52 | Ga0070714_100234242 | 3300005435 | Bacteria | 1692 |
| 53 | Ga0070714_100597192 | 3300005435 | Unclassified | 1060 |
| 54 | Ga0070714_100937213 | 3300005435 | Unclassified | 841 |
| 55 | Ga0070714_101192473 | 3300005435 | Bacteria | 743 |
| 56 | Ga0070714_101243548 | 3300005435 | Bacteria | 727 |
| 57 | Ga0070714_101676049 | 3300005435 | Bacteria | 621 |
| 58 | Ga0070713_100002803 | 3300005436 | Bacteria | 11397 |
| 59 | Ga0070713_100046549 | 3300005436 | Bacteria | 3560 |
| 60 | Ga0070713_100075518 | 3300005436 | Unclassified | 2858 |
| 61 | Ga0070713_100099065 | 3300005436 | Bacteria | 2521 |
| 62 | Ga0070713_100204852 | 3300005436 | Bacteria | 1783 |
| 63 | Ga0070713_100286586 | 3300005436 | Bacteria | 1512 |
| 64 | Ga0070713_100307599 | 3300005436 | Bacteria | 1461 |
| 65 | Ga0070713_100669300 | 3300005436 | Unclassified | 989 |
| 66 | Ga0070713_100812545 | 3300005436 | Bacteria | 897 |
| 67 | Ga0070713_101586341 | 3300005436 | Bacteria | 635 |
| 68 | Ga0070710_10033319 | 3300005437 | Bacteria | 2797 |
| 69 | Ga0070710_10526962 | 3300005437 | Unclassified | 813 |
| 70 | Ga0070711_100001117 | 3300005439 | Bacteria | 14354 |
| 71 | Ga0070711_100999612 | 3300005439 | Bacteria | 717 |
| 72 | Ga0070700_100455567 | 3300005441 | Bacteria | 974 |
| 73 | Ga0070694_101238098 | 3300005444 | Unclassified | 626 |
| 74 | Ga0070708_100001333 | 3300005445 | Bacteria | 18861 |
| 75 | Ga0070708_100002056 | 3300005445 | Bacteria | 15515 |
| 76 | Ga0070708_100117293 | 3300005445 | Bacteria | 2451 |
| 77 | Ga0070708_100130650 | 3300005445 | Bacteria | 2324 |
| 78 | Ga0070708_100404659 | 3300005445 | Archaea | 1287 |
| 79 | Ga0070708_100433357 | 3300005445 | Bacteria | 1240 |
| 80 | Ga0070678_100115288 | 3300005456 | Bacteria | 2109 |
| 81 | Ga0070678_100138813 | 3300005456 | Bacteria | 1942 |
| 82 | Ga0070681_10002804 | 3300005458 | Bacteria | 16094 |
| 83 | Ga0070681_10007002 | 3300005458 | Bacteria | 10975 |
| 84 | Ga0070681_10317406 | 3300005458 | Bacteria | 1467 |
| 85 | Ga0070681_10456904 | 3300005458 | Bacteria | 1189 |
| 86 | Ga0070681_10749991 | 3300005458 | Unclassified | 893 |
| 87 | Ga0070681_11030770 | 3300005458 | Bacteria | 743 |
| 88 | Ga0068867_100030981 | 3300005459 | Bacteria | 3860 |
| 89 | Ga0070685_10022947 | 3300005466 | Bacteria | 3409 |
| 90 | Ga0070706_100000434 | 3300005467 | Bacteria | 50174 |
| 91 | Ga0070706_100000964 | 3300005467 | Bacteria | 31387 |
| 92 | Ga0070706_100075258 | 3300005467 | Bacteria | 3124 |
| 93 | Ga0070707_100001324 | 3300005468 | Bacteria | 24377 |
| 94 | Ga0070707_100003717 | 3300005468 | Bacteria | 14388 |
| 95 | Ga0070707_100233065 | 3300005468 | Bacteria | 1792 |
| 96 | Ga0070707_100264188 | 3300005468 | Bacteria | 1674 |
| 97 | Ga0070698_100000491 | 3300005471 | Bacteria | 42035 |
| 98 | Ga0070698_100004164 | 3300005471 | Bacteria | 15900 |
| 99 | Ga0070698_100328989 | 3300005471 | Unclassified | 1459 |
| 100 | Ga0070699_100001228 | 3300005518 | Bacteria | 23633 |
| 101 | Ga0070699_100219135 | 3300005518 | Unclassified | 1696 |
| 102 | Ga0070699_100319495 | 3300005518 | Bacteria | 1395 |
| 103 | Ga0070699_100841612 | 3300005518 | Unclassified | 840 |
| 104 | Ga0070679_100018495 | 3300005530 | Bacteria | 6764 |
| 105 | Ga0070679_100043857 | 3300005530 | Bacteria | 4454 |
| 106 | Ga0070679_100048002 | 3300005530 | Bacteria | 4255 |
| 107 | Ga0070679_100192146 | 3300005530 | Unclassified | 2010 |
| 108 | Ga0070679_100203882 | 3300005530 | Unclassified | 1943 |
| 109 | Ga0070679_100558982 | 3300005530 | Bacteria | 1088 |
| 110 | Ga0070684_100103818 | 3300005535 | Bacteria | 2543 |
| 111 | Ga0070684_100105735 | 3300005535 | Bacteria | 2519 |
| 112 | Ga0070697_100000816 | 3300005536 | Bacteria | 23362 |
| 113 | Ga0070697_100001114 | 3300005536 | Bacteria | 20315 |
| 114 | Ga0070697_100002580 | 3300005536 | Bacteria | 13932 |
| 115 | Ga0070697_100008339 | 3300005536 | Bacteria | 8085 |
| 116 | Ga0070697_100384489 | 3300005536 | Bacteria | 1216 |
| 117 | Ga0070697_100576967 | 3300005536 | Bacteria | 987 |
| 118 | Ga0070697_100820879 | 3300005536 | Bacteria | 823 |
| 119 | Ga0070697_100955318 | 3300005536 | Unclassified | 761 |
| 120 | Ga0070697_101828338 | 3300005536 | Bacteria | 543 |
| 121 | Ga0068853_100003545 | 3300005539 | Bacteria | 11939 |
| 122 | Ga0068853_100156132 | 3300005539 | Unclassified | 2056 |
| 123 | Ga0068853_100438114 | 3300005539 | Unclassified | 1228 |
| 124 | Ga0070672_100227764 | 3300005543 | Bacteria | 1565 |
| 125 | Ga0070695_100110924 | 3300005545 | Unclassified | 1861 |
| 126 | Ga0070696_100088234 | 3300005546 | Bacteria | 2204 |
| 127 | Ga0070696_100172251 | 3300005546 | Unclassified | 1601 |
| 128 | Ga0070693_100439001 | 3300005547 | Unclassified | 913 |
| 129 | Ga0070665_100125691 | 3300005548 | Bacteria | 2567 |
| 130 | Ga0070665_100365852 | 3300005548 | Bacteria | 1448 |
| 131 | Ga0068855_100013569 | 3300005563 | Bacteria | 9826 |
| 132 | Ga0068855_100063619 | 3300005563 | Bacteria | 4305 |
| 133 | Ga0068855_100188112 | 3300005563 | Bacteria | 2331 |
| 134 | Ga0068855_100340483 | 3300005563 | Bacteria | 1654 |
| 135 | Ga0068855_100397031 | 3300005563 | Bacteria | 1512 |
| 136 | Ga0070664_100079375 | 3300005564 | Bacteria | 2825 |
| 137 | Ga0070664_100938051 | 3300005564 | Bacteria | 812 |
| 138 | Ga0068857_100023786 | 3300005577 | Bacteria | 5394 |
| 139 | Ga0068857_100420324 | 3300005577 | Bacteria | 1246 |
| 140 | Ga0068857_100695671 | 3300005577 | Unclassified | 966 |
| 141 | Ga0068857_101281084 | 3300005577 | Bacteria | 711 |
| 142 | Ga0068854_100142878 | 3300005578 | Unclassified | 1838 |
| 143 | Ga0068854_100855300 | 3300005578 | Unclassified | 796 |
| 144 | Ga0068854_101367264 | 3300005578 | Unclassified | 639 |
| 145 | Ga0068856_100002867 | 3300005614 | Bacteria | 17647 |
| 146 | Ga0068856_100006497 | 3300005614 | Bacteria | 11465 |
| 147 | Ga0068856_100034500 | 3300005614 | Bacteria | 4956 |
| 148 | Ga0068856_100075408 | 3300005614 | Unclassified | 3341 |
| 149 | Ga0068856_100451085 | 3300005614 | Bacteria | 1307 |
| 150 | Ga0068856_100584418 | 3300005614 | Unclassified | 1138 |
| 151 | Ga0068856_100588555 | 3300005614 | Unclassified | 1134 |
| 152 | Ga0068856_100600455 | 3300005614 | Bacteria | 1122 |
| 153 | Ga0068856_101089393 | 3300005614 | Unclassified | 816 |
| 154 | Ga0070702_100842455 | 3300005615 | Unclassified | 713 |
| 155 | Ga0068852_100307798 | 3300005616 | Bacteria | 1535 |
| 156 | Ga0068852_101826977 | 3300005616 | Bacteria | 630 |
| 157 | Ga0068859_100358367 | 3300005617 | Bacteria | 1553 |
| 158 | Ga0068859_101107459 | 3300005617 | Unclassified | 871 |
| 159 | Ga0068864_100251925 | 3300005618 | Bacteria | 1640 |
| 160 | Ga0068866_10179619 | 3300005718 | Bacteria | 1249 |
| 161 | Ga0068851_10139892 | 3300005834 | Bacteria | 1316 |
| 162 | Ga0068863_100015005 | 3300005841 | Bacteria | 7441 |
| 163 | Ga0068863_100018549 | 3300005841 | Bacteria | 6659 |
| 164 | Ga0068863_100027179 | 3300005841 | Bacteria | 5457 |
| 165 | Ga0068863_100031125 | 3300005841 | Bacteria | 5095 |
| 166 | Ga0068858_100007300 | 3300005842 | Bacteria | 10704 |
| 167 | Ga0068858_100433370 | 3300005842 | Unclassified | 1265 |
| 168 | Ga0068858_100808766 | 3300005842 | Bacteria | 914 |
| 169 | Ga0068858_100934633 | 3300005842 | Unclassified | 849 |
| 170 | Ga0068858_101029909 | 3300005842 | Unclassified | 807 |
| 171 | Ga0068860_100227615 | 3300005843 | Bacteria | 1812 |
| 172 | Ga0068860_100746541 | 3300005843 | Unclassified | 990 |
| 173 | Ga0068862_100150228 | 3300005844 | Bacteria | 2073 |
| 174 | Ga0068862_100663345 | 3300005844 | Bacteria | 1007 |
| 175 | Ga0081455_10008142 | 3300005937 | Bacteria | 10934 |
| 176 | Ga0081540_1036745 | 3300005983 | Unclassified | 2607 |
| 177 | Ga0070717_10008243 | 3300006028 | Bacteria | 7779 |
| 178 | Ga0070717_10016033 | 3300006028 | Bacteria | 5803 |
| 179 | Ga0070717_10036399 | 3300006028 | Bacteria | 3992 |
| 180 | Ga0070717_10049620 | 3300006028 | Bacteria | 3446 |
| 181 | Ga0070717_10063701 | 3300006028 | Bacteria | 3061 |
| 182 | Ga0070717_10071451 | 3300006028 | Bacteria | 2895 |
| 183 | Ga0070717_10172732 | 3300006028 | Bacteria | 1880 |
| 184 | Ga0070717_10185760 | 3300006028 | Bacteria | 1814 |
