F476760

General Info

Members Datasets Scaffolds Average Seq Length
711 308 1422 106

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100394999|Ga0070693_1003949992
Length 115
Sequence MPKPRNGDAMKDLMKMMKQAQEIQGRMQQLQDDLASLEVEGQSGAGLVKVKLNGKGDARSIKIDQSLVKPEETEILEDLIVAALQDAKGKVEAAVQAKMAEITGGLALPPGLKLF

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
116 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
197 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
198 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
206 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
214 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
215 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
276 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
277 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
304 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
308 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.06
Nodule 0
Rhizoplane 7.74
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 0.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100394999 3300005547 Unclassified 957
2 JGI24747J21853_1026366 3300001978 Bacteria 651
3 JGI24739J22299_10070761 3300001989 Bacteria 1086
4 JGI24737J22298_10039564 3300001990 Bacteria 1449
5 JGI24750J21931_1079018 3300002070 Bacteria 545
6 JGI24738J21930_10020523 3300002075 Bacteria 1373
7 JGI24751J29686_10024660 3300002459 Bacteria 1248
8 JGI24751J29686_10044330 3300002459 Bacteria 919
9 JGI25404J52841_10120565 3300003659 Bacteria 553
10 JGI25405J52794_10085216 3300003911 Bacteria 697
11 Ga0065712_10280623 3300005290 Bacteria 896
12 Ga0070676_10000301 3300005328 Bacteria 22137
13 Ga0070690_100010536 3300005330 Bacteria 5384
14 Ga0070690_100511319 3300005330 Bacteria 900
15 Ga0070677_10410097 3300005333 Bacteria 716
16 Ga0068869_100056221 3300005334 Bacteria 2869
17 Ga0070680_100041764 3300005336 Bacteria 3719
18 Ga0070680_100118491 3300005336 Bacteria 2208
19 Ga0070680_100218930 3300005336 Bacteria 1607
20 Ga0070680_100359855 3300005336 Bacteria 1238
21 Ga0070682_100001766 3300005337 Bacteria 12040
22 Ga0068868_100243238 3300005338 Bacteria 1512
23 Ga0070660_100413264 3300005339 Bacteria 1116
24 Ga0070689_100044910 3300005340 Bacteria 3400
25 Ga0070689_100072974 3300005340 Bacteria 2683
26 Ga0070691_10000239 3300005341 Bacteria 18784
27 Ga0070691_10123999 3300005341 Bacteria 1303
28 Ga0070687_100292927 3300005343 Bacteria 1029
29 Ga0070661_100001859 3300005344 Bacteria 14612
30 Ga0070692_10037784 3300005345 Bacteria 2457
31 Ga0070668_100064746 3300005347 Bacteria 2834
32 Ga0070668_100152825 3300005347 Bacteria 1868
33 Ga0070668_100255021 3300005347 Bacteria 1457
34 Ga0070669_100000391 3300005353 Bacteria 33788
35 Ga0070675_100007068 3300005354 Bacteria 8634
36 Ga0070671_100006526 3300005355 Bacteria 9326
37 Ga0070671_100515759 3300005355 Bacteria 1029
38 Ga0070674_100000499 3300005356 Bacteria 19672
39 Ga0070674_101125299 3300005356 Bacteria 694
40 Ga0070674_101828016 3300005356 Bacteria 551
41 Ga0070673_100001824 3300005364 Bacteria 12720
42 Ga0070673_100095233 3300005364 Bacteria 2442
43 Ga0070688_100000242 3300005365 Bacteria 28832
44 Ga0070688_100130435 3300005365 Bacteria 1695
45 Ga0070688_100924522 3300005365 Bacteria 689
46 Ga0070659_100156679 3300005366 Bacteria 1860
47 Ga0070659_100333544 3300005366 Bacteria 1270
48 Ga0070659_100349872 3300005366 Bacteria 1239
49 Ga0070659_100736896 3300005366 Bacteria 854
50 Ga0070667_100000918 3300005367 Bacteria 27217
51 Ga0070667_101146874 3300005367 Bacteria 727
52 Ga0070667_102196459 3300005367 Bacteria 520
53 Ga0070709_10005755 3300005434 Bacteria 6723
54 Ga0070714_100013579 3300005435 Bacteria 6528
55 Ga0070710_10044068 3300005437 Bacteria 2474
56 Ga0070701_10015251 3300005438 Bacteria 3543
57 Ga0070701_10291576 3300005438 Bacteria 1000
58 Ga0070701_10515490 3300005438 Bacteria 779
59 Ga0070711_100000881 3300005439 Bacteria 15809
60 Ga0070711_101160854 3300005439 Bacteria 667
61 Ga0070705_100002231 3300005440 Bacteria 9832
62 Ga0070705_100178072 3300005440 Bacteria 1438
63 Ga0070700_100113515 3300005441 Bacteria 1805
64 Ga0070700_100436574 3300005441 Bacteria 993
65 Ga0070700_100461418 3300005441 Bacteria 969
66 Ga0070700_100480589 3300005441 Bacteria 951
67 Ga0070694_100027289 3300005444 Bacteria 3707
68 Ga0070694_100029406 3300005444 Bacteria 3585
69 Ga0070694_100464853 3300005444 Bacteria 1001
70 Ga0070708_101041711 3300005445 Bacteria 767
71 Ga0070708_101450957 3300005445 Bacteria 640
72 Ga0070663_100097735 3300005455 Bacteria 2186
73 Ga0070663_100316296 3300005455 Bacteria 1254
74 Ga0070663_100902742 3300005455 Bacteria 763
75 Ga0070678_100057207 3300005456 Bacteria 2856
76 Ga0070662_100012179 3300005457 Bacteria 5696
77 Ga0070662_101135665 3300005457 Bacteria 671
78 Ga0070662_101138660 3300005457 Bacteria 670
79 Ga0070681_10035471 3300005458 Bacteria 5010
80 Ga0068867_100055195 3300005459 Bacteria 2937
81 Ga0068867_100333428 3300005459 Bacteria 1261
82 Ga0070685_10009257 3300005466 Bacteria 5084
83 Ga0070685_10134357 3300005466 Bacteria 1550
84 Ga0070685_10522587 3300005466 Bacteria 843
85 Ga0070707_100711768 3300005468 Bacteria 967
86 Ga0070699_100065684 3300005518 Bacteria 3149
87 Ga0070679_100508708 3300005530 Bacteria 1148
88 Ga0070684_100006303 3300005535 Bacteria 9168
89 Ga0070697_100001481 3300005536 Bacteria 17848
90 Ga0068853_102191666 3300005539 Bacteria 536
91 Ga0068853_102389208 3300005539 Bacteria 512
92 Ga0070672_100008024 3300005543 Bacteria 7211
93 Ga0070686_100000939 3300005544 Bacteria 16781
94 Ga0070695_100017664 3300005545 Bacteria 4328
95 Ga0070695_100274511 3300005545 Bacteria 1236
96 Ga0070695_100344078 3300005545 Bacteria 1115
97 Ga0070696_100002535 3300005546 Bacteria 12105
98 Ga0070696_100031476 3300005546 Bacteria 3636
99 Ga0070696_101387045 3300005546 Bacteria 599
100 Ga0070696_102025526 3300005546 Bacteria 500
101 Ga0070693_100000603 3300005547 Bacteria 15927
102 Ga0070693_101456335 3300005547 Bacteria 534