| 185 | Ga0070717_10591421 | 3300006028 | Bacteria | 1006 |
| 186 | Ga0070715_10022904 | 3300006163 | Unclassified | 2440 |
| 187 | Ga0070716_100000370 | 3300006173 | Bacteria | 18480 |
| 188 | Ga0070716_100181257 | 3300006173 | Bacteria | 1383 |
| 189 | Ga0070716_100406492 | 3300006173 | Unclassified | 980 |
| 190 | Ga0070716_101052809 | 3300006173 | Bacteria | 646 |
| 191 | Ga0070712_100002677 | 3300006175 | Bacteria | 10995 |
| 192 | Ga0070712_100016973 | 3300006175 | Bacteria | 4706 |
| 193 | Ga0070712_100122698 | 3300006175 | Bacteria | 1957 |
| 194 | Ga0070712_100317370 | 3300006175 | Bacteria | 1266 |
| 195 | Ga0097621_100872971 | 3300006237 | Unclassified | 837 |
| 196 | Ga0068871_100362792 | 3300006358 | Unclassified | 1283 |
| 197 | Ga0068871_101959482 | 3300006358 | Bacteria | 557 |
| 198 | Ga0075431_100095610 | 3300006847 | Bacteria | 3067 |
| 199 | Ga0075431_100262358 | 3300006847 | Bacteria | 1753 |
| 200 | Ga0075433_10925527 | 3300006852 | Unclassified | 760 |
| 201 | Ga0075434_100138208 | 3300006871 | Bacteria | 2456 |
| 202 | Ga0075429_100356477 | 3300006880 | Bacteria | 1281 |
| 203 | Ga0068865_100038329 | 3300006881 | Bacteria | 3243 |
| 204 | Ga0075436_100286777 | 3300006914 | Bacteria | 1178 |
| 205 | Ga0097620_100358348 | 3300006931 | Bacteria | 1553 |
| 206 | Ga0097620_101107399 | 3300006931 | Unclassified | 871 |
| 207 | Ga0075435_100106420 | 3300007076 | Bacteria | 2329 |
| 208 | Ga0075435_100940987 | 3300007076 | Bacteria | 754 |
| 209 | Ga0099794_10115248 | 3300007265 | Unclassified | 1349 |
| 210 | Ga0099794_10232124 | 3300007265 | Unclassified | 949 |
| 211 | Ga0099795_10179974 | 3300007788 | Unclassified | 882 |
| 212 | Ga0105240_10001788 | 3300009093 | Bacteria | 36269 |
| 213 | Ga0105240_10036510 | 3300009093 | Bacteria | 6320 |
| 214 | Ga0105240_10049306 | 3300009093 | Bacteria | 5316 |
| 215 | Ga0105240_10071151 | 3300009093 | Unclassified | 4302 |
| 216 | Ga0105240_10330424 | 3300009093 | Bacteria | 1735 |
| 217 | Ga0105240_10344041 | 3300009093 | Bacteria | 1693 |
| 218 | Ga0105240_10399765 | 3300009093 | Bacteria | 1548 |
| 219 | Ga0105240_11474276 | 3300009093 | Bacteria | 714 |
| 220 | Ga0105245_10012601 | 3300009098 | Bacteria | 7360 |
| 221 | Ga0105245_10162070 | 3300009098 | Bacteria | 2123 |
| 222 | Ga0105245_10763342 | 3300009098 | Unclassified | 1003 |
| 223 | Ga0105247_10233634 | 3300009101 | Bacteria | 1250 |
| 224 | Ga0114129_10129562 | 3300009147 | Bacteria | 3467 |
| 225 | Ga0114129_10162241 | 3300009147 | Bacteria | 3052 |
| 226 | Ga0105241_10004468 | 3300009174 | Bacteria | 10344 |
| 227 | Ga0105241_10152438 | 3300009174 | Unclassified | 1892 |
| 228 | Ga0105241_10633539 | 3300009174 | Bacteria | 969 |
| 229 | Ga0105241_10661721 | 3300009174 | Bacteria | 950 |
| 230 | Ga0105242_10108020 | 3300009176 | Bacteria | 2367 |
| 231 | Ga0105242_10196711 | 3300009176 | Bacteria | 1788 |
| 232 | Ga0105242_10629625 | 3300009176 | Bacteria | 1040 |
| 233 | Ga0105242_10934492 | 3300009176 | Bacteria | 870 |
| 234 | Ga0105248_10181203 | 3300009177 | Bacteria | 2374 |
| 235 | Ga0105248_11079525 | 3300009177 | Bacteria | 907 |
| 236 | Ga0105248_11117245 | 3300009177 | Unclassified | 891 |
| 237 | Ga0105248_11414308 | 3300009177 | Bacteria | 787 |
| 238 | Ga0105237_10007566 | 3300009545 | Bacteria | 11874 |
| 239 | Ga0105237_10038687 | 3300009545 | Bacteria | 4816 |
| 240 | Ga0105237_10146539 | 3300009545 | Bacteria | 2356 |
| 241 | Ga0105237_10550465 | 3300009545 | Bacteria | 1160 |
| 242 | Ga0105237_10605006 | 3300009545 | Unclassified | 1103 |
| 243 | Ga0105237_11040911 | 3300009545 | Bacteria | 825 |
| 244 | Ga0105237_11107334 | 3300009545 | Unclassified | 799 |
| 245 | Ga0105238_10191480 | 3300009551 | Unclassified | 2021 |
| 246 | Ga0105238_10247061 | 3300009551 | Bacteria | 1762 |
| 247 | Ga0105238_10273178 | 3300009551 | Bacteria | 1671 |
| 248 | Ga0105238_10374660 | 3300009551 | Bacteria | 1414 |
| 249 | Ga0105238_10722869 | 3300009551 | Unclassified | 1008 |
| 250 | Ga0105238_10899182 | 3300009551 | Bacteria | 904 |
| 251 | Ga0105249_10328860 | 3300009553 | Bacteria | 1542 |
| 252 | Ga0099796_10147675 | 3300010159 | Bacteria | 923 |
| 253 | Ga0105239_10144815 | 3300010375 | Unclassified | 2649 |
| 254 | Ga0105239_10181461 | 3300010375 | Bacteria | 2355 |
| 255 | Ga0105239_10250632 | 3300010375 | Unclassified | 1988 |
| 256 | Ga0105239_10422070 | 3300010375 | Bacteria | 1511 |
| 257 | Ga0105239_10426852 | 3300010375 | Bacteria | 1502 |
| 258 | Ga0157329_1002664 | 3300012491 | Bacteria | 1036 |
| 259 | Ga0157326_1000115 | 3300012513 | Bacteria | 8380 |
| 260 | Ga0157373_10004065 | 3300013100 | Bacteria | 11021 |
| 261 | Ga0157373_10052565 | 3300013100 | Bacteria | 2899 |
| 262 | Ga0157373_10428922 | 3300013100 | Bacteria | 950 |
| 263 | Ga0157371_10066319 | 3300013102 | Bacteria | 2556 |
| 264 | Ga0157370_10024938 | 3300013104 | Bacteria | 5918 |
| 265 | Ga0157370_10131100 | 3300013104 | Bacteria | 2338 |
| 266 | Ga0157370_10196291 | 3300013104 | Bacteria | 1873 |
| 267 | Ga0157370_10236665 | 3300013104 | Bacteria | 1690 |
| 268 | Ga0157370_10251984 | 3300013104 | Bacteria | 1633 |
| 269 | Ga0157370_10467113 | 3300013104 | Bacteria | 1160 |
| 270 | Ga0157369_10000176 | 3300013105 | Bacteria | 89387 |
| 271 | Ga0157369_10018758 | 3300013105 | Bacteria | 7755 |
| 272 | Ga0157369_10022746 | 3300013105 | Bacteria | 6989 |
| 273 | Ga0157369_10324428 | 3300013105 | Bacteria | 1600 |
| 274 | Ga0157369_10340623 | 3300013105 | Bacteria | 1558 |
| 275 | Ga0157369_10427646 | 3300013105 | Unclassified | 1373 |
| 276 | Ga0157369_10678578 | 3300013105 | Bacteria | 1062 |
| 277 | Ga0157369_10837486 | 3300013105 | Bacteria | 944 |
| 278 | Ga0157369_10850407 | 3300013105 | Bacteria | 936 |
| 279 | Ga0157369_11491910 | 3300013105 | Bacteria | 688 |
| 280 | Ga0157374_10000744 | 3300013296 | Bacteria | 28383 |
| 281 | Ga0157374_10007889 | 3300013296 | Bacteria | 9087 |
| 282 | Ga0157374_10007973 | 3300013296 | Bacteria | 9048 |
| 283 | Ga0157374_10020389 | 3300013296 | Bacteria | 5881 |
| 284 | Ga0157374_10144171 | 3300013296 | Bacteria | 2313 |
| 285 | Ga0157378_10020722 | 3300013297 | Bacteria | 5782 |
| 286 | Ga0163162_10055799 | 3300013306 | Bacteria | 3978 |
| 287 | Ga0163162_10132015 | 3300013306 | Bacteria | 2606 |
| 288 | Ga0163162_10159186 | 3300013306 | Bacteria | 2379 |
| 289 | Ga0163162_11252653 | 3300013306 | Bacteria | 842 |
| 290 | Ga0157372_10007162 | 3300013307 | Bacteria | 11870 |
| 291 | Ga0157372_10030761 | 3300013307 | Bacteria | 5874 |
| 292 | Ga0157372_10096920 | 3300013307 | Bacteria | 3362 |
| 293 | Ga0157372_10224907 | 3300013307 | Bacteria | 2176 |
| 294 | Ga0157372_10763371 | 3300013307 | Unclassified | 1124 |
| 295 | Ga0157372_10879961 | 3300013307 | Bacteria | 1039 |
| 296 | Ga0157372_10883086 | 3300013307 | Bacteria | 1037 |
| 297 | Ga0157372_11001580 | 3300013307 | Unclassified | 968 |
| 298 | Ga0157372_11853596 | 3300013307 | Bacteria | 693 |
| 299 | Ga0163163_10043562 | 3300014325 | Bacteria | 4400 |
| 300 | Ga0163163_10085126 | 3300014325 | Bacteria | 3169 |
| 301 | Ga0163163_11477847 | 3300014325 | Bacteria | 741 |
| 302 | Ga0157379_10060614 | 3300014968 | Bacteria | 3383 |
| 303 | Ga0157379_10181543 | 3300014968 | Bacteria | 1901 |
| 304 | Ga0157376_10062888 | 3300014969 | Unclassified | 3125 |
| 305 | Ga0157376_10089347 | 3300014969 | Bacteria | 2664 |
| 306 | Ga0157376_10100371 | 3300014969 | Bacteria | 2527 |
| 307 | Ga0163161_10714117 | 3300017792 | Bacteria | 836 |
| 308 | Ga0197907_10232491 | 3300020069 | Unclassified | 794 |
| 309 | Ga0197907_11451980 | 3300020069 | Bacteria | 633 |
| 310 | Ga0206356_11472961 | 3300020070 | Unclassified | 626 |
| 311 | Ga0206349_1931184 | 3300020075 | Unclassified | 696 |
| 312 | Ga0206351_10266289 | 3300020077 | Unclassified | 1260 |
| 313 | Ga0206352_10043527 | 3300020078 | Unclassified | 1232 |
| 314 | Ga0206350_10024126 | 3300020080 | Unclassified | 910 |
| 315 | Ga0206350_10024493 | 3300020080 | Unclassified | 522 |
| 316 | Ga0206350_10491217 | 3300020080 | Bacteria | 754 |
| 317 | Ga0206350_11038258 | 3300020080 | Unclassified | 624 |
| 318 | Ga0206354_11560833 | 3300020081 | Bacteria | 902 |
| 319 | Ga0154015_1615104 | 3300020610 | Unclassified | 1703 |
| 320 | Ga0213873_10058865 | 3300021358 | Bacteria | 1035 |
| 321 | Ga0213872_10001445 | 3300021361 | Bacteria | 15460 |
| 322 | Ga0213874_10025079 | 3300021377 | Bacteria | 1678 |
| 323 | Ga0213876_10003207 | 3300021384 | Bacteria | 9392 |
| 324 | Ga0213876_10123083 | 3300021384 | Bacteria | 1378 |
| 325 | Ga0213876_10152067 | 3300021384 | Bacteria | 1230 |
| 326 | Ga0213876_10284712 | 3300021384 | Bacteria | 878 |
| 327 | Ga0213875_10023638 | 3300021388 | Bacteria | 2935 |
| 328 | Ga0213875_10054791 | 3300021388 | Bacteria | 1867 |
| 329 | Ga0213875_10075336 | 3300021388 | Bacteria | 1574 |
| 330 | Ga0213875_10109619 | 3300021388 | Bacteria | 1289 |
| 331 | Ga0213875_10177384 | 3300021388 | Unclassified | 1001 |
| 332 | Ga0213875_10334247 | 3300021388 | Unclassified | 719 |
| 333 | Ga0213871_10105552 | 3300021441 | Bacteria | 828 |
| 334 | Ga0224712_10013532 | 3300022467 | Unclassified | 2601 |
| 335 | Ga0224712_10542530 | 3300022467 | Unclassified | 565 |
| 336 | Ga0224572_1054568 | 3300024225 | Unclassified | 743 |
| 337 | Ga0207692_10093933 | 3300025898 | Bacteria | 1632 |
| 338 | Ga0207692_10156358 | 3300025898 | Bacteria | 1310 |
| 339 | Ga0207692_10318521 | 3300025898 | Bacteria | 951 |
| 340 | Ga0207692_10872666 | 3300025898 | Unclassified | 591 |
| 341 | Ga0207642_10056320 | 3300025899 | Bacteria | 1803 |
| 342 | Ga0207688_10208370 | 3300025901 | Bacteria | 1174 |
| 343 | Ga0207680_10788103 | 3300025903 | Bacteria | 681 |
| 344 | Ga0207647_10026279 | 3300025904 | Bacteria | 3811 |
| 345 | Ga0207647_10111333 | 3300025904 | Bacteria | 1618 |
| 346 | Ga0207647_10393333 | 3300025904 | Bacteria | 782 |
| 347 | Ga0207685_10366137 | 3300025905 | Unclassified | 731 |
| 348 | Ga0207685_10386710 | 3300025905 | Bacteria | 714 |
| 349 | Ga0207685_10697087 | 3300025905 | Bacteria | 552 |
| 350 | Ga0207699_10054720 | 3300025906 | Bacteria | 2371 |
| 351 | Ga0207699_10118788 | 3300025906 | Bacteria | 1706 |
| 352 | Ga0207699_10170971 | 3300025906 | Bacteria | 1454 |
| 353 | Ga0207699_10243195 | 3300025906 | Bacteria | 1237 |
| 354 | Ga0207699_10269544 | 3300025906 | Bacteria | 1179 |
| 355 | Ga0207699_10329566 | 3300025906 | Bacteria | 1073 |
| 356 | Ga0207699_10651767 | 3300025906 | Bacteria | 769 |
| 357 | Ga0207705_10025641 | 3300025909 | Bacteria | 4206 |
| 358 | Ga0207705_10385939 | 3300025909 | Bacteria | 1082 |
| 359 | Ga0207705_10425881 | 3300025909 | Unclassified | 1028 |
| 360 | Ga0207705_10426177 | 3300025909 | Bacteria | 1027 |
| 361 | Ga0207705_11210577 | 3300025909 | Unclassified | 579 |
| 362 | Ga0207684_10001135 | 3300025910 | Bacteria | 29768 |
| 363 | Ga0207684_10003936 | 3300025910 | Bacteria | 14212 |
| 364 | Ga0207684_10013009 | 3300025910 | Bacteria | 7205 |
| 365 | Ga0207654_10006411 | 3300025911 | Bacteria | 5923 |
| 366 | Ga0207654_10037436 | 3300025911 | Unclassified | 2716 |
| 367 | Ga0207654_10141219 | 3300025911 | Unclassified | 1536 |
| 368 | Ga0207654_10882489 | 3300025911 | Bacteria | 648 |
| 369 | Ga0207707_10009254 | 3300025912 | Bacteria | 8547 |
| 370 | Ga0207707_10040954 | 3300025912 | Bacteria | 4045 |
| 371 | Ga0207707_10105256 | 3300025912 | Unclassified | 2466 |
| 372 | Ga0207707_10246691 | 3300025912 | Unclassified | 1551 |
| 373 | Ga0207695_10017479 | 3300025913 | Bacteria | 8346 |
| 374 | Ga0207695_10275838 | 3300025913 | Bacteria | 1576 |
| 375 | Ga0207695_10471369 | 3300025913 | Bacteria | 1138 |
| 376 | Ga0207695_10691081 | 3300025913 | Bacteria | 901 |
| 377 | Ga0207671_10111311 | 3300025914 | Bacteria | 2083 |
| 378 | Ga0207671_10226909 | 3300025914 | Bacteria | 1464 |
| 379 | Ga0207693_10002889 | 3300025915 | Bacteria | 14863 |
| 380 | Ga0207693_10003362 | 3300025915 | Bacteria | 13659 |
| 381 | Ga0207663_10002318 | 3300025916 | Bacteria | 9127 |
| 382 | Ga0207663_10019697 | 3300025916 | Bacteria | 3807 |
| 383 | Ga0207663_10225304 | 3300025916 | Bacteria | 1366 |
| 384 | Ga0207663_10341271 | 3300025916 | Bacteria | 1131 |
| 385 | Ga0207663_10689335 | 3300025916 | Unclassified | 808 |
| 386 | Ga0207660_10004672 | 3300025917 | Bacteria | 8917 |
| 387 | Ga0207660_10023928 | 3300025917 | Unclassified | 4130 |
| 388 | Ga0207660_10630540 | 3300025917 | Unclassified | 874 |
| 389 | Ga0207660_10676585 | 3300025917 | Bacteria | 842 |
| 390 | Ga0207660_10908403 | 3300025917 | Bacteria | 718 |
| 391 | Ga0207660_11338151 | 3300025917 | Unclassified | 581 |
| 392 | Ga0207657_10195945 | 3300025919 | Bacteria | 1627 |
| 393 | Ga0207657_10224040 | 3300025919 | Unclassified | 1506 |
| 394 | Ga0207657_10455292 | 3300025919 | Bacteria | 1004 |
| 395 | Ga0207657_10514166 | 3300025919 | Bacteria | 937 |
| 396 | Ga0207649_10207541 | 3300025920 | Unclassified | 1388 |
| 397 | Ga0207652_10070897 | 3300025921 | Unclassified | 3027 |
| 398 | Ga0207652_10106060 | 3300025921 | Bacteria | 2487 |
| 399 | Ga0207652_10168836 | 3300025921 | Unclassified | 1963 |
| 400 | Ga0207652_10423306 | 3300025921 | Unclassified | 1201 |
| 401 | Ga0207646_10005017 | 3300025922 | Bacteria | 14095 |
| 402 | Ga0207646_10021574 | 3300025922 | Bacteria | 5947 |
| 403 | Ga0207646_10074849 | 3300025922 | Bacteria | 3025 |
| 404 | Ga0207646_10216551 | 3300025922 | Unclassified | 1730 |
| 405 | Ga0207694_10135569 | 3300025924 | Bacteria | 1977 |
| 406 | Ga0207694_10211129 | 3300025924 | Bacteria | 1581 |
| 407 | Ga0207694_10408560 | 3300025924 | Bacteria | 1130 |
| 408 | Ga0207694_10608031 | 3300025924 | Bacteria | 919 |
| 409 | Ga0207694_10721244 | 3300025924 | Bacteria | 841 |
| 410 | Ga0207687_10064945 | 3300025927 | Bacteria | 2590 |
| 411 | Ga0207687_10134678 | 3300025927 | Bacteria | 1867 |
| 412 | Ga0207687_10814233 | 3300025927 | Bacteria | 797 |
| 413 | Ga0207687_11198572 | 3300025927 | Unclassified | 652 |
| 414 | Ga0207700_10011606 | 3300025928 | Bacteria | 5627 |
| 415 | Ga0207700_10024926 | 3300025928 | Bacteria | 4146 |
| 416 | Ga0207700_10347052 | 3300025928 | Bacteria | 1292 |
| 417 | Ga0207700_10383412 | 3300025928 | Bacteria | 1229 |
| 418 | Ga0207700_10582116 | 3300025928 | Bacteria | 995 |
| 419 | Ga0207664_10026573 | 3300025929 | Bacteria | 4377 |
| 420 | Ga0207664_10115734 | 3300025929 | Bacteria | 2236 |
| 421 | Ga0207664_10336576 | 3300025929 | Bacteria | 1334 |
| 422 | Ga0207664_10760635 | 3300025929 | Bacteria | 871 |
| 423 | Ga0207664_10954417 | 3300025929 | Unclassified | 769 |
| 424 | Ga0207664_10980150 | 3300025929 | Bacteria | 758 |
| 425 | Ga0207644_10018557 | 3300025931 | Bacteria | 4709 |
| 426 | Ga0207644_10538074 | 3300025931 | Bacteria | 966 |
| 427 | Ga0207690_10181029 | 3300025932 | Bacteria | 1587 |
| 428 | Ga0207706_10110483 | 3300025933 | Bacteria | 2418 |
| 429 | Ga0207706_10405783 | 3300025933 | Bacteria | 1181 |
| 430 | Ga0207706_10742462 | 3300025933 | Unclassified | 837 |
| 431 | Ga0207686_10081501 | 3300025934 | Bacteria | 2113 |
| 432 | Ga0207686_10231331 | 3300025934 | Bacteria | 1340 |
| 433 | Ga0207686_10896486 | 3300025934 | Bacteria | 715 |
| 434 | Ga0207704_10342338 | 3300025938 | Bacteria | 1161 |
| 435 | Ga0207665_10000159 | 3300025939 | Bacteria | 45540 |
| 436 | Ga0207665_10009234 | 3300025939 | Bacteria | 6474 |
| 437 | Ga0207665_10098008 | 3300025939 | Bacteria | 2042 |
| 438 | Ga0207665_10535998 | 3300025939 | Unclassified | 908 |
| 439 | Ga0207665_10613496 | 3300025939 | Bacteria | 850 |
| 440 | Ga0207665_10650797 | 3300025939 | Bacteria | 826 |
| 441 | Ga0207711_10194036 | 3300025941 | Bacteria | 1852 |
| 442 | Ga0207689_10006096 | 3300025942 | Bacteria | 10663 |
| 443 | Ga0207689_10219074 | 3300025942 | Unclassified | 1572 |
| 444 | Ga0207661_10067257 | 3300025944 | Bacteria | 2914 |
| 445 | Ga0207661_10112429 | 3300025944 | Bacteria | 2305 |
| 446 | Ga0207661_10530297 | 3300025944 | Unclassified | 1077 |
| 447 | Ga0207661_11614003 | 3300025944 | Unclassified | 593 |
| 448 | Ga0207679_10235040 | 3300025945 | Bacteria | 1550 |
| 449 | Ga0207679_10904777 | 3300025945 | Bacteria | 807 |
| 450 | Ga0207667_10037948 | 3300025949 | Bacteria | 5148 |
| 451 | Ga0207667_10042066 | 3300025949 | Bacteria | 4859 |
| 452 | Ga0207667_10055870 | 3300025949 | Bacteria | 4149 |
| 453 | Ga0207667_10082964 | 3300025949 | Bacteria | 3319 |
| 454 | Ga0207667_10123500 | 3300025949 | Bacteria | 2667 |