103 Ga0070665_100003793 3300005548 Bacteria 16000
104 Ga0070665_100187743 3300005548 Bacteria 2068
105 Ga0070665_100656403 3300005548 Bacteria 1062
106 Ga0070704_100001715 3300005549 Bacteria 11955
107 Ga0070704_100233547 3300005549 Bacteria 1502
108 Ga0070704_100302493 3300005549 Bacteria 1333
109 Ga0070704_100318248 3300005549 Bacteria 1303
110 Ga0068855_100004383 3300005563 Bacteria 17247
111 Ga0068855_101811150 3300005563 Bacteria 620
112 Ga0070664_100048569 3300005564 Bacteria 3586
113 Ga0068857_100128850 3300005577 Bacteria 2281
114 Ga0068854_100010513 3300005578 Bacteria 6005
115 Ga0068856_100019676 3300005614 Bacteria 6552
116 Ga0068856_100210249 3300005614 Bacteria 1961
117 Ga0070702_100007898 3300005615 Bacteria 5120
118 Ga0070702_100508830 3300005615 Bacteria 886
119 Ga0070702_101111590 3300005615 Bacteria 632
120 Ga0068852_100604565 3300005616 Bacteria 1101
121 Ga0068859_100003356 3300005617 Bacteria 16289
122 Ga0068859_100056767 3300005617 Bacteria 3942
123 Ga0068859_101286056 3300005617 Bacteria 806
124 Ga0068864_100623742 3300005618 Bacteria 1048
125 Ga0068861_100004366 3300005719 Bacteria 9483
126 Ga0068861_100363737 3300005719 Bacteria 1273
127 Ga0068861_100619156 3300005719 Bacteria 996
128 Ga0068861_101469973 3300005719 Bacteria 668
129 Ga0068870_10174869 3300005840 Bacteria 1284
130 Ga0068863_100053816 3300005841 Bacteria 3815
131 Ga0068863_100431512 3300005841 Bacteria 1292
132 Ga0068863_102604151 3300005841 Bacteria 515
133 Ga0068858_100014191 3300005842 Bacteria 7513
134 Ga0068858_100347313 3300005842 Bacteria 1421
135 Ga0068858_101288519 3300005842 Bacteria 719
136 Ga0068860_100002798 3300005843 Bacteria 18148
137 Ga0068860_100536566 3300005843 Bacteria 1171
138 Ga0068860_101437930 3300005843 Bacteria 711
139 Ga0068862_100004242 3300005844 Bacteria 12145
140 Ga0068862_101098190 3300005844 Bacteria 790
141 Ga0068862_101320979 3300005844 Bacteria 723
142 Ga0081455_10000170 3300005937 Bacteria 80847
143 Ga0081455_10039515 3300005937 Bacteria 4169
144 Ga0081540_1000165 3300005983 Bacteria 68435
145 Ga0081540_1033393 3300005983 Bacteria 2795
146 Ga0081540_1050453 3300005983 Bacteria 2066
147 Ga0081539_10070068 3300005985 Bacteria 1884
148 Ga0075365_10006755 3300006038 Bacteria 6348
149 Ga0075365_10450204 3300006038 Bacteria 909
150 Ga0075368_10001299 3300006042 Bacteria 7919
151 Ga0075368_10005248 3300006042 Bacteria 4449
152 Ga0075368_10128874 3300006042 Bacteria 1051
153 Ga0075363_100021865 3300006048 Bacteria 3228
154 Ga0075363_100024186 3300006048 Bacteria 3085
155 Ga0075364_10003077 3300006051 Bacteria 9425
156 Ga0075364_10672103 3300006051 Bacteria 707
157 Ga0075364_10907065 3300006051 Bacteria 600
158 Ga0075432_10044185 3300006058 Bacteria 1562
159 Ga0070715_10000180 3300006163 Bacteria 14743
160 Ga0070712_100025172 3300006175 Bacteria 3953
161 Ga0070712_100093091 3300006175 Bacteria 2212
162 Ga0075367_10004018 3300006178 Bacteria 7113
163 Ga0075367_10007480 3300006178 Bacteria 5595
164 Ga0075367_10020318 3300006178 Bacteria 3696
165 Ga0075367_10297433 3300006178 Bacteria 1016
166 Ga0075366_10002421 3300006195 Bacteria 9575
167 Ga0075366_10019541 3300006195 Bacteria 3922
168 Ga0097621_100010829 3300006237 Bacteria 6691
169 Ga0097621_100998324 3300006237 Bacteria 783
170 Ga0097621_102066725 3300006237 Unclassified 544
171 Ga0075370_10315359 3300006353 Bacteria 931
172 Ga0068871_100156845 3300006358 Bacteria 1944
173 Ga0075428_100082477 3300006844 Bacteria 3508
174 Ga0075428_100144091 3300006844 Bacteria 2590
175 Ga0075428_100372744 3300006844 Bacteria 1531
176 Ga0075428_100610739 3300006844 Bacteria 1164
177 Ga0075428_100762305 3300006844 Bacteria 1029
178 Ga0075430_100045125 3300006846 Bacteria 3724
179 Ga0075430_100078448 3300006846 Bacteria 2768
180 Ga0075430_100085560 3300006846 Bacteria 2640
181 Ga0075430_100323289 3300006846 Bacteria 1275
182 Ga0075430_100517586 3300006846 Bacteria 984
183 Ga0075430_100637038 3300006846 Bacteria 879
184 Ga0075430_100642824 3300006846 Bacteria 875
185 Ga0075431_100042858 3300006847 Bacteria 4668
186 Ga0075431_100049916 3300006847 Bacteria 4314
187 Ga0075431_100288117 3300006847 Bacteria 1662
188 Ga0075431_100624827 3300006847 Bacteria 1059
189 Ga0075431_100900293 3300006847 Bacteria 854
190 Ga0075431_100966677 3300006847 Bacteria 819
191 Ga0075433_10006505 3300006852 Bacteria 9240
192 Ga0075433_10026034 3300006852 Bacteria 4948
193 Ga0075433_10036544 3300006852 Bacteria 4232
194 Ga0075433_10293846 3300006852 Bacteria 1439
195 Ga0075434_100000653 3300006871 Bacteria 26879
196 Ga0075434_100194746 3300006871 Bacteria 2047
197 Ga0075434_100526469 3300006871 Bacteria 1202
198 Ga0075434_100568268 3300006871 Bacteria 1153
199 Ga0075429_100291325 3300006880 Bacteria 1429
200 Ga0075429_100345161 3300006880 Bacteria 1303
201 Ga0075429_100359151 3300006880 Bacteria 1276
202 Ga0075429_100574937 3300006880 Bacteria 987
203 Ga0068865_100015213 3300006881 Bacteria 4903
204 Ga0068865_100244613 3300006881 Bacteria 1413
205 Ga0068865_100712310 3300006881 Bacteria 859
206 Ga0068865_100824367 3300006881 Bacteria 802
207 Ga0075436_100002459 3300006914 Bacteria 12742
208 Ga0075436_101060863 3300006914 Bacteria 609
209 Ga0097620_100003356 3300006931 Bacteria 16289
210 Ga0097620_100056765 3300006931 Bacteria 3942
211 Ga0097620_101285862 3300006931 Bacteria 806
212 Ga0097620_102954632 3300006931 Bacteria 520
213 Ga0075435_100015403 3300007076 Bacteria 5747
214 Ga0075435_100679934 3300007076 Bacteria 894
215 Ga0105240_10051975 3300009093 Bacteria 5153
216 Ga0105240_10597240 3300009093 Bacteria 1216
217 Ga0111539_10024090 3300009094 Bacteria 7475
218 Ga0111539_10031382 3300009094 Bacteria 6454
219 Ga0111539_10076404 3300009094 Bacteria 3944
220 Ga0111539_10124508 3300009094 Bacteria 3021
221 Ga0111539_10454450 3300009094 Bacteria 1492
222 Ga0111539_11716424 3300009094 Bacteria 728
223 Ga0111539_12482804 3300009094 Bacteria 601
224 Ga0105245_10355803 3300009098 Bacteria 1452
225 Ga0105245_10459318 3300009098 Bacteria 1283
226 Ga0105245_10527501 3300009098 Bacteria 1200
227 Ga0105245_10604072 3300009098 Bacteria 1124
228 Ga0105245_11719135 3300009098 Bacteria 680
229 Ga0105247_10006124 3300009101 Bacteria 7471
230 Ga0105247_10065353 3300009101 Bacteria 2262
231 Ga0105247_10241073 3300009101 Bacteria 1232
232 Ga0105247_10299509 3300009101 Bacteria 1115
233 Ga0105247_10533645 3300009101 Bacteria 860
234 Ga0114129_10053132 3300009147 Bacteria 5682
235 Ga0114129_10085456 3300009147 Bacteria 4377
236 Ga0114129_10233827 3300009147 Bacteria 2474
237 Ga0114129_10268522 3300009147 Bacteria 2283
238 Ga0114129_10341577 3300009147 Bacteria 1986
239 Ga0105243_10001295 3300009148 Bacteria 22421
240 Ga0105243_10493478 3300009148 Bacteria 1159
241 Ga0105243_10699134 3300009148 Bacteria 988
242 Ga0105243_11948424 3300009148 Bacteria 621
243 Ga0105243_12547174 3300009148 Bacteria 551
244 Ga0105243_12703057 3300009148 Bacteria 537
245 Ga0105241_10000469 3300009174 Bacteria 30491
246 Ga0105242_10001374 3300009176 Bacteria 19175
247 Ga0105242_11873242 3300009176 Bacteria 640
248 Ga0105242_13073054 3300009176 Bacteria 517
249 Ga0105248_10013243 3300009177 Bacteria 9080
250 Ga0105248_10363545 3300009177 Bacteria 1629
251 Ga0105248_11327642 3300009177 Bacteria 814
252 Ga0105237_10006470 3300009545 Bacteria 12987
253 Ga0105238_10037236 3300009551 Bacteria 4946
254 Ga0105249_10825344 3300009553 Bacteria 992
255 Ga0105249_10976740 3300009553 Bacteria 915
256 Ga0105249_11097169 3300009553 Bacteria 866
257 Ga0105249_11460134 3300009553 Bacteria 756
258 Ga0105249_12729564 3300009553 Bacteria 566
259 Ga0099796_10218108 3300010159 Bacteria 781
260 Ga0105239_10129421 3300010375 Bacteria 2807
261 Ga0105239_11033287 3300010375 Bacteria 945
262 Ga0105239_11250320 3300010375 Bacteria 856
263 Ga0105246_10003512 3300011119 Bacteria 9492
264 Ga0105246_10116454 3300011119 Bacteria 1973
265 Ga0105246_10321580 3300011119 Bacteria 1257
266 Ga0105246_10844140 3300011119 Bacteria 816
267 Ga0105246_12315279 3300011119 Bacteria 525
268 Ga0105246_12388579 3300011119 Bacteria 518
269 Ga0157314_1019300 3300012500 Bacteria 681
270 Ga0157342_1077121 3300012507 Bacteria 517
271 Ga0157373_10128604 3300013100 Bacteria 1781
272 Ga0157371_10009461 3300013102 Bacteria 7666
273 Ga0157369_10000947 3300013105 Bacteria 36855
274 Ga0157374_10098149 3300013296 Bacteria 2804
275 Ga0157378_10001777 3300013297 Bacteria 19356
276 Ga0157378_10070443 3300013297 Bacteria 3140
277 Ga0157378_10428673 3300013297 Bacteria 1308
278 Ga0157378_12884960 3300013297 Bacteria 533
279 Ga0163162_10013704 3300013306 Bacteria 7919
280 Ga0163162_10205094 3300013306 Bacteria 2101
281 Ga0163162_10832701 3300013306 Bacteria 1039
282 Ga0163162_11584005 3300013306 Bacteria 747
283 Ga0157372_10000133 3300013307 Bacteria 81875
284 Ga0157372_10816972 3300013307 Bacteria 1083
285 Ga0157372_13109929 3300013307 Bacteria 530
286 Ga0157375_10000531 3300013308 Bacteria 34206
287 Ga0157375_10003004 3300013308 Bacteria 14648
288 Ga0163163_10048586 3300014325 Bacteria 4173
289 Ga0163163_10163851 3300014325 Bacteria 2269
290 Ga0163163_11058904 3300014325 Bacteria 874
291 Ga0157380_10001038 3300014326 Bacteria 17730
292 Ga0157380_10104329 3300014326 Bacteria 2367
293 Ga0157380_10196428 3300014326 Bacteria 1786
294 Ga0157380_10254682 3300014326 Bacteria 1591
295 Ga0157380_10443843 3300014326 Bacteria 1244
296 Ga0157380_10973111 3300014326 Bacteria 880
297 Ga0157380_11263780 3300014326 Bacteria 784
298 Ga0157380_11426226 3300014326 Bacteria 744
299 Ga0157380_12198440 3300014326 Unclassified 615
300 Ga0182008_10096205 3300014497 Bacteria 1461
301 Ga0182008_10543624 3300014497 Bacteria 644
302 Ga0157377_10000610 3300014745 Bacteria 14809
303 Ga0157379_10000847 3300014968 Bacteria 24772
304 Ga0157379_10030380 3300014968 Bacteria 4809
305 Ga0157379_10066960 3300014968 Bacteria 3211
306 Ga0157379_10285667 3300014968 Bacteria 1502
307 Ga0157379_10439234 3300014968 Bacteria 1203
308 Ga0157379_10745490 3300014968 Bacteria 922
309 Ga0157379_12243878 3300014968 Bacteria 543
310 Ga0157376_10000565 3300014969 Bacteria 23889
311 Ga0157376_10336940 3300014969 Bacteria 1439
312 Ga0163161_10002364 3300017792 Bacteria 13527
313 Ga0163161_10207301 3300017792 Bacteria 1513
314 Ga0163161_10975830 3300017792 Bacteria 722
315 Ga0207692_10013938 3300025898 Bacteria 3500
316 Ga0207642_11080872 3300025899 Bacteria 518
317 Ga0207710_10291321 3300025900 Bacteria 823
318 Ga0207710_10465970 3300025900 Bacteria 653
319 Ga0207688_10052665 3300025901 Bacteria 2281
320 Ga0207680_10291846 3300025903 Bacteria 1135
321 Ga0207680_10529147 3300025903 Bacteria 841
322 Ga0207647_10000886 3300025904 Bacteria 23217
323 Ga0207685_10063207 3300025905 Bacteria 1474
324 Ga0207699_10095303 3300025906 Bacteria 1876
325 Ga0207699_11366935 3300025906 Bacteria 524
326 Ga0207645_10000890 3300025907 Bacteria 24772
327 Ga0207643_10353682 3300025908 Bacteria 923
328 Ga0207654_10010151 3300025911 Bacteria 4791
329 Ga0207707_10048984 3300025912 Bacteria 3681
330 Ga0207695_10887561 3300025913 Bacteria 771
331 Ga0207695_11194785 3300025913 Bacteria 641
332 Ga0207671_10004966 3300025914 Bacteria 12465
333 Ga0207693_10000110 3300025915 Bacteria 74444
334 Ga0207693_10102070 3300025915 Bacteria 2249
335 Ga0207663_10018165 3300025916 Bacteria 3935
336 Ga0207663_10299381 3300025916 Bacteria 1201
337 Ga0207662_10001153 3300025918 Bacteria 12509
338 Ga0207657_10000023 3300025919 Bacteria 152701
339 Ga0207649_10002699 3300025920 Bacteria 9832
340 Ga0207652_10461103 3300025921 Bacteria 1145
341 Ga0207646_10515888 3300025922 Bacteria 1076
342 Ga0207681_10940067 3300025923 Bacteria 724
343 Ga0207694_10029078 3300025924 Bacteria 4215
344 Ga0207659_10006477 3300025926 Bacteria 7176
345 Ga0207687_10008017 3300025927 Bacteria 6913
346 Ga0207700_10005146 3300025928 Bacteria 7780
347 Ga0207700_11908819 3300025928 Bacteria 520
348 Ga0207664_10355539 3300025929 Bacteria 1297