| 455 | Ga0207667_10382831 | 3300025949 | Bacteria | 1433 |
| 456 | Ga0207667_10576864 | 3300025949 | Unclassified | 1136 |
| 457 | Ga0207651_10095848 | 3300025960 | Bacteria | 2186 |
| 458 | Ga0207651_10158755 | 3300025960 | Bacteria | 1770 |
| 459 | Ga0207640_10542465 | 3300025981 | Bacteria | 976 |
| 460 | Ga0207658_10358953 | 3300025986 | Unclassified | 1271 |
| 461 | Ga0207658_10653195 | 3300025986 | Bacteria | 948 |
| 462 | Ga0207703_10003336 | 3300026035 | Bacteria | 13480 |
| 463 | Ga0207703_11533610 | 3300026035 | Bacteria | 641 |
| 464 | Ga0207639_10002681 | 3300026041 | Bacteria | 11950 |
| 465 | Ga0207639_10350741 | 3300026041 | Bacteria | 1318 |
| 466 | Ga0207678_10736556 | 3300026067 | Unclassified | 869 |
| 467 | Ga0207708_10844199 | 3300026075 | Bacteria | 790 |
| 468 | Ga0207702_10009022 | 3300026078 | Bacteria | 8398 |
| 469 | Ga0207702_10009187 | 3300026078 | Bacteria | 8311 |
| 470 | Ga0207702_10026780 | 3300026078 | Bacteria | 4787 |
| 471 | Ga0207702_10027019 | 3300026078 | Unclassified | 4766 |
| 472 | Ga0207702_10099802 | 3300026078 | Bacteria | 2560 |
| 473 | Ga0207702_10241398 | 3300026078 | Unclassified | 1693 |
| 474 | Ga0207702_10252836 | 3300026078 | Unclassified | 1656 |
| 475 | Ga0207702_10489388 | 3300026078 | Unclassified | 1198 |
| 476 | Ga0207702_10613831 | 3300026078 | Bacteria | 1068 |
| 477 | Ga0207702_11159349 | 3300026078 | Bacteria | 767 |
| 478 | Ga0207702_11285737 | 3300026078 | Bacteria | 726 |
| 479 | Ga0207641_10019852 | 3300026088 | Bacteria | 5516 |
| 480 | Ga0207641_10052010 | 3300026088 | Unclassified | 3468 |
| 481 | Ga0207641_10073999 | 3300026088 | Bacteria | 2937 |
| 482 | Ga0207641_10740832 | 3300026088 | Bacteria | 970 |
| 483 | Ga0207641_11861907 | 3300026088 | Bacteria | 603 |
| 484 | Ga0207648_10029434 | 3300026089 | Bacteria | 4870 |
| 485 | Ga0207676_10682691 | 3300026095 | Bacteria | 993 |
| 486 | Ga0207674_10040534 | 3300026116 | Bacteria | 4823 |
| 487 | Ga0207674_10121765 | 3300026116 | Bacteria | 2576 |
| 488 | Ga0207674_11478378 | 3300026116 | Bacteria | 649 |
| 489 | Ga0207675_100525564 | 3300026118 | Bacteria | 1180 |
| 490 | Ga0207683_10202869 | 3300026121 | Bacteria | 1803 |
| 491 | Ga0207698_10015132 | 3300026142 | Bacteria | 5157 |
| 492 | Ga0207698_11204633 | 3300026142 | Unclassified | 771 |
| 493 | Ga0209588_1163109 | 3300027671 | Bacteria | 703 |
| 494 | Ga0268266_10704974 | 3300028379 | Bacteria | 973 |
| 495 | Ga0268265_10156189 | 3300028380 | Bacteria | 1931 |
| 496 | Ga0268265_11494814 | 3300028380 | Bacteria | 679 |
| 497 | Ga0268264_10219737 | 3300028381 | Bacteria | 1749 |
| 498 | Ga0268264_11050938 | 3300028381 | Unclassified | 822 |
| 499 | Ga0265338_10013026 | 3300028800 | Bacteria | 9430 |
| 500 | Ga0265338_10046375 | 3300028800 | Bacteria | 3983 |
| 501 | Ga0265338_10149743 | 3300028800 | Bacteria | 1814 |
| 502 | Ga0265338_10206419 | 3300028800 | Bacteria | 1478 |
| 503 | Ga0265338_10418893 | 3300028800 | Bacteria | 952 |
| 504 | Ga0265760_10000376 | 3300031090 | Bacteria | 12478 |
| 505 | Ga0265760_10140829 | 3300031090 | Unclassified | 785 |
| 506 | Ga0265328_10099235 | 3300031239 | Unclassified | 1078 |
| 507 | Ga0265325_10029009 | 3300031241 | Bacteria | 2977 |
| 508 | Ga0265325_10030361 | 3300031241 | Unclassified | 2898 |
| 509 | Ga0265325_10034826 | 3300031241 | Bacteria | 2677 |
| 510 | Ga0265340_10038584 | 3300031247 | Bacteria | 2362 |
| 511 | Ga0265339_10026135 | 3300031249 | Bacteria | 3345 |
| 512 | Ga0265316_10016104 | 3300031344 | Bacteria | 6502 |
| 513 | Ga0265316_10027667 | 3300031344 | Bacteria | 4690 |
| 514 | Ga0265314_10085635 | 3300031711 | Bacteria | 2065 |
| 515 | Ga0373926_0003562 | 3300035083 | Bacteria | 5044 |
| 516 | Ga0373926_0167301 | 3300035083 | Bacteria | 841 |
| 517 | Ga0373926_0352454 | 3300035083 | Bacteria | 578 |
| 518 | Ga0373944_0013200 | 3300035089 | Unclassified | 2287 |
| 519 | Ga0373923_0220046 | 3300035111 | Bacteria | 882 |
| 520 | Ga0373932_0187929 | 3300035112 | Bacteria | 728 |
| 521 | Ga0373936_0004608 | 3300035113 | Bacteria | 5217 |
| 522 | Ga0373945_0008890 | 3300035116 | Unclassified | 3282 |
| 523 | Ga0373945_0177312 | 3300035116 | Bacteria | 876 |
| 524 | Ga0373954_0013107 | 3300035118 | Bacteria | 3691 |
| 525 | Ga0373956_0051164 | 3300035119 | Bacteria | 1856 |
| 526 | Ga0373957_0005203 | 3300035120 | Bacteria | 4022 |
| 527 | Ga0373960_0080939 | 3300035121 | Bacteria | 1022 |
| 528 | Ga0373946_0066226 | 3300035171 | Unclassified | 1548 |
| 529 | Ga0373924_0000304 | 3300035410 | Bacteria | 15161 |
| 530 | Ga0373924_0055830 | 3300035410 | Bacteria | 1644 |
| 531 | Ga0373931_0256028 | 3300035691 | Bacteria | 1066 |
| 532 | Ga0373931_0676172 | 3300035691 | Unclassified | 680 |
| 533 | Ga0373935_0265383 | 3300035692 | Bacteria | 1205 |
| 534 | Ga0373935_0551877 | 3300035692 | Bacteria | 840 |
| 535 | Ga0373927_0002071 | 3300035695 | Bacteria | 14816 |
| 536 | Ga0373927_0059797 | 3300035695 | Unclassified | 2465 |
| 537 | Ga0373927_0118480 | 3300035695 | Unclassified | 1727 |
| 538 | Ga0373927_0320959 | 3300035695 | Bacteria | 1020 |
| 539 | Ga0373933_0066516 | 3300035724 | Bacteria | 2184 |
| 540 | Ga0373933_0236296 | 3300035724 | Bacteria | 1175 |
| 541 | Ga0373933_0345210 | 3300035724 | Unclassified | 967 |
| 542 | Ga0373947_0016110 | 3300035725 | Bacteria | 4296 |
| 543 | Ga0373947_0381214 | 3300035725 | Bacteria | 949 |
| 544 | Ga0373937_0001266 | 3300036401 | Bacteria | 21178 |
| 545 | Ga0373937_0010333 | 3300036401 | Bacteria | 8149 |
| 546 | Ga0373937_0022576 | 3300036401 | Bacteria | 5660 |
| 547 | Ga0373937_0072292 | 3300036401 | Bacteria | 3181 |
| 548 | Ga0373937_0084818 | 3300036401 | Bacteria | 2931 |
| 549 | Ga0373937_0247640 | 3300036401 | Unclassified | 1680 |
| 550 | Ga0373937_0557946 | 3300036401 | Bacteria | 1088 |
| 551 | Ga0373937_0913373 | 3300036401 | Unclassified | 827 |
| 552 | Ga0373925_0026022 | 3300037068 | Bacteria | 4278 |
| 553 | Ga0373925_0156706 | 3300037068 | Unclassified | 1791 |
| 554 | Ga0373925_0179380 | 3300037068 | Unclassified | 1675 |
| 555 | Ga0373925_0514156 | 3300037068 | Bacteria | 983 |
| 556 | Ga0373925_0754936 | 3300037068 | Bacteria | 802 |
| 557 | Ga0395899_0145885 | 3300037312 | Bacteria | 1681 |
| 558 | Ga0395900_0060163 | 3300037418 | Bacteria | 3910 |
| 559 | Ga0395900_0245511 | 3300037418 | Bacteria | 1794 |
| 560 | Ga0395900_0909235 | 3300037418 | Bacteria | 803 |
| 561 | Ga0395900_1076118 | 3300037418 | Bacteria | 722 |
| 562 | Ga0395898_0986350 | 3300037466 | Bacteria | 779 |
| 563 | Ga0436364_0414552 | 3300037853 | Bacteria | 2412 |
| 564 | Ga0436364_0476732 | 3300037853 | Bacteria | 5854 |
| 565 | Ga0436364_0694061 | 3300037853 | Bacteria | 5424 |
| 566 | Ga0436364_0992254 | 3300037853 | Unclassified | 1113 |
| 567 | Ga0436364_1098164 | 3300037853 | Bacteria | 3472 |
| 568 | Ga0436364_1241905 | 3300037853 | Bacteria | 7222 |
| 569 | Ga0436364_1432658 | 3300037853 | Bacteria | 2768 |
| 570 | Ga0436364_1565351 | 3300037853 | Unclassified | 814 |
| 571 | Ga0436365_0258655 | 3300039437 | Bacteria | 9587 |
| 572 | Ga0436365_0314914 | 3300039437 | Bacteria | 12163 |
| 573 | Ga0436365_0547771 | 3300039437 | Bacteria | 4269 |
| 574 | Ga0436365_0688717 | 3300039437 | Bacteria | 1617 |
| 575 | Ga0436365_0779833 | 3300039437 | Bacteria | 5754 |
| 576 | Ga0436365_1189479 | 3300039437 | Bacteria | 1315 |
| 577 | Ga0436360_0569503 | 3300039438 | Bacteria | 950 |
| 578 | Ga0436360_0860172 | 3300039438 | Unclassified | 1151 |
| 579 | Ga0436360_1310473 | 3300039438 | Bacteria | 1399 |
| 580 | Ga0436361_0182389 | 3300039447 | Bacteria | 15481 |
| 581 | Ga0436361_0676841 | 3300039447 | Bacteria | 1201 |
| 582 | Ga0436363_0078300 | 3300039450 | Bacteria | 980 |
| 583 | Ga0436363_0498641 | 3300039450 | Bacteria | 1319 |
| 584 | Ga0436363_1159801 | 3300039450 | Bacteria | 3658 |
| 585 | Ga0436363_1593994 | 3300039450 | Bacteria | 4147 |
| 586 | Ga0436362_0400574 | 3300039453 | Bacteria | 3693 |
| 587 | Ga0436362_1183358 | 3300039453 | Bacteria | 1227 |
| 588 | Ga0436362_1241382 | 3300039453 | Bacteria | 8570 |
| 589 | Ga0451791_1527395 | 3300041451 | Unclassified | 799 |
| 590 | Ga0439432_140573 | 3300042006 | Bacteria | 710 |