349 Ga0207664_10407696 3300025929 Bacteria 1209
350 Ga0207664_10660607 3300025929 Bacteria 940
351 Ga0207644_10007668 3300025931 Bacteria 7039
352 Ga0207644_10780622 3300025931 Bacteria 799
353 Ga0207690_10027051 3300025932 Bacteria 3621
354 Ga0207690_10323748 3300025932 Bacteria 1212
355 Ga0207690_11019973 3300025932 Bacteria 689
356 Ga0207706_10000019 3300025933 Bacteria 167592
357 Ga0207706_10464809 3300025933 Bacteria 1094
358 Ga0207706_10895737 3300025933 Bacteria 749
359 Ga0207686_10050601 3300025934 Bacteria 2584
360 Ga0207709_10023709 3300025935 Bacteria 3495
361 Ga0207670_10006112 3300025936 Bacteria 6657
362 Ga0207670_10634426 3300025936 Bacteria 880
363 Ga0207669_10674309 3300025937 Bacteria 847
364 Ga0207669_10752588 3300025937 Bacteria 805
365 Ga0207704_10037246 3300025938 Bacteria 2809
366 Ga0207704_10284012 3300025938 Bacteria 1260
367 Ga0207704_10550687 3300025938 Bacteria 937
368 Ga0207665_10000095 3300025939 Bacteria 57181
369 Ga0207691_10000947 3300025940 Bacteria 28721
370 Ga0207711_10011651 3300025941 Bacteria 7305
371 Ga0207711_10234136 3300025941 Bacteria 1683
372 Ga0207711_10962089 3300025941 Bacteria 793
373 Ga0207689_10021208 3300025942 Bacteria 5462
374 Ga0207679_10536904 3300025945 Bacteria 1048
375 Ga0207667_10100285 3300025949 Bacteria 2987
376 Ga0207651_10002421 3300025960 Bacteria 8918
377 Ga0207651_10127282 3300025960 Bacteria 1943
378 Ga0207712_10001385 3300025961 Bacteria 16600
379 Ga0207712_10996432 3300025961 Bacteria 743
380 Ga0207712_11066709 3300025961 Bacteria 718
381 Ga0207668_10009497 3300025972 Bacteria 5835
382 Ga0207668_10112666 3300025972 Bacteria 2044
383 Ga0207668_10354878 3300025972 Bacteria 1227
384 Ga0207668_10823120 3300025972 Bacteria 823
385 Ga0207668_10971018 3300025972 Bacteria 758
386 Ga0207640_11746624 3300025981 Bacteria 562
387 Ga0207658_10034585 3300025986 Bacteria 3612
388 Ga0207658_11538456 3300025986 Bacteria 608
389 Ga0207677_10044501 3300026023 Bacteria 2958
390 Ga0207703_10019892 3300026035 Bacteria 5247
391 Ga0207703_10048370 3300026035 Bacteria 3433
392 Ga0207703_10402708 3300026035 Bacteria 1270
393 Ga0207639_10002584 3300026041 Bacteria 12151
394 Ga0207639_10321207 3300026041 Bacteria 1375
395 Ga0207678_10000017 3300026067 Bacteria 135871
396 Ga0207678_10125765 3300026067 Bacteria 2187
397 Ga0207678_10860403 3300026067 Bacteria 801
398 Ga0207708_10001479 3300026075 Bacteria 17559
399 Ga0207708_10008312 3300026075 Bacteria 7685
400 Ga0207708_10150358 3300026075 Bacteria 1832
401 Ga0207708_10205059 3300026075 Bacteria 1574
402 Ga0207708_10613935 3300026075 Bacteria 922
403 Ga0207708_10726005 3300026075 Bacteria 851
404 Ga0207708_11530857 3300026075 Bacteria 586
405 Ga0207702_10011527 3300026078 Bacteria 7365
406 Ga0207702_10307843 3300026078 Bacteria 1505
407 Ga0207648_10039142 3300026089 Bacteria 4169
408 Ga0207648_10468056 3300026089 Bacteria 1150
409 Ga0207676_10029374 3300026095 Bacteria 4115
410 Ga0207676_10508282 3300026095 Bacteria 1145
411 Ga0207674_10000437 3300026116 Bacteria 53986
412 Ga0207675_100001318 3300026118 Bacteria 24888
413 Ga0207675_100165949 3300026118 Bacteria 2109
414 Ga0207675_100187640 3300026118 Bacteria 1982
415 Ga0207675_100234765 3300026118 Bacteria 1770
416 Ga0207675_100489152 3300026118 Bacteria 1224
417 Ga0207675_100800790 3300026118 Bacteria 956
418 Ga0207683_10000030 3300026121 Bacteria 109087
419 Ga0207683_10084115 3300026121 Bacteria 2828
420 Ga0207683_12167542 3300026121 Bacteria 504
421 Ga0207698_10298221 3300026142 Bacteria 1499
422 Ga0207698_11638518 3300026142 Bacteria 659
423 Ga0207698_11920328 3300026142 Bacteria 607
424 Ga0209813_10000400 3300027866 Bacteria 10671
425 Ga0209813_10006650 3300027866 Bacteria 2861
426 Ga0207428_10046057 3300027907 Bacteria 3509
427 Ga0207428_10112457 3300027907 Bacteria 2094
428 Ga0207428_10178022 3300027907 Bacteria 1608
429 Ga0207428_11165333 3300027907 Bacteria 537
430 Ga0268266_10269152 3300028379 Bacteria 1581
431 Ga0268266_10750980 3300028379 Bacteria 941
432 Ga0268266_11872568 3300028379 Bacteria 574
433 Ga0268266_11921341 3300028379 Bacteria 566
434 Ga0268265_10102879 3300028380 Bacteria 2311
435 Ga0268265_11100720 3300028380 Bacteria 789
436 Ga0268264_10041649 3300028381 Bacteria 3800
437 Ga0268264_11123202 3300028381 Bacteria 795
438 Ga0268264_11149446 3300028381 Bacteria 785
439 Ga0307411_11160945 3300032005 Bacteria 699
440 Ga0373930_0199130 3300034816 Bacteria 521
441 Ga0373948_0034072 3300034817 Bacteria 1039
442 Ga0373950_0011534 3300034818 Bacteria 1445
443 Ga0373958_0028705 3300034819 Bacteria 1078
444 Ga0373959_0022350 3300034820 Bacteria 1222
445 Ga0373928_0007710 3300035084 Bacteria 2080
446 Ga0373929_0153927 3300035085 Bacteria 618
447 Ga0373929_0167106 3300035085 Bacteria 599
448 Ga0373940_0094936 3300035088 Bacteria 898
449 Ga0373940_0213633 3300035088 Unclassified 638
450 Ga0373951_0041560 3300035091 Bacteria 1110
451 Ga0373952_0006622 3300035092 Bacteria 2147
452 Ga0373952_0015166 3300035092 Bacteria 1553
453 Ga0373932_0004056 3300035112 Bacteria 3483
454 Ga0373932_0245446 3300035112 Bacteria 652
455 Ga0373939_0016694 3300035114 Bacteria 1939
456 Ga0373941_0008349 3300035115 Bacteria 2568
457 Ga0373941_0086660 3300035115 Bacteria 1067
458 Ga0373953_0554444 3300035117 Bacteria 511
459 Ga0373960_0016981 3300035121 Bacteria 1879
460 Ga0373960_0019623 3300035121 Bacteria 1778
461 Ga0373943_0599626 3300035170 Bacteria 649
462 Ga0373946_0786502 3300035171 Bacteria 501
463 Ga0373942_0057922 3300035207 Bacteria 1103
464 Ga0373961_0003490 3300035241 Bacteria 3887
465 Ga0373961_0008127 3300035241 Bacteria 2550
466 Ga0373962_0002283 3300035242 Bacteria 4579
467 Ga0373962_0005871 3300035242 Bacteria 2963
468 Ga0373931_0000472 3300035691 Bacteria 16383
469 Ga0373931_0003271 3300035691 Bacteria 7251
470 Ga0373931_0006500 3300035691 Bacteria 5463
471 Ga0373931_0092917 3300035691 Bacteria 1684
472 Ga0373935_0065574 3300035692 Bacteria 2331
473 Ga0373927_0756318 3300035695 Bacteria 642
474 Ga0373937_0256450 3300036401 Bacteria 1649
475 Ga0373937_1051005 3300036401 Bacteria 763
476 Ga0373925_0511772 3300037068 Bacteria 986
477 Ga0395899_0138009 3300037312 Bacteria 1737
478 Ga0395900_0055899 3300037418 Bacteria 4063
479 Ga0395905_0001223 3300037471 Bacteria 32002
480 Ga0395905_0089349 3300037471 Bacteria 2888
481 Ga0436364_1216280 3300037853 Bacteria 1488
482 Ga0395901_0042308 3300038443 Bacteria 4723
483 Ga0436360_0655873 3300039438 Bacteria 690
484 Ga0436363_0559314 3300039450 Unclassified 977
485 Ga0436363_1580826 3300039450 Bacteria 525
486 Ga0451853_1699587 3300041512 Bacteria 664
487 Ga0466960_0314501 3300044901 Bacteria 885
488 Ga0451576_0663200 3300045051 Bacteria 1096
489 Ga0495590_0327335 3300046457 Bacteria 580
490 Ga0495584_0207122 3300046491 Bacteria 997
491 Ga0495607_0521341 3300046501 Bacteria 525
492 Ga0495628_0453233 3300046516 Bacteria 931
493 Ga0495598_0141663 3300046537 Bacteria 832
494 Ga0495633_0153382 3300046558 Bacteria 1064
495 Ga0495668_0253462 3300046616 Bacteria 963
496 Ga0495625_0643364 3300046660 Bacteria 632
497 Ga0496100_0007639 3300048903 Bacteria 5979
498 Ga0496100_0011415 3300048903 Bacteria 5056
499 Ga0496100_0052620 3300048903 Bacteria 2648
500 Ga0496101_0022659 3300048904 Bacteria 4326
501 Ga0496101_0032589 3300048904 Bacteria 3669
502 Ga0496102_0450728 3300048905 Bacteria 1207
503 Ga0496102_0858550 3300048905 Bacteria 830
504 Ga0496102_1267714 3300048905 Bacteria 656
505 Ga0496103_0024224 3300048906 Bacteria 3661
506 Ga0496104_0000516 3300048907 Bacteria 33106
507 Ga0496104_0001175 3300048907 Bacteria 22476
508 Ga0496104_0205451 3300048907 Bacteria 1881
509 Ga0496104_0487540 3300048907 Bacteria 1144
510 Ga0496104_1143535 3300048907 Bacteria 682
511 Ga0496105_0118112 3300048908 Bacteria 2187
512 Ga0496105_0403609 3300048908 Bacteria 1084
513 Ga0496105_0862883 3300048908 Bacteria 684
514 Ga0496105_0896821 3300048908 Bacteria 668
515 Ga0496106_0001682 3300048909 Bacteria 16553
516 Ga0496106_0043006 3300048909 Bacteria 3388
517 Ga0496106_0175615 3300048909 Bacteria 1699
518 Ga0496107_0001737 3300048910 Bacteria 13696
519 Ga0496107_0037841 3300048910 Bacteria 3463
520 Ga0496107_0332641 3300048910 Bacteria 1130
521 Ga0496108_0015349 3300048911 Bacteria 6247
522 Ga0496108_0027601 3300048911 Bacteria 4691
523 Ga0496108_0071147 3300048911 Bacteria 2935
524 Ga0496108_0092744 3300048911 Bacteria 2568
525 Ga0496108_1465829 3300048911 Bacteria 569
526 Ga0496108_1665710 3300048911 Bacteria 526
527 Ga0496109_0033413 3300048912 Bacteria 4628
528 Ga0496109_0246123 3300048912 Bacteria 1683
529 Ga0496109_0556233 3300048912 Bacteria 1082
530 Ga0496109_0744891 3300048912 Bacteria 917
531 Ga0496110_0001844 3300048913 Bacteria 15638
532 Ga0496110_0007298 3300048913 Bacteria 8816
533 Ga0496110_0031151 3300048913 Bacteria 4600
534 Ga0496110_0128509 3300048913 Bacteria 2287
535 Ga0496110_0200233 3300048913 Bacteria 1814
536 Ga0496111_0056730 3300048914 Bacteria 2834
537 Ga0496111_0217219 3300048914 Bacteria 1420
538 Ga0496111_0314360 3300048914 Bacteria 1160
539 Ga0496111_0353554 3300048914 Bacteria 1087
540 Ga0496112_0183421 3300048915 Bacteria 2056
541 Ga0496112_0191616 3300048915 Bacteria 2006
542 Ga0496112_0222777 3300048915 Bacteria 1842
543 Ga0496113_0034741 3300048916 Bacteria 3681
544 Ga0496113_0348887 3300048916 Bacteria 1187
545 Ga0496113_0847519 3300048916 Bacteria 724
546 Ga0496114_0005890 3300048917 Bacteria 9633
547 Ga0496114_0036154 3300048917 Bacteria 4082
548 Ga0496114_0046637 3300048917 Bacteria 3602
549 Ga0496115_0001067 3300048918 Bacteria 19832
550 Ga0496115_0035479 3300048918 Bacteria 3945
551 Ga0496115_0083069 3300048918 Bacteria 2610
552 Ga0496119_0536224 3300048922 Bacteria 540
553 Ga0501031_0216768 3300049568 Bacteria 1247
554 Ga0501032_0135004 3300049569 Bacteria 1626
555 Ga0501032_0265890 3300049569 Bacteria 1112
556 Ga0501034_0009570 3300049571 Bacteria 10141
557 Ga0501034_0341376 3300049571 Bacteria 1428
558 Ga0501036_0025031 3300049572 Bacteria 5034
559 Ga0501037_0043124 3300049573 Bacteria 3315
560 Ga0501037_0198107 3300049573 Bacteria 1420
561 Ga0501037_1084211 3300049573 Bacteria 519
562 Ga0501038_0036367 3300049574 Bacteria 4322
563 Ga0501039_0149097 3300049575 Bacteria 1838
564 Ga0501039_0192224 3300049575 Bacteria 1605
565 Ga0501039_0249042 3300049575 Bacteria 1397
566 Ga0501040_0035626 3300049576 Bacteria 3376
567 Ga0501040_0156082 3300049576 Bacteria 1612
568 Ga0501040_0173746 3300049576 Bacteria 1526
569 Ga0501040_0486853 3300049576 Bacteria 889
570 Ga0501041_0027454 3300049577 Bacteria 3430
571 Ga0501041_0242884 3300049577 Bacteria 1132
572 Ga0501041_0471623 3300049577 Bacteria 797
573 Ga0501041_0721783 3300049577 Bacteria 638
574 Ga0501042_0061289 3300049578 Bacteria 2688
575 Ga0501042_0991480 3300049578 Bacteria 612
576 Ga0501043_0330668 3300049579 Bacteria 1160
577 Ga0501046_0376814 3300049580 Bacteria 1028
578 Ga0501046_0576022 3300049580 Bacteria 800
579 Ga0501048_0274794 3300049582 Bacteria 1198
580 Ga0501067_0001744 3300049583 Bacteria 11950
581 Ga0501067_0155389 3300049583 Bacteria 1274
582 Ga0501067_0713952 3300049583 Bacteria 564
583 Ga0501068_0239495 3300049584 Bacteria 1155
584 Ga0501069_0508423 3300049585 Bacteria 719
585 Ga0501070_0269089 3300049586 Bacteria 1392
586 Ga0501071_0901497 3300049587 Bacteria 682
587 Ga0501072_0039562 3300049588 Bacteria 3702
588 Ga0501072_0779419 3300049588 Bacteria 749
589 Ga0501073_0195125 3300049589 Bacteria 1400
590 Ga0501074_0112138 3300049590 Bacteria 1951
591 Ga0501074_0116892 3300049590 Bacteria 1908
592 Ga0501074_0504094 3300049590 Bacteria 857
593 Ga0501075_0005939 3300049591 Bacteria 8355
594 Ga0501075_0195066 3300049591 Bacteria 1544
595 Ga0501075_0206971 3300049591 Bacteria 1497
596 Ga0501076_0015278 3300049592 Bacteria 5800
597 Ga0501076_0401135 3300049592 Bacteria 1128
598 Ga0501076_0431945 3300049592 Bacteria 1084
599 Ga0501076_0436564 3300049592 Bacteria 1078
600 Ga0501076_0616756 3300049592 Bacteria 895