| 591 | Ga0451577_0001621 | 3300042876 | Bacteria | 29253 |
| 592 | Ga0451577_0138779 | 3300042876 | Unclassified | 2184 |
| 593 | Ga0451577_0630977 | 3300042876 | Bacteria | 972 |
| 594 | Ga0453683_0017145 | 3300044673 | Bacteria | 4667 |
| 595 | Ga0466966_0046294 | 3300044684 | Unclassified | 2778 |
| 596 | Ga0466963_0044119 | 3300044694 | Bacteria | 2934 |
| 597 | Ga0466963_0568033 | 3300044694 | Unclassified | 801 |
| 598 | Ga0466964_0059756 | 3300044706 | Unclassified | 1584 |
| 599 | Ga0453684_0002322 | 3300044712 | Bacteria | 46658 |
| 600 | Ga0453684_0489457 | 3300044712 | Bacteria | 1364 |
| 601 | Ga0453684_2284106 | 3300044712 | Unclassified | 538 |
| 602 | Ga0466970_0392036 | 3300044765 | Bacteria | 792 |
| 603 | Ga0466957_1005211 | 3300044842 | Bacteria | 599 |
| 604 | Ga0466959_0092905 | 3300045049 | Unclassified | 2166 |
| 605 | Ga0466959_0173041 | 3300045049 | Bacteria | 1514 |
| 606 | Ga0451576_0097795 | 3300045051 | Bacteria | 3052 |
| 607 | Ga0451576_0625590 | 3300045051 | Bacteria | 1131 |
| 608 | Ga0451576_2083273 | 3300045051 | Unclassified | 584 |
| 609 | Ga0466958_0285918 | 3300045836 | Bacteria | 1057 |
| 610 | Ga0466958_0472972 | 3300045836 | Unclassified | 812 |
| 611 | Ga0466958_0496561 | 3300045836 | Unclassified | 792 |
| 612 | Ga0466967_0000985 | 3300045976 | Bacteria | 15477 |
| 613 | Ga0466967_0206955 | 3300045976 | Unclassified | 1860 |
| 614 | Ga0466967_0227830 | 3300045976 | Bacteria | 1773 |
| 615 | Ga0466967_0405573 | 3300045976 | Bacteria | 1327 |
| 616 | Ga0495603_0616127 | 3300046455 | Unclassified | 621 |
| 617 | Ga0495651_0093780 | 3300046462 | Bacteria | 2247 |
| 618 | Ga0495580_0000809 | 3300046472 | Bacteria | 27092 |
| 619 | Ga0495580_0000971 | 3300046472 | Bacteria | 25127 |
| 620 | Ga0495580_0007053 | 3300046472 | Bacteria | 9057 |
| 621 | Ga0495580_0067207 | 3300046472 | Bacteria | 2508 |
| 622 | Ga0495580_0089427 | 3300046472 | Bacteria | 2144 |
| 623 | Ga0495580_0093616 | 3300046472 | Bacteria | 2091 |
| 624 | Ga0495580_0161357 | 3300046472 | Bacteria | 1551 |
| 625 | Ga0495580_0169979 | 3300046472 | Bacteria | 1507 |
| 626 | Ga0495580_0260252 | 3300046472 | Bacteria | 1187 |
| 627 | Ga0495580_0415786 | 3300046472 | Bacteria | 905 |
| 628 | Ga0495580_0438830 | 3300046472 | Bacteria | 877 |
| 629 | Ga0495582_0028864 | 3300046473 | Bacteria | 3045 |
| 630 | Ga0495582_0112596 | 3300046473 | Bacteria | 1529 |
| 631 | Ga0495639_0062543 | 3300046475 | Bacteria | 1708 |
| 632 | Ga0495639_0398748 | 3300046475 | Bacteria | 695 |
| 633 | Ga0495594_0551132 | 3300046499 | Bacteria | 654 |
| 634 | Ga0495608_0328362 | 3300046511 | Unclassified | 944 |
| 635 | Ga0495628_0206801 | 3300046516 | Bacteria | 1477 |
| 636 | Ga0495642_0108296 | 3300046528 | Bacteria | 1187 |
| 637 | Ga0495665_0128548 | 3300046531 | Unclassified | 1326 |
| 638 | Ga0495640_0304867 | 3300046533 | Unclassified | 989 |
| 639 | Ga0495645_0317815 | 3300046543 | Bacteria | 1012 |
| 640 | Ga0495667_0090864 | 3300046559 | Unclassified | 1978 |
| 641 | Ga0495635_0291322 | 3300046663 | Unclassified | 1095 |
| 642 | Ga0495658_0208699 | 3300046683 | Unclassified | 1220 |
| 643 | Ga0495669_0023499 | 3300046684 | Bacteria | 2684 |
| 644 | Ga0495669_0356525 | 3300046684 | Bacteria | 707 |
| 645 | Ga0495581_0090263 | 3300047315 | Unclassified | 1777 |
| 646 | Ga0495604_0549859 | 3300047317 | Bacteria | 744 |
| 647 | Ga0495684_0528795 | 3300047471 | Bacteria | 806 |
| 648 | Ga0495593_0105299 | 3300047673 | Unclassified | 1444 |
| 649 | Ga0496101_0325220 | 3300048904 | Bacteria | 1207 |
| 650 | Ga0496101_0343367 | 3300048904 | Bacteria | 1173 |
| 651 | Ga0496102_0256642 | 3300048905 | Bacteria | 1648 |
| 652 | Ga0496102_0270576 | 3300048905 | Bacteria | 1602 |
| 653 | Ga0496102_0865800 | 3300048905 | Bacteria | 826 |
| 654 | Ga0496104_0239132 | 3300048907 | Bacteria | 1728 |
| 655 | Ga0496104_0246311 | 3300048907 | Bacteria | 1700 |
| 656 | Ga0496104_0266023 | 3300048907 | Unclassified | 1627 |
| 657 | Ga0496104_0271636 | 3300048907 | Bacteria | 1608 |
| 658 | Ga0496104_0577318 | 3300048907 | Bacteria | 1035 |
| 659 | Ga0496105_0010424 | 3300048908 | Bacteria | 7310 |
| 660 | Ga0496105_0134187 | 3300048908 | Unclassified | 2040 |
| 661 | Ga0496108_0388919 | 3300048911 | Bacteria | 1218 |
| 662 | Ga0496108_1010401 | 3300048911 | Unclassified | 710 |
| 663 | Ga0496109_0110633 | 3300048912 | Bacteria | 2554 |
| 664 | Ga0496110_0352402 | 3300048913 | Unclassified | 1341 |
| 665 | Ga0496112_0003730 | 3300048915 | Bacteria | 12721 |
| 666 | Ga0496112_0019164 | 3300048915 | Bacteria | 6452 |
| 667 | Ga0496112_0069108 | 3300048915 | Bacteria | 3489 |
| 668 | Ga0496112_0074390 | 3300048915 | Unclassified | 3359 |
| 669 | Ga0496112_0080454 | 3300048915 | Unclassified | 3222 |
| 670 | Ga0496112_0096215 | 3300048915 | Bacteria | 2931 |
| 671 | Ga0496113_0002032 | 3300048916 | Bacteria | 11618 |
| 672 | Ga0496113_0015986 | 3300048916 | Bacteria | 5176 |
| 673 | Ga0496113_0457201 | 3300048916 | Bacteria | 1026 |
| 674 | Ga0496113_0836775 | 3300048916 | Unclassified | 730 |
| 675 | Ga0496115_0002633 | 3300048918 | Bacteria | 12890 |
| 676 | Ga0496115_0588264 | 3300048918 | Bacteria | 886 |
| 677 | Ga0501299_171243 | 3300049522 | Bacteria | 561 |
| 678 | Ga0501032_0437928 | 3300049569 | Bacteria | 838 |
| 679 | Ga0501033_0037457 | 3300049570 | Unclassified | 3630 |
| 680 | Ga0501034_0035583 | 3300049571 | Bacteria | 5048 |
| 681 | Ga0501034_0515080 | 3300049571 | Unclassified | 1109 |
| 682 | Ga0501043_0231180 | 3300049579 | Bacteria | 1428 |
| 683 | Ga0501046_0503070 | 3300049580 | Bacteria | 868 |
| 684 | Ga0501047_0059129 | 3300049581 | Unclassified | 3701 |
| 685 | Ga0501047_0074038 | 3300049581 | Bacteria | 3279 |
| 686 | Ga0501047_0113836 | 3300049581 | Unclassified | 2587 |
| 687 | Ga0501047_0129917 | 3300049581 | Bacteria | 2400 |
| 688 | Ga0501070_0002154 | 3300049586 | Bacteria | 17307 |
| 689 | Ga0501070_0046568 | 3300049586 | Bacteria | 3606 |
| 690 | Ga0501073_0678375 | 3300049589 | Bacteria | 711 |
| 691 | Ga0501035_0056347 | 3300049822 | Bacteria | 3507 |
| 692 | Ga0501035_0122236 | 3300049822 | Bacteria | 2275 |
| 693 | Ga0501044_0032698 | 3300049823 | Bacteria | 5467 |
| 694 | Ga0501044_0034174 | 3300049823 | Bacteria | 5335 |
| 695 | Ga0501044_0076871 | 3300049823 | Unclassified | 3387 |
| 696 | Ga0501044_0196315 | 3300049823 | Bacteria | 1978 |
| 697 | nmdc:mga05p37_204513_c1 | 3300050507 | Unclassified | 2389 |
| 698 | nmdc:mga06r32_281638_c1 | 3300050510 | Bacteria | 1649 |
| 699 | nmdc:mga0n895_1010221_c1 | 3300050512 | Bacteria | 812 |
| 700 | nmdc:mga0n895_110542_c1 | 3300050512 | Bacteria | 2764 |
| 701 | nmdc:mga0rr50_92634_c1 | 3300050513 | Bacteria | 2356 |
| 702 | nmdc:mga08x19_352317_c1 | 3300050514 | Bacteria | 1028 |
| 703 | nmdc:mga08x19_521447_c1 | 3300050514 | Bacteria | 840 |
| 704 | nmdc:mga0a205_897476_c1 | 3300050515 | Unclassified | 733 |
| 705 | Ga0495601_0234299 | 3300053077 | Bacteria | 1199 |
| 706 | Ga0495601_0394924 | 3300053077 | Unclassified | 897 |
| 707 | Ga0495619_0129853 | 3300053085 | Bacteria | 1731 |
| 708 | Ga0587093_033276 | 3300059478 | Unclassified | 752 |
| 709 | Ga0587073_0230891 | 3300059492 | Bacteria | 570 |
| 710 | Ga0587085_040741 | 3300059506 | Unclassified | 808 |
| 711 | Ga0587075_075114 | 3300059644 | Bacteria | 635 |
| 712 | Ga0501082_1468976 | 3300060353 | Bacteria | 595 |
| 713 | Ga0207695_10002257 | |||
| 714 | JGI24736J21556_1040945 | |||
| 715 | JGI24737J22298_10086169 | |||
| 716 | Ga0065712_10123382 | |||
| 717 | Ga0065712_10478414 | |||
| 718 | Ga0070658_10129524 | |||
| 719 | Ga0070658_10363854 | |||
| 720 | Ga0070658_10531848 | |||
| 721 | Ga0070658_10816520 | |||
| 722 | Ga0070658_11471051 | |||
| 723 | Ga0070683_100445764 | |||
| 724 | Ga0070683_100470543 | |||
| 725 | Ga0070683_100475220 | |||
| 726 | Ga0070683_100826875 | |||
| 727 | Ga0070690_100992129 | |||
| 728 | Ga0068869_100005975 | |||
| 729 | Ga0068869_100197736 | |||
| 730 | Ga0070666_10136777 | |||
| 731 | Ga0070666_10496171 | |||
| 732 | Ga0070680_100014540 | |||
| 733 | Ga0070680_100048185 | |||
| 734 | Ga0070680_100167675 | |||
| 735 | Ga0070680_100179439 | |||
| 736 | Ga0070680_100468440 | |||
| 737 | Ga0070680_101026451 | |||