601 Ga0501077_0068353 3300049593 Bacteria 2252
602 Ga0501077_0482521 3300049593 Bacteria 794
603 Ga0501077_0562838 3300049593 Bacteria 732
604 Ga0501077_0807714 3300049593 Bacteria 603
605 Ga0501077_0924845 3300049593 Bacteria 561
606 Ga0501079_0062339 3300049741 Bacteria 2876
607 Ga0501079_0090574 3300049741 Bacteria 2369
608 Ga0501079_0191365 3300049741 Bacteria 1597
609 Ga0501079_0361261 3300049741 Bacteria 1138
610 Ga0501079_1072340 3300049741 Bacteria 635
611 Ga0501080_0062699 3300049742 Bacteria 3460
612 Ga0501080_0227481 3300049742 Bacteria 1705
613 Ga0501080_0240687 3300049742 Bacteria 1652
614 Ga0501080_0677360 3300049742 Bacteria 911
615 Ga0501080_0811657 3300049742 Bacteria 820
616 Ga0501080_1202068 3300049742 Bacteria 652
617 Ga0501081_0025414 3300049743 Bacteria 3983
618 Ga0501081_0051720 3300049743 Bacteria 2833
619 Ga0501081_0117096 3300049743 Bacteria 1895
620 Ga0501081_1259221 3300049743 Bacteria 561
621 Ga0501083_0017441 3300049744 Bacteria 5004
622 Ga0501083_0028037 3300049744 Bacteria 3882
623 Ga0501083_0052513 3300049744 Bacteria 2738
624 Ga0501083_0420247 3300049744 Bacteria 870
625 Ga0501083_0444554 3300049744 Bacteria 844
626 Ga0501035_0245428 3300049822 Bacteria 1522
627 Ga0501044_0242532 3300049823 Bacteria 1745
628 Ga0501044_1053901 3300049823 Bacteria 684
629 Ga0501045_0188174 3300049824 Bacteria 1538
630 Ga0501045_0728181 3300049824 Bacteria 731
631 nmdc:mga03n38_303_c1 3300050490 Bacteria 11863
632 nmdc:mga03n38_5304_c1 3300050490 Bacteria 4376
633 nmdc:mga03n38_682641_c1 3300050490 Bacteria 591
634 nmdc:mga00v17_596629_c1 3300050491 Bacteria 712
635 nmdc:mga00v17_88117_c1 3300050491 Bacteria 1946
636 nmdc:mga0yw44_416810_c1 3300050492 Bacteria 909
637 nmdc:mga0yw44_5626_c1 3300050492 Bacteria 5959
638 nmdc:mga0k408_27706_c1 3300050493 Bacteria 3219
639 nmdc:mga0k408_3565_c1 3300050493 Bacteria 8230
640 nmdc:mga06z11_1093_c1 3300050494 Bacteria 9890
641 nmdc:mga06z11_1406_c1 3300050494 Bacteria 8943
642 nmdc:mga06z11_1533_c1 3300050494 Bacteria 8571
643 nmdc:mga04h51_10879_c1 3300050495 Bacteria 2512
644 nmdc:mga04h51_211784_c1 3300050495 Bacteria 765
645 nmdc:mga04h51_22136_c1 3300050495 Bacteria 1920
646 nmdc:mga05p37_133337_c1 3300050507 Bacteria 3047
647 nmdc:mga05p37_1370857_c1 3300050507 Bacteria 715
648 nmdc:mga05p37_1472359_c1 3300050507 Bacteria 680
649 nmdc:mga05p37_313624_c1 3300050507 Bacteria 1858
650 nmdc:mga05p37_525908_c2 3300050507 Bacteria 635
651 nmdc:mga05p37_885435_c1 3300050507 Unclassified 965
652 nmdc:mga09592_1048432_c1 3300050508 Bacteria 680
653 nmdc:mga09592_199910_c1 3300050508 Bacteria 1731
654 nmdc:mga09592_277563_c1 3300050508 Bacteria 1453
655 nmdc:mga09592_281099_c1 3300050508 Bacteria 1443
656 nmdc:mga0qj67_13558_c1 3300050509 Bacteria 6149
657 nmdc:mga0qj67_136570_c1 3300050509 Bacteria 1987
658 nmdc:mga0qj67_183834_c1 3300050509 Bacteria 1698
659 nmdc:mga0qj67_226329_c1 3300050509 Bacteria 1518
660 nmdc:mga0qj67_24345_c1 3300050509 Bacteria 4666
661 nmdc:mga0qj67_575886_c1 3300050509 Bacteria 902
662 nmdc:mga06r32_121796_c1 3300050510 Bacteria 2574
663 nmdc:mga06r32_1267705_c1 3300050510 Bacteria 682
664 nmdc:mga06r32_433296_c1 3300050510 Bacteria 1295
665 nmdc:mga06r32_48108_c1 3300050510 Bacteria 4076
666 nmdc:mga06r32_517515_c1 3300050510 Bacteria 1169
667 nmdc:mga06r32_629079_c1 3300050510 Bacteria 1043
668 nmdc:mga06r32_6618_c1 3300050510 Bacteria 10413
669 nmdc:mga08y16_1169839_c1 3300050511 Bacteria 741
670 nmdc:mga08y16_170570_c1 3300050511 Bacteria 2260
671 nmdc:mga08y16_275453_c1 3300050511 Bacteria 1737
672 nmdc:mga08y16_323338_c1 3300050511 Bacteria 1588
673 nmdc:mga08y16_524199_c1 3300050511 Bacteria 1201
674 nmdc:mga08y16_674083_c1 3300050511 Bacteria 1036
675 nmdc:mga08y16_781949_c1 3300050511 Bacteria 949
676 nmdc:mga08y16_89761_c1 3300050511 Bacteria 3203
677 nmdc:mga0n895_136398_c1 3300050512 Bacteria 2480
678 nmdc:mga0n895_141505_c1 3300050512 Bacteria 2434
679 nmdc:mga0n895_694795_c1 3300050512 Bacteria 1014
680 nmdc:mga0n895_8117_c1 3300050512 Bacteria 9068
681 nmdc:mga0rr50_116996_c1 3300050513 Bacteria 2117
682 nmdc:mga0rr50_343113_c1 3300050513 Bacteria 1255
683 nmdc:mga0rr50_947124_c1 3300050513 Bacteria 734
684 nmdc:mga0rr50_9893_c1 3300050513 Bacteria 6027
685 nmdc:mga08x19_547354_c1 3300050514 Bacteria 819
686 nmdc:mga0a205_151595_c1 3300050515 Bacteria 2217
687 nmdc:mga0a205_270574_c1 3300050515 Bacteria 1576
688 nmdc:mga0a205_2998_c1 3300050515 Bacteria 14963
689 nmdc:mga0a205_70058_c1 3300050515 Bacteria 3386
690 nmdc:mga0a205_834006_c1 3300050515 Bacteria 769
691 Ga0495619_0209830 3300053085 Bacteria 1349
692 Ga0495619_0322001 3300053085 Bacteria 1070
693 Ga0500608_105598 3300053122 Bacteria 1298
694 Ga0500590_066511 3300053148 Bacteria 1799
695 Ga0501084_0006560 3300054114 Bacteria 9561
696 Ga0501084_0093435 3300054114 Bacteria 2525
697 Ga0501084_0106686 3300054114 Bacteria 2353
698 Ga0501084_0259778 3300054114 Bacteria 1466
699 Ga0501084_0468891 3300054114 Bacteria 1064
700 Ga0501084_0995090 3300054114 Bacteria 705
701 Ga0501082_0002773 3300060353 Bacteria 15309
702 Ga0501082_0019935 3300060353 Bacteria 5779
703 Ga0501082_0150797 3300060353 Bacteria 2019
704 Ga0501082_0242787 3300060353 Bacteria 1567
705 Ga0501082_1606064 3300060353 Bacteria 568
706 Ga0530510_0031615 3300061734 Bacteria 3806
707 Ga0530510_0261482 3300061734 Bacteria 1291
708 Ga0530510_0401628 3300061734 Bacteria 1033
709 Ga0530510_0589688 3300061734 Bacteria 845
710 Ga0530510_0842352 3300061734 Bacteria 700
711 2828309285 2828305725 Bacteria 4916900
712 Ga0070693_100394999
713 JGI24747J21853_1026366
714 JGI24739J22299_10070761
715 JGI24737J22298_10039564
716 JGI24750J21931_1079018
717 JGI24738J21930_10020523
718 JGI24751J29686_10024660
719 JGI24751J29686_10044330
720 JGI25404J52841_10120565
721 JGI25405J52794_10085216
722 Ga0065712_10280623
723 Ga0070676_10000301
724 Ga0070690_100010536
725 Ga0070690_100511319
726 Ga0070677_10410097
727 Ga0068869_100056221
728 Ga0070680_100041764