| 738 | Ga0070680_101467225 | |||
| 739 | Ga0070660_100088189 | |||
| 740 | Ga0070660_100198455 | |||
| 741 | Ga0070660_100443026 | |||
| 742 | Ga0070660_100532316 | |||
| 743 | Ga0070661_100251700 | |||
| 744 | Ga0070661_100608230 | |||
| 745 | Ga0070661_100734553 | |||
| 746 | Ga0070692_10376272 | |||
| 747 | Ga0070671_100077834 | |||
| 748 | Ga0070673_100018349 | |||
| 749 | Ga0070673_100116325 | |||
| 750 | Ga0070688_100295391 | |||
| 751 | Ga0070688_101282314 | |||
| 752 | Ga0070659_100135818 | |||
| 753 | Ga0070667_100835312 | |||
| 754 | Ga0070667_101476913 | |||
| 755 | Ga0070709_10015570 | |||
| 756 | Ga0070709_10034594 | |||
| 757 | Ga0070709_10074254 | |||
| 758 | Ga0070709_10183174 | |||
| 759 | Ga0070709_10331580 | |||
| 760 | Ga0070709_10635967 | |||
| 761 | Ga0070714_100008945 | |||
| 762 | Ga0070714_100013528 | |||
| 763 | Ga0070714_100110896 | |||
| 764 | Ga0070714_100234242 | |||
| 765 | Ga0070714_100597192 | |||
| 766 | Ga0070714_100937213 | |||
| 767 | Ga0070714_101192473 | |||
| 768 | Ga0070714_101243548 | |||
| 769 | Ga0070714_101676049 | |||
| 770 | Ga0070713_100002803 | |||
| 771 | Ga0070713_100046549 | |||
| 772 | Ga0070713_100075518 | |||
| 773 | Ga0070713_100099065 | |||
| 774 | Ga0070713_100204852 | |||
| 775 | Ga0070713_100286586 | |||
| 776 | Ga0070713_100307599 | |||
| 777 | Ga0070713_100669300 | |||
| 778 | Ga0070713_100812545 | |||
| 779 | Ga0070713_101586341 | |||
| 780 | Ga0070710_10033319 | |||
| 781 | Ga0070710_10526962 | |||
| 782 | Ga0070711_100001117 | |||
| 783 | Ga0070711_100999612 | |||
| 784 | Ga0070700_100455567 | |||
| 785 | Ga0070694_101238098 | |||
| 786 | Ga0070708_100001333 | |||
| 787 | Ga0070708_100002056 | |||
| 788 | Ga0070708_100117293 | |||
| 789 | Ga0070708_100130650 | |||
| 790 | Ga0070708_100404659 | |||
| 791 | Ga0070708_100433357 | |||
| 792 | Ga0070678_100115288 | |||
| 793 | Ga0070678_100138813 | |||
| 794 | Ga0070681_10002804 | |||
| 795 | Ga0070681_10007002 | |||
| 796 | Ga0070681_10317406 | |||
| 797 | Ga0070681_10456904 | |||
| 798 | Ga0070681_10749991 | |||
| 799 | Ga0070681_11030770 | |||
| 800 | Ga0068867_100030981 | |||
| 801 | Ga0070685_10022947 | |||
| 802 | Ga0070706_100000434 | |||
| 803 | Ga0070706_100000964 | |||
| 804 | Ga0070706_100075258 | |||
| 805 | Ga0070707_100001324 | |||
| 806 | Ga0070707_100003717 | |||
| 807 | Ga0070707_100233065 | |||
| 808 | Ga0070707_100264188 | |||
| 809 | Ga0070698_100000491 | |||
| 810 | Ga0070698_100004164 | |||
| 811 | Ga0070698_100328989 | |||
| 812 | Ga0070699_100001228 | |||
| 813 | Ga0070699_100219135 | |||
| 814 | Ga0070699_100319495 | |||
| 815 | Ga0070699_100841612 | |||
| 816 | Ga0070679_100018495 | |||
| 817 | Ga0070679_100043857 | |||
| 818 | Ga0070679_100048002 | |||
| 819 | Ga0070679_100192146 | |||
| 820 | Ga0070679_100203882 | |||
| 821 | Ga0070679_100558982 | |||
| 822 | Ga0070684_100103818 | |||
| 823 | Ga0070684_100105735 | |||
| 824 | Ga0070697_100000816 | |||
| 825 | Ga0070697_100001114 | |||
| 826 | Ga0070697_100002580 | |||
| 827 | Ga0070697_100008339 | |||
| 828 | Ga0070697_100384489 | |||
| 829 | Ga0070697_100576967 | |||
| 830 | Ga0070697_100820879 | |||
| 831 | Ga0070697_100955318 | |||
| 832 | Ga0070697_101828338 | |||
| 833 | Ga0068853_100003545 | |||
| 834 | Ga0068853_100156132 | |||
| 835 | Ga0068853_100438114 | |||
| 836 | Ga0070672_100227764 | |||
| 837 | Ga0070695_100110924 | |||
| 838 | Ga0070696_100088234 | |||
| 839 | Ga0070696_100172251 | |||
| 840 | Ga0070693_100439001 | |||
| 841 | Ga0070665_100125691 | |||
| 842 | Ga0070665_100365852 | |||
| 843 | Ga0068855_100013569 | |||
| 844 | Ga0068855_100063619 | |||
| 845 | Ga0068855_100188112 | |||
| 846 | Ga0068855_100340483 | |||
| 847 | Ga0068855_100397031 | |||
| 848 | Ga0070664_100079375 | |||
| 849 | Ga0070664_100938051 | |||
| 850 | Ga0068857_100023786 | |||
| 851 | Ga0068857_100420324 | |||
| 852 | Ga0068857_100695671 | |||
| 853 | Ga0068857_101281084 | |||
| 854 | Ga0068854_100142878 | |||
| 855 | Ga0068854_100855300 | |||
| 856 | Ga0068854_101367264 | |||
| 857 | Ga0068856_100002867 | |||
| 858 | Ga0068856_100006497 | |||
| 859 | Ga0068856_100034500 | |||
| 860 | Ga0068856_100075408 | |||
| 861 | Ga0068856_100451085 | |||
| 862 | Ga0068856_100584418 | |||
| 863 | Ga0068856_100588555 | |||
| 864 | Ga0068856_100600455 | |||
| 865 | Ga0068856_101089393 | |||
| 866 | Ga0070702_100842455 | |||
| 867 | Ga0068852_100307798 | |||
| 868 | Ga0068852_101826977 | |||
| 869 | Ga0068859_100358367 | |||
| 870 | Ga0068859_101107459 | |||
| 871 | Ga0068864_100251925 | |||
| 872 | Ga0068866_10179619 | |||
| 873 | Ga0068851_10139892 | |||
| 874 | Ga0068863_100015005 | |||
| 875 | Ga0068863_100018549 | |||
| 876 | Ga0068863_100027179 | |||
| 877 | Ga0068863_100031125 | |||
| 878 | Ga0068858_100007300 | |||
| 879 | Ga0068858_100433370 | |||
| 880 | Ga0068858_100808766 | |||
| 881 | Ga0068858_100934633 | |||
| 882 | Ga0068858_101029909 | |||
| 883 | Ga0068860_100227615 | |||
| 884 | Ga0068860_100746541 | |||
| 885 | Ga0068862_100150228 | |||
| 886 | Ga0068862_100663345 | |||
| 887 | Ga0081455_10008142 | |||
| 888 | Ga0081540_1036745 | |||
| 889 | Ga0070717_10008243 | |||
| 890 | Ga0070717_10016033 | |||
| 891 | Ga0070717_10036399 | |||
| 892 | Ga0070717_10049620 | |||
| 893 | Ga0070717_10063701 | |||
| 894 | Ga0070717_10071451 | |||
| 895 | Ga0070717_10172732 | |||
| 896 | Ga0070717_10185760 | |||
| 897 | Ga0070717_10591421 | |||
| 898 | Ga0070715_10022904 | |||
| 899 | Ga0070716_100000370 | |||
| 900 | Ga0070716_100181257 | |||
| 901 | Ga0070716_100406492 | |||
| 902 | Ga0070716_101052809 | |||
| 903 | Ga0070712_100002677 | |||
| 904 | Ga0070712_100016973 | |||
| 905 | Ga0070712_100122698 | |||
| 906 | Ga0070712_100317370 | |||
| 907 | Ga0097621_100872971 | |||
| 908 | Ga0068871_100362792 | |||
| 909 | Ga0068871_101959482 | |||
| 910 | Ga0075431_100095610 | |||
| 911 | Ga0075431_100262358 | |||
| 912 | Ga0075433_10925527 | |||
| 913 | Ga0075434_100138208 | |||
| 914 | Ga0075429_100356477 | |||
| 915 | Ga0068865_100038329 | |||
| 916 | Ga0075436_100286777 | |||
| 917 | Ga0097620_100358348 | |||
| 918 | Ga0097620_101107399 | |||
| 919 | Ga0075435_100106420 | |||
| 920 | Ga0075435_100940987 | |||
| 921 | Ga0099794_10115248 | |||
| 922 | Ga0099794_10232124 | |||
| 923 | Ga0099795_10179974 | |||
| 924 | Ga0105240_10001788 | |||
| 925 | Ga0105240_10036510 | |||
| 926 | Ga0105240_10049306 | |||
| 927 | Ga0105240_10071151 | |||
| 928 | Ga0105240_10330424 | |||
| 929 | Ga0105240_10344041 | |||
| 930 | Ga0105240_10399765 | |||
| 931 | Ga0105240_11474276 | |||
| 932 | Ga0105245_10012601 | |||
| 933 | Ga0105245_10162070 | |||
| 934 | Ga0105245_10763342 | |||
| 935 | Ga0105247_10233634 | |||
| 936 | Ga0114129_10129562 | |||
| 937 | Ga0114129_10162241 | |||
| 938 | Ga0105241_10004468 | |||
| 939 | Ga0105241_10152438 | |||
| 940 | Ga0105241_10633539 | |||
| 941 | Ga0105241_10661721 | |||
| 942 | Ga0105242_10108020 | |||
| 943 | Ga0105242_10196711 | |||
| 944 | Ga0105242_10629625 | |||
| 945 | Ga0105242_10934492 | |||
| 946 | Ga0105248_10181203 | |||
| 947 | Ga0105248_11079525 | |||
| 948 | Ga0105248_11117245 | |||
| 949 | Ga0105248_11414308 | |||
| 950 | Ga0105237_10007566 | |||
| 951 | Ga0105237_10038687 | |||
| 952 | Ga0105237_10146539 | |||
| 953 | Ga0105237_10550465 | |||
| 954 | Ga0105237_10605006 | |||
| 955 | Ga0105237_11040911 | |||
| 956 | Ga0105237_11107334 | |||
| 957 | Ga0105238_10191480 | |||
| 958 | Ga0105238_10247061 | |||
| 959 | Ga0105238_10273178 | |||
| 960 | Ga0105238_10374660 | |||
| 961 | Ga0105238_10722869 | |||
| 962 | Ga0105238_10899182 | |||
| 963 | Ga0105249_10328860 | |||
| 964 | Ga0099796_10147675 | |||
| 965 | Ga0105239_10144815 | |||
| 966 | Ga0105239_10181461 | |||
| 967 | Ga0105239_10250632 | |||
| 968 | Ga0105239_10422070 | |||
| 969 | Ga0105239_10426852 | |||
| 970 | Ga0157329_1002664 | |||
| 971 | Ga0157326_1000115 | |||
| 972 | Ga0157373_10004065 | |||
| 973 | Ga0157373_10052565 | |||
| 974 | Ga0157373_10428922 | |||
| 975 | Ga0157371_10066319 | |||
| 976 | Ga0157370_10024938 | |||
| 977 | Ga0157370_10131100 | |||
| 978 | Ga0157370_10196291 | |||
| 979 | Ga0157370_10236665 | |||
| 980 | Ga0157370_10251984 | |||