729 Ga0070680_100118491
730 Ga0070680_100218930
731 Ga0070680_100359855
732 Ga0070682_100001766
733 Ga0068868_100243238
734 Ga0070660_100413264
735 Ga0070689_100044910
736 Ga0070689_100072974
737 Ga0070691_10000239
738 Ga0070691_10123999
739 Ga0070687_100292927
740 Ga0070661_100001859
741 Ga0070692_10037784
742 Ga0070668_100064746
743 Ga0070668_100152825
744 Ga0070668_100255021
745 Ga0070669_100000391
746 Ga0070675_100007068
747 Ga0070671_100006526
748 Ga0070671_100515759
749 Ga0070674_100000499
750 Ga0070674_101125299
751 Ga0070674_101828016
752 Ga0070673_100001824
753 Ga0070673_100095233
754 Ga0070688_100000242
755 Ga0070688_100130435
756 Ga0070688_100924522
757 Ga0070659_100156679
758 Ga0070659_100333544
759 Ga0070659_100349872
760 Ga0070659_100736896
761 Ga0070667_100000918
762 Ga0070667_101146874
763 Ga0070667_102196459
764 Ga0070709_10005755
765 Ga0070714_100013579
766 Ga0070710_10044068
767 Ga0070701_10015251
768 Ga0070701_10291576
769 Ga0070701_10515490
770 Ga0070711_100000881
771 Ga0070711_101160854
772 Ga0070705_100002231
773 Ga0070705_100178072
774 Ga0070700_100113515
775 Ga0070700_100436574
776 Ga0070700_100461418
777 Ga0070700_100480589
778 Ga0070694_100027289
779 Ga0070694_100029406
780 Ga0070694_100464853
781 Ga0070708_101041711
782 Ga0070708_101450957
783 Ga0070663_100097735
784 Ga0070663_100316296
785 Ga0070663_100902742
786 Ga0070678_100057207
787 Ga0070662_100012179
788 Ga0070662_101135665
789 Ga0070662_101138660
790 Ga0070681_10035471
791 Ga0068867_100055195
792 Ga0068867_100333428
793 Ga0070685_10009257
794 Ga0070685_10134357
795 Ga0070685_10522587
796 Ga0070707_100711768
797 Ga0070699_100065684
798 Ga0070679_100508708
799 Ga0070684_100006303
800 Ga0070697_100001481
801 Ga0068853_102191666
802 Ga0068853_102389208
803 Ga0070672_100008024
804 Ga0070686_100000939
805 Ga0070695_100017664
806 Ga0070695_100274511
807 Ga0070695_100344078
808 Ga0070696_100002535
809 Ga0070696_100031476
810 Ga0070696_101387045
811 Ga0070696_102025526
812 Ga0070693_100000603
813 Ga0070693_101456335
814 Ga0070665_100003793
815 Ga0070665_100187743
816 Ga0070665_100656403
817 Ga0070704_100001715
818 Ga0070704_100233547
819 Ga0070704_100302493
820 Ga0070704_100318248
821 Ga0068855_100004383
822 Ga0068855_101811150
823 Ga0070664_100048569
824 Ga0068857_100128850
825 Ga0068854_100010513
826 Ga0068856_100019676
827 Ga0068856_100210249
828 Ga0070702_100007898
829 Ga0070702_100508830
830 Ga0070702_101111590
831 Ga0068852_100604565
832 Ga0068859_100003356
833 Ga0068859_100056767
834 Ga0068859_101286056
835 Ga0068864_100623742
836 Ga0068861_100004366
837 Ga0068861_100363737
838 Ga0068861_100619156
839 Ga0068861_101469973
840 Ga0068870_10174869
841 Ga0068863_100053816
842 Ga0068863_100431512
843 Ga0068863_102604151
844 Ga0068858_100014191
845 Ga0068858_100347313
846 Ga0068858_101288519
847 Ga0068860_100002798
848 Ga0068860_100536566
849 Ga0068860_101437930
850 Ga0068862_100004242
851 Ga0068862_101098190
852 Ga0068862_101320979
853 Ga0081455_10000170
854 Ga0081455_10039515
855 Ga0081540_1000165
856 Ga0081540_1033393
857 Ga0081540_1050453
858 Ga0081539_10070068
859 Ga0075365_10006755
860 Ga0075365_10450204
861 Ga0075368_10001299
862 Ga0075368_10005248
863 Ga0075368_10128874
864 Ga0075363_100021865
865 Ga0075363_100024186
866 Ga0075364_10003077
867 Ga0075364_10672103
868 Ga0075364_10907065
869 Ga0075432_10044185
870 Ga0070715_10000180
871 Ga0070712_100025172
872 Ga0070712_100093091
873 Ga0075367_10004018
874 Ga0075367_10007480
875 Ga0075367_10020318
876 Ga0075367_10297433
877 Ga0075366_10002421
878 Ga0075366_10019541
879 Ga0097621_100010829
880 Ga0097621_100998324
881 Ga0097621_102066725
882 Ga0075370_10315359
883 Ga0068871_100156845
884 Ga0075428_100082477
885 Ga0075428_100144091
886 Ga0075428_100372744
887 Ga0075428_100610739
888 Ga0075428_100762305
889 Ga0075430_100045125
890 Ga0075430_100078448
891 Ga0075430_100085560
892 Ga0075430_100323289
893 Ga0075430_100517586
894 Ga0075430_100637038
895 Ga0075430_100642824
896 Ga0075431_100042858
897 Ga0075431_100049916
898 Ga0075431_100288117
899 Ga0075431_100624827
900 Ga0075431_100900293
901 Ga0075431_100966677
902 Ga0075433_10006505
903 Ga0075433_10026034
904 Ga0075433_10036544
905 Ga0075433_10293846
906 Ga0075434_100000653
907 Ga0075434_100194746
908 Ga0075434_100526469
909 Ga0075434_100568268
910 Ga0075429_100291325
911 Ga0075429_100345161
912 Ga0075429_100359151
913 Ga0075429_100574937
914 Ga0068865_100015213
915 Ga0068865_100244613
916 Ga0068865_100712310
917 Ga0068865_100824367
918 Ga0075436_100002459
919 Ga0075436_101060863
920 Ga0097620_100003356
921 Ga0097620_100056765
922 Ga0097620_101285862
923 Ga0097620_102954632
924 Ga0075435_100015403
925 Ga0075435_100679934
926 Ga0105240_10051975
927 Ga0105240_10597240
928 Ga0111539_10024090
929 Ga0111539_10031382
930 Ga0111539_10076404
931 Ga0111539_10124508
932 Ga0111539_10454450
933 Ga0111539_11716424
934 Ga0111539_12482804
935 Ga0105245_10355803
936 Ga0105245_10459318
937 Ga0105245_10527501
938 Ga0105245_10604072
939 Ga0105245_11719135
940 Ga0105247_10006124
941 Ga0105247_10065353
942 Ga0105247_10241073
943 Ga0105247_10299509
944 Ga0105247_10533645
945 Ga0114129_10053132
946 Ga0114129_10085456
947 Ga0114129_10233827
948 Ga0114129_10268522
949 Ga0114129_10341577
950 Ga0105243_10001295
951 Ga0105243_10493478
952 Ga0105243_10699134
953 Ga0105243_11948424
954 Ga0105243_12547174
955 Ga0105243_12703057
956 Ga0105241_10000469
957 Ga0105242_10001374
958 Ga0105242_11873242
959 Ga0105242_13073054
960 Ga0105248_10013243
961 Ga0105248_10363545
962 Ga0105248_11327642
963 Ga0105237_10006470
964 Ga0105238_10037236
965 Ga0105249_10825344
966 Ga0105249_10976740
967 Ga0105249_11097169
968 Ga0105249_11460134
969 Ga0105249_12729564
970 Ga0099796_10218108
971 Ga0105239_10129421
972 Ga0105239_11033287
973 Ga0105239_11250320
974 Ga0105246_10003512
975 Ga0105246_10116454
976 Ga0105246_10321580
977 Ga0105246_10844140
978 Ga0105246_12315279
979 Ga0105246_12388579