| 981 | Ga0157370_10467113 | |||
| 982 | Ga0157369_10000176 | |||
| 983 | Ga0157369_10018758 | |||
| 984 | Ga0157369_10022746 | |||
| 985 | Ga0157369_10324428 | |||
| 986 | Ga0157369_10340623 | |||
| 987 | Ga0157369_10427646 | |||
| 988 | Ga0157369_10678578 | |||
| 989 | Ga0157369_10837486 | |||
| 990 | Ga0157369_10850407 | |||
| 991 | Ga0157369_11491910 | |||
| 992 | Ga0157374_10000744 | |||
| 993 | Ga0157374_10007889 | |||
| 994 | Ga0157374_10007973 | |||
| 995 | Ga0157374_10020389 | |||
| 996 | Ga0157374_10144171 | |||
| 997 | Ga0157378_10020722 | |||
| 998 | Ga0163162_10055799 | |||
| 999 | Ga0163162_10132015 | |||
| 1000 | Ga0163162_10159186 | |||
| 1001 | Ga0163162_11252653 | |||
| 1002 | Ga0157372_10007162 | |||
| 1003 | Ga0157372_10030761 | |||
| 1004 | Ga0157372_10096920 | |||
| 1005 | Ga0157372_10224907 | |||
| 1006 | Ga0157372_10763371 | |||
| 1007 | Ga0157372_10879961 | |||
| 1008 | Ga0157372_10883086 | |||
| 1009 | Ga0157372_11001580 | |||
| 1010 | Ga0157372_11853596 | |||
| 1011 | Ga0163163_10043562 | |||
| 1012 | Ga0163163_10085126 | |||
| 1013 | Ga0163163_11477847 | |||
| 1014 | Ga0157379_10060614 | |||
| 1015 | Ga0157379_10181543 | |||
| 1016 | Ga0157376_10062888 | |||
| 1017 | Ga0157376_10089347 | |||
| 1018 | Ga0157376_10100371 | |||
| 1019 | Ga0163161_10714117 | |||
| 1020 | Ga0197907_10232491 | |||
| 1021 | Ga0197907_11451980 | |||
| 1022 | Ga0206356_11472961 | |||
| 1023 | Ga0206349_1931184 | |||
| 1024 | Ga0206351_10266289 | |||
| 1025 | Ga0206352_10043527 | |||
| 1026 | Ga0206350_10024126 | |||
| 1027 | Ga0206350_10024493 | |||
| 1028 | Ga0206350_10491217 | |||
| 1029 | Ga0206350_11038258 | |||
| 1030 | Ga0206354_11560833 | |||
| 1031 | Ga0154015_1615104 | |||
| 1032 | Ga0213873_10058865 | |||
| 1033 | Ga0213872_10001445 | |||
| 1034 | Ga0213874_10025079 | |||
| 1035 | Ga0213876_10003207 | |||
| 1036 | Ga0213876_10123083 | |||
| 1037 | Ga0213876_10152067 | |||
| 1038 | Ga0213876_10284712 | |||
| 1039 | Ga0213875_10023638 | |||
| 1040 | Ga0213875_10054791 | |||
| 1041 | Ga0213875_10075336 | |||
| 1042 | Ga0213875_10109619 | |||
| 1043 | Ga0213875_10177384 | |||
| 1044 | Ga0213875_10334247 | |||
| 1045 | Ga0213871_10105552 | |||
| 1046 | Ga0224712_10013532 | |||
| 1047 | Ga0224712_10542530 | |||
| 1048 | Ga0224572_1054568 | |||
| 1049 | Ga0207692_10093933 | |||
| 1050 | Ga0207692_10156358 | |||
| 1051 | Ga0207692_10318521 | |||
| 1052 | Ga0207692_10872666 | |||
| 1053 | Ga0207642_10056320 | |||
| 1054 | Ga0207688_10208370 | |||
| 1055 | Ga0207680_10788103 | |||
| 1056 | Ga0207647_10026279 | |||
| 1057 | Ga0207647_10111333 | |||
| 1058 | Ga0207647_10393333 | |||
| 1059 | Ga0207685_10366137 | |||
| 1060 | Ga0207685_10386710 | |||
| 1061 | Ga0207685_10697087 | |||
| 1062 | Ga0207699_10054720 | |||
| 1063 | Ga0207699_10118788 | |||
| 1064 | Ga0207699_10170971 | |||
| 1065 | Ga0207699_10243195 | |||
| 1066 | Ga0207699_10269544 | |||
| 1067 | Ga0207699_10329566 | |||
| 1068 | Ga0207699_10651767 | |||
| 1069 | Ga0207705_10025641 | |||
| 1070 | Ga0207705_10385939 | |||
| 1071 | Ga0207705_10425881 | |||
| 1072 | Ga0207705_10426177 | |||
| 1073 | Ga0207705_11210577 | |||
| 1074 | Ga0207684_10001135 | |||
| 1075 | Ga0207684_10003936 | |||
| 1076 | Ga0207684_10013009 | |||
| 1077 | Ga0207654_10006411 | |||
| 1078 | Ga0207654_10037436 | |||
| 1079 | Ga0207654_10141219 | |||
| 1080 | Ga0207654_10882489 | |||
| 1081 | Ga0207707_10009254 | |||
| 1082 | Ga0207707_10040954 | |||
| 1083 | Ga0207707_10105256 | |||
| 1084 | Ga0207707_10246691 | |||
| 1085 | Ga0207695_10017479 | |||
| 1086 | Ga0207695_10275838 | |||
| 1087 | Ga0207695_10471369 | |||
| 1088 | Ga0207695_10691081 | |||
| 1089 | Ga0207671_10111311 | |||
| 1090 | Ga0207671_10226909 | |||
| 1091 | Ga0207693_10002889 | |||
| 1092 | Ga0207693_10003362 | |||
| 1093 | Ga0207663_10002318 | |||
| 1094 | Ga0207663_10019697 | |||
| 1095 | Ga0207663_10225304 | |||
| 1096 | Ga0207663_10341271 | |||
| 1097 | Ga0207663_10689335 | |||
| 1098 | Ga0207660_10004672 | |||
| 1099 | Ga0207660_10023928 | |||
| 1100 | Ga0207660_10630540 | |||
| 1101 | Ga0207660_10676585 | |||
| 1102 | Ga0207660_10908403 | |||
| 1103 | Ga0207660_11338151 | |||
| 1104 | Ga0207657_10195945 | |||
| 1105 | Ga0207657_10224040 | |||
| 1106 | Ga0207657_10455292 | |||
| 1107 | Ga0207657_10514166 | |||
| 1108 | Ga0207649_10207541 | |||
| 1109 | Ga0207652_10070897 | |||
| 1110 | Ga0207652_10106060 | |||
| 1111 | Ga0207652_10168836 | |||
| 1112 | Ga0207652_10423306 | |||
| 1113 | Ga0207646_10005017 | |||
| 1114 | Ga0207646_10021574 | |||
| 1115 | Ga0207646_10074849 | |||
| 1116 | Ga0207646_10216551 | |||
| 1117 | Ga0207694_10135569 | |||
| 1118 | Ga0207694_10211129 | |||
| 1119 | Ga0207694_10408560 | |||
| 1120 | Ga0207694_10608031 | |||
| 1121 | Ga0207694_10721244 | |||
| 1122 | Ga0207687_10064945 | |||
| 1123 | Ga0207687_10134678 | |||
| 1124 | Ga0207687_10814233 | |||
| 1125 | Ga0207687_11198572 | |||
| 1126 | Ga0207700_10011606 | |||
| 1127 | Ga0207700_10024926 | |||
| 1128 | Ga0207700_10347052 | |||
| 1129 | Ga0207700_10383412 | |||
| 1130 | Ga0207700_10582116 | |||
| 1131 | Ga0207664_10026573 | |||
| 1132 | Ga0207664_10115734 | |||
| 1133 | Ga0207664_10336576 | |||
| 1134 | Ga0207664_10760635 | |||
| 1135 | Ga0207664_10954417 | |||
| 1136 | Ga0207664_10980150 | |||
| 1137 | Ga0207644_10018557 | |||
| 1138 | Ga0207644_10538074 | |||
| 1139 | Ga0207690_10181029 | |||
| 1140 | Ga0207706_10110483 | |||
| 1141 | Ga0207706_10405783 | |||
| 1142 | Ga0207706_10742462 | |||
| 1143 | Ga0207686_10081501 | |||
| 1144 | Ga0207686_10231331 | |||
| 1145 | Ga0207686_10896486 | |||
| 1146 | Ga0207704_10342338 | |||
| 1147 | Ga0207665_10000159 | |||
| 1148 | Ga0207665_10009234 | |||
| 1149 | Ga0207665_10098008 | |||
| 1150 | Ga0207665_10535998 | |||
| 1151 | Ga0207665_10613496 | |||
| 1152 | Ga0207665_10650797 | |||
| 1153 | Ga0207711_10194036 | |||
| 1154 | Ga0207689_10006096 | |||
| 1155 | Ga0207689_10219074 | |||
| 1156 | Ga0207661_10067257 | |||
| 1157 | Ga0207661_10112429 | |||
| 1158 | Ga0207661_10530297 | |||
| 1159 | Ga0207661_11614003 | |||
| 1160 | Ga0207679_10235040 | |||
| 1161 | Ga0207679_10904777 | |||
| 1162 | Ga0207667_10037948 | |||
| 1163 | Ga0207667_10042066 | |||
| 1164 | Ga0207667_10055870 | |||
| 1165 | Ga0207667_10082964 | |||
| 1166 | Ga0207667_10123500 | |||
| 1167 | Ga0207667_10382831 | |||
| 1168 | Ga0207667_10576864 | |||
| 1169 | Ga0207651_10095848 | |||
| 1170 | Ga0207651_10158755 | |||
| 1171 | Ga0207640_10542465 | |||
| 1172 | Ga0207658_10358953 | |||
| 1173 | Ga0207658_10653195 | |||
| 1174 | Ga0207703_10003336 | |||
| 1175 | Ga0207703_11533610 | |||
| 1176 | Ga0207639_10002681 | |||
| 1177 | Ga0207639_10350741 | |||
| 1178 | Ga0207678_10736556 | |||
| 1179 | Ga0207708_10844199 | |||
| 1180 | Ga0207702_10009022 | |||
| 1181 | Ga0207702_10009187 | |||
| 1182 | Ga0207702_10026780 | |||
| 1183 | Ga0207702_10027019 | |||
| 1184 | Ga0207702_10099802 | |||
| 1185 | Ga0207702_10241398 | |||
| 1186 | Ga0207702_10252836 | |||
| 1187 | Ga0207702_10489388 | |||
| 1188 | Ga0207702_10613831 | |||
| 1189 | Ga0207702_11159349 | |||
| 1190 | Ga0207702_11285737 | |||
| 1191 | Ga0207641_10019852 | |||
| 1192 | Ga0207641_10052010 | |||
| 1193 | Ga0207641_10073999 | |||
| 1194 | Ga0207641_10740832 | |||
| 1195 | Ga0207641_11861907 | |||
| 1196 | Ga0207648_10029434 | |||
| 1197 | Ga0207676_10682691 | |||
| 1198 | Ga0207674_10040534 | |||
| 1199 | Ga0207674_10121765 | |||
| 1200 | Ga0207674_11478378 | |||
| 1201 | Ga0207675_100525564 | |||
| 1202 | Ga0207683_10202869 | |||
| 1203 | Ga0207698_10015132 | |||
| 1204 | Ga0207698_11204633 | |||
| 1205 | Ga0209588_1163109 | |||
| 1206 | Ga0268266_10704974 | |||
| 1207 | Ga0268265_10156189 | |||
| 1208 | Ga0268265_11494814 | |||
| 1209 | Ga0268264_10219737 | |||
| 1210 | Ga0268264_11050938 | |||
| 1211 | Ga0265338_10013026 | |||
| 1212 | Ga0265338_10046375 | |||
| 1213 | Ga0265338_10149743 | |||
| 1214 | Ga0265338_10206419 | |||
| 1215 | Ga0265338_10418893 | |||
| 1216 | Ga0265760_10000376 | |||
| 1217 | Ga0265760_10140829 | |||
| 1218 | Ga0265328_10099235 | |||
| 1219 | Ga0265325_10029009 | |||
| 1220 | Ga0265325_10030361 | |||
| 1221 | Ga0265325_10034826 | |||
| 1222 | Ga0265340_10038584 | |||
| 1223 | Ga0265339_10026135 | |||
| 1224 | Ga0265316_10016104 | |||
| 1225 | Ga0265316_10027667 | |||
| 1226 | Ga0265314_10085635 | |||
| 1227 | Ga0373926_0003562 | |||
| 1228 | Ga0373926_0167301 | |||
| 1229 | Ga0373926_0352454 | |||
| 1230 | Ga0373944_0013200 | |||
| 1231 | Ga0373923_0220046 | |||
| 1232 | Ga0373932_0187929 | |||
| 1233 | Ga0373936_0004608 | |||
| 1234 | Ga0373945_0008890 | |||
| 1235 | Ga0373945_0177312 | |||
| 1236 | Ga0373954_0013107 | |||
| 1237 | Ga0373956_0051164 | |||
| 1238 | Ga0373957_0005203 | |||
| 1239 | Ga0373960_0080939 | |||
| 1240 | Ga0373946_0066226 | |||
| 1241 | Ga0373924_0000304 | |||
| 1242 | Ga0373924_0055830 | |||
| 1243 | Ga0373931_0256028 | |||
| 1244 | Ga0373931_0676172 | |||
| 1245 | Ga0373935_0265383 | |||
| 1246 | Ga0373935_0551877 | |||
| 1247 | Ga0373927_0002071 | |||
| 1248 | Ga0373927_0059797 | |||
| 1249 | Ga0373927_0118480 | |||
| 1250 | Ga0373927_0320959 | |||
| 1251 | Ga0373933_0066516 | |||
| 1252 | Ga0373933_0236296 | |||
| 1253 | Ga0373933_0345210 | |||
| 1254 | Ga0373947_0016110 | |||
| 1255 | Ga0373947_0381214 | |||
| 1256 | Ga0373937_0001266 | |||
| 1257 | Ga0373937_0010333 | |||
| 1258 | Ga0373937_0022576 | |||
| 1259 | Ga0373937_0072292 | |||
| 1260 | Ga0373937_0084818 | |||
| 1261 | Ga0373937_0247640 | |||
| 1262 | Ga0373937_0557946 | |||
| 1263 | Ga0373937_0913373 | |||
| 1264 | Ga0373925_0026022 | |||
| 1265 | Ga0373925_0156706 | |||
| 1266 | Ga0373925_0179380 | |||
| 1267 | Ga0373925_0514156 | |||
| 1268 | Ga0373925_0754936 | |||
| 1269 | Ga0395899_0145885 | |||
| 1270 | Ga0395900_0060163 | |||
| 1271 | Ga0395900_0245511 | |||
| 1272 | Ga0395900_0909235 | |||
| 1273 | Ga0395900_1076118 | |||
| 1274 | Ga0395898_0986350 | |||
| 1275 | Ga0436364_0414552 | |||
| 1276 | Ga0436364_0476732 | |||
| 1277 | Ga0436364_0694061 | |||
| 1278 | Ga0436364_0992254 | |||
| 1279 | Ga0436364_1098164 | |||
| 1280 | Ga0436364_1241905 | |||
| 1281 | Ga0436364_1432658 | |||
| 1282 | Ga0436364_1565351 | |||
| 1283 | Ga0436365_0258655 | |||
| 1284 | Ga0436365_0314914 | |||
| 1285 | Ga0436365_0547771 | |||
| 1286 | Ga0436365_0688717 | |||
| 1287 | Ga0436365_0779833 | |||
| 1288 | Ga0436365_1189479 | |||
| 1289 | Ga0436360_0569503 | |||
| 1290 | Ga0436360_0860172 | |||
| 1291 | Ga0436360_1310473 | |||
| 1292 | Ga0436361_0182389 | |||
| 1293 | Ga0436361_0676841 | |||
| 1294 | Ga0436363_0078300 | |||
| 1295 | Ga0436363_0498641 | |||
| 1296 | Ga0436363_1159801 | |||
| 1297 | Ga0436363_1593994 | |||
| 1298 | Ga0436362_0400574 | |||
| 1299 | Ga0436362_1183358 | |||
| 1300 | Ga0436362_1241382 | |||
| 1301 | Ga0451791_1527395 | |||
| 1302 | Ga0439432_140573 | |||
| 1303 | Ga0451577_0001621 | |||
| 1304 | Ga0451577_0138779 | |||
| 1305 | Ga0451577_0630977 | |||
| 1306 | Ga0453683_0017145 | |||
| 1307 | Ga0466966_0046294 | |||
| 1308 | Ga0466963_0044119 | |||
| 1309 | Ga0466963_0568033 | |||
| 1310 | Ga0466964_0059756 | |||
| 1311 | Ga0453684_0002322 | |||
| 1312 | Ga0453684_0489457 | |||
| 1313 | Ga0453684_2284106 | |||
| 1314 | Ga0466970_0392036 | |||
| 1315 | Ga0466957_1005211 | |||
| 1316 | Ga0466959_0092905 | |||
| 1317 | Ga0466959_0173041 | |||
| 1318 | Ga0451576_0097795 | |||
| 1319 | Ga0451576_0625590 | |||
| 1320 | Ga0451576_2083273 | |||
| 1321 | Ga0466958_0285918 | |||
| 1322 | Ga0466958_0472972 | |||
| 1323 | Ga0466958_0496561 | |||
| 1324 | Ga0466967_0000985 | |||
| 1325 | Ga0466967_0206955 | |||
| 1326 | Ga0466967_0227830 | |||
| 1327 | Ga0466967_0405573 | |||
| 1328 | Ga0495603_0616127 | |||
| 1329 | Ga0495651_0093780 | |||
| 1330 | Ga0495580_0000809 | |||
| 1331 | Ga0495580_0000971 | |||
| 1332 | Ga0495580_0007053 | |||
| 1333 | Ga0495580_0067207 | |||
| 1334 | Ga0495580_0089427 | |||
| 1335 | Ga0495580_0093616 | |||
| 1336 | Ga0495580_0161357 | |||
| 1337 | Ga0495580_0169979 | |||
| 1338 | Ga0495580_0260252 | |||
| 1339 | Ga0495580_0415786 | |||
| 1340 | Ga0495580_0438830 | |||
| 1341 | Ga0495582_0028864 | |||
| 1342 | Ga0495582_0112596 | |||
| 1343 | Ga0495639_0062543 | |||
| 1344 | Ga0495639_0398748 | |||
| 1345 | Ga0495594_0551132 | |||
| 1346 | Ga0495608_0328362 | |||
| 1347 | Ga0495628_0206801 | |||
| 1348 | Ga0495642_0108296 | |||
| 1349 | Ga0495665_0128548 | |||
| 1350 | Ga0495640_0304867 | |||
| 1351 | Ga0495645_0317815 | |||
| 1352 | Ga0495667_0090864 | |||
| 1353 | Ga0495635_0291322 | |||
| 1354 | Ga0495658_0208699 | |||
| 1355 | Ga0495669_0023499 | |||
| 1356 | Ga0495669_0356525 | |||
| 1357 | Ga0495581_0090263 | |||
| 1358 | Ga0495604_0549859 | |||
| 1359 | Ga0495684_0528795 | |||
| 1360 | Ga0495593_0105299 | |||
| 1361 | Ga0496101_0325220 | |||
| 1362 | Ga0496101_0343367 | |||
| 1363 | Ga0496102_0256642 | |||
| 1364 | Ga0496102_0270576 | |||
| 1365 | Ga0496102_0865800 | |||
| 1366 | Ga0496104_0239132 | |||
| 1367 | Ga0496104_0246311 | |||
| 1368 | Ga0496104_0266023 | |||
| 1369 | Ga0496104_0271636 | |||
| 1370 | Ga0496104_0577318 | |||
| 1371 | Ga0496105_0010424 | |||
| 1372 | Ga0496105_0134187 | |||
| 1373 | Ga0496108_0388919 | |||
| 1374 | Ga0496108_1010401 | |||
| 1375 | Ga0496109_0110633 | |||
| 1376 | Ga0496110_0352402 | |||
| 1377 | Ga0496112_0003730 | |||
| 1378 | Ga0496112_0019164 | |||
| 1379 | Ga0496112_0069108 | |||
| 1380 | Ga0496112_0074390 | |||
| 1381 | Ga0496112_0080454 | |||
| 1382 | Ga0496112_0096215 | |||
| 1383 | Ga0496113_0002032 | |||
| 1384 | Ga0496113_0015986 | |||
| 1385 | Ga0496113_0457201 | |||
| 1386 | Ga0496113_0836775 | |||
| 1387 | Ga0496115_0002633 | |||
| 1388 | Ga0496115_0588264 | |||
| 1389 | Ga0501299_171243 | |||
| 1390 | Ga0501032_0437928 | |||
| 1391 | Ga0501033_0037457 | |||
| 1392 | Ga0501034_0035583 | |||
| 1393 | Ga0501034_0515080 | |||
| 1394 | Ga0501043_0231180 | |||
| 1395 | Ga0501046_0503070 | |||
| 1396 | Ga0501047_0059129 | |||
| 1397 | Ga0501047_0074038 | |||
| 1398 | Ga0501047_0113836 | |||
| 1399 | Ga0501047_0129917 | |||
| 1400 | Ga0501070_0002154 | |||
| 1401 | Ga0501070_0046568 | |||
| 1402 | Ga0501073_0678375 | |||
| 1403 | Ga0501035_0056347 | |||
| 1404 | Ga0501035_0122236 | |||
| 1405 | Ga0501044_0032698 | |||
| 1406 | Ga0501044_0034174 | |||
| 1407 | Ga0501044_0076871 | |||
| 1408 | Ga0501044_0196315 | |||
| 1409 | nmdc:mga05p37_204513_c1 | |||
| 1410 | nmdc:mga06r32_281638_c1 | |||
| 1411 | nmdc:mga0n895_1010221_c1 | |||
| 1412 | nmdc:mga0n895_110542_c1 | |||
| 1413 | nmdc:mga0rr50_92634_c1 | |||
| 1414 | nmdc:mga08x19_352317_c1 | |||
| 1415 | nmdc:mga08x19_521447_c1 | |||
| 1416 | nmdc:mga0a205_897476_c1 | |||
| 1417 | Ga0495601_0234299 | |||
| 1418 | Ga0495601_0394924 | |||
| 1419 | Ga0495619_0129853 | |||
| 1420 | Ga0587093_033276 | |||
| 1421 | Ga0587073_0230891 | |||
| 1422 | Ga0587085_040741 | |||
| 1423 | Ga0587075_075114 | |||
| 1424 | Ga0501082_1468976 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.9274 | 1 | 163 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.9166 | 1 | 163 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8448 | 5 | 163 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8265 | 5 | 163 |
| 2n2u-assembly1.cif.gz_A | solution nmr structure of de novo designed ferredoxin fold protein sfr3, northeast structural genomics consortium (nesg) target or358 | 0.6891 | 104 | 161 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1in0B01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.987 | 102 | 163 | 3.30.70.860 |
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9489 | 11 | 96 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9326 | 11 | 101 | 3.30.70.990 |
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.928 | 11 | 96 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9229 | 11 | 101 | 3.30.70.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XNU2-F1-model_v4 | DUF520 family protein | 0.9946 | 102 | 163 |
GO:0000166
GO:0005829 |
| AF-A0A520IEZ1-F1-model_v4 | DUF520 family protein | 0.9927 | 102 | 163 |
GO:0000166
GO:0005829 |
| AF-A0A1V6BKQ7-F1-model_v4 | Putative nucleotide-binding protein | 0.9895 | 100 | 163 |
GO:0000166
GO:0005829 |
| AF-A0A2V9P8Z4-F1-model_v4 | UPF0234 protein DMG95_08200 | 0.9894 | 1 | 165 |
GO:0000166
GO:0005829 |
| AF-A0A1Z8TXT2-F1-model_v4 | Uncharacterized protein | 0.9865 | 100 | 163 |
GO:0000166
GO:0005829 |