980 Ga0157314_1019300
981 Ga0157342_1077121
982 Ga0157373_10128604
983 Ga0157371_10009461
984 Ga0157369_10000947
985 Ga0157374_10098149
986 Ga0157378_10001777
987 Ga0157378_10070443
988 Ga0157378_10428673
989 Ga0157378_12884960
990 Ga0163162_10013704
991 Ga0163162_10205094
992 Ga0163162_10832701
993 Ga0163162_11584005
994 Ga0157372_10000133
995 Ga0157372_10816972
996 Ga0157372_13109929
997 Ga0157375_10000531
998 Ga0157375_10003004
999 Ga0163163_10048586
1000 Ga0163163_10163851
1001 Ga0163163_11058904
1002 Ga0157380_10001038
1003 Ga0157380_10104329
1004 Ga0157380_10196428
1005 Ga0157380_10254682
1006 Ga0157380_10443843
1007 Ga0157380_10973111
1008 Ga0157380_11263780
1009 Ga0157380_11426226
1010 Ga0157380_12198440
1011 Ga0182008_10096205
1012 Ga0182008_10543624
1013 Ga0157377_10000610
1014 Ga0157379_10000847
1015 Ga0157379_10030380
1016 Ga0157379_10066960
1017 Ga0157379_10285667
1018 Ga0157379_10439234
1019 Ga0157379_10745490
1020 Ga0157379_12243878
1021 Ga0157376_10000565
1022 Ga0157376_10336940
1023 Ga0163161_10002364
1024 Ga0163161_10207301
1025 Ga0163161_10975830
1026 Ga0207692_10013938
1027 Ga0207642_11080872
1028 Ga0207710_10291321
1029 Ga0207710_10465970
1030 Ga0207688_10052665
1031 Ga0207680_10291846
1032 Ga0207680_10529147
1033 Ga0207647_10000886
1034 Ga0207685_10063207
1035 Ga0207699_10095303
1036 Ga0207699_11366935
1037 Ga0207645_10000890
1038 Ga0207643_10353682
1039 Ga0207654_10010151
1040 Ga0207707_10048984
1041 Ga0207695_10887561
1042 Ga0207695_11194785
1043 Ga0207671_10004966
1044 Ga0207693_10000110
1045 Ga0207693_10102070
1046 Ga0207663_10018165
1047 Ga0207663_10299381
1048 Ga0207662_10001153
1049 Ga0207657_10000023
1050 Ga0207649_10002699
1051 Ga0207652_10461103
1052 Ga0207646_10515888
1053 Ga0207681_10940067
1054 Ga0207694_10029078
1055 Ga0207659_10006477
1056 Ga0207687_10008017
1057 Ga0207700_10005146
1058 Ga0207700_11908819
1059 Ga0207664_10355539
1060 Ga0207664_10407696
1061 Ga0207664_10660607
1062 Ga0207644_10007668
1063 Ga0207644_10780622
1064 Ga0207690_10027051
1065 Ga0207690_10323748
1066 Ga0207690_11019973
1067 Ga0207706_10000019
1068 Ga0207706_10464809
1069 Ga0207706_10895737
1070 Ga0207686_10050601
1071 Ga0207709_10023709
1072 Ga0207670_10006112
1073 Ga0207670_10634426
1074 Ga0207669_10674309
1075 Ga0207669_10752588
1076 Ga0207704_10037246
1077 Ga0207704_10284012
1078 Ga0207704_10550687
1079 Ga0207665_10000095
1080 Ga0207691_10000947
1081 Ga0207711_10011651
1082 Ga0207711_10234136
1083 Ga0207711_10962089
1084 Ga0207689_10021208
1085 Ga0207679_10536904
1086 Ga0207667_10100285
1087 Ga0207651_10002421
1088 Ga0207651_10127282
1089 Ga0207712_10001385
1090 Ga0207712_10996432
1091 Ga0207712_11066709
1092 Ga0207668_10009497
1093 Ga0207668_10112666
1094 Ga0207668_10354878
1095 Ga0207668_10823120
1096 Ga0207668_10971018
1097 Ga0207640_11746624
1098 Ga0207658_10034585
1099 Ga0207658_11538456
1100 Ga0207677_10044501
1101 Ga0207703_10019892
1102 Ga0207703_10048370
1103 Ga0207703_10402708
1104 Ga0207639_10002584
1105 Ga0207639_10321207
1106 Ga0207678_10000017
1107 Ga0207678_10125765
1108 Ga0207678_10860403
1109 Ga0207708_10001479
1110 Ga0207708_10008312
1111 Ga0207708_10150358
1112 Ga0207708_10205059
1113 Ga0207708_10613935
1114 Ga0207708_10726005
1115 Ga0207708_11530857
1116 Ga0207702_10011527
1117 Ga0207702_10307843
1118 Ga0207648_10039142
1119 Ga0207648_10468056
1120 Ga0207676_10029374
1121 Ga0207676_10508282
1122 Ga0207674_10000437
1123 Ga0207675_100001318
1124 Ga0207675_100165949
1125 Ga0207675_100187640
1126 Ga0207675_100234765
1127 Ga0207675_100489152
1128 Ga0207675_100800790
1129 Ga0207683_10000030
1130 Ga0207683_10084115
1131 Ga0207683_12167542
1132 Ga0207698_10298221
1133 Ga0207698_11638518
1134 Ga0207698_11920328
1135 Ga0209813_10000400
1136 Ga0209813_10006650
1137 Ga0207428_10046057
1138 Ga0207428_10112457
1139 Ga0207428_10178022
1140 Ga0207428_11165333
1141 Ga0268266_10269152
1142 Ga0268266_10750980
1143 Ga0268266_11872568
1144 Ga0268266_11921341
1145 Ga0268265_10102879
1146 Ga0268265_11100720
1147 Ga0268264_10041649
1148 Ga0268264_11123202
1149 Ga0268264_11149446
1150 Ga0307411_11160945
1151 Ga0373930_0199130
1152 Ga0373948_0034072
1153 Ga0373950_0011534
1154 Ga0373958_0028705
1155 Ga0373959_0022350
1156 Ga0373928_0007710
1157 Ga0373929_0153927
1158 Ga0373929_0167106
1159 Ga0373940_0094936
1160 Ga0373940_0213633
1161 Ga0373951_0041560
1162 Ga0373952_0006622
1163 Ga0373952_0015166
1164 Ga0373932_0004056
1165 Ga0373932_0245446
1166 Ga0373939_0016694
1167 Ga0373941_0008349
1168 Ga0373941_0086660
1169 Ga0373953_0554444
1170 Ga0373960_0016981
1171 Ga0373960_0019623
1172 Ga0373943_0599626
1173 Ga0373946_0786502
1174 Ga0373942_0057922
1175 Ga0373961_0003490
1176 Ga0373961_0008127
1177 Ga0373962_0002283
1178 Ga0373962_0005871
1179 Ga0373931_0000472
1180 Ga0373931_0003271
1181 Ga0373931_0006500
1182 Ga0373931_0092917
1183 Ga0373935_0065574
1184 Ga0373927_0756318
1185 Ga0373937_0256450
1186 Ga0373937_1051005
1187 Ga0373925_0511772
1188 Ga0395899_0138009
1189 Ga0395900_0055899
1190 Ga0395905_0001223
1191 Ga0395905_0089349
1192 Ga0436364_1216280
1193 Ga0395901_0042308
1194 Ga0436360_0655873
1195 Ga0436363_0559314
1196 Ga0436363_1580826
1197 Ga0451853_1699587
1198 Ga0466960_0314501
1199 Ga0451576_0663200
1200 Ga0495590_0327335
1201 Ga0495584_0207122
1202 Ga0495607_0521341
1203 Ga0495628_0453233
1204 Ga0495598_0141663
1205 Ga0495633_0153382
1206 Ga0495668_0253462
1207 Ga0495625_0643364
1208 Ga0496100_0007639
1209 Ga0496100_0011415
1210 Ga0496100_0052620
1211 Ga0496101_0022659
1212 Ga0496101_0032589
1213 Ga0496102_0450728
1214 Ga0496102_0858550
1215 Ga0496102_1267714
1216 Ga0496103_0024224
1217 Ga0496104_0000516
1218 Ga0496104_0001175
1219 Ga0496104_0205451
1220 Ga0496104_0487540
1221 Ga0496104_1143535
1222 Ga0496105_0118112
1223 Ga0496105_0403609
1224 Ga0496105_0862883
1225 Ga0496105_0896821
1226 Ga0496106_0001682
1227 Ga0496106_0043006
1228 Ga0496106_0175615
1229 Ga0496107_0001737
1230 Ga0496107_0037841
1231 Ga0496107_0332641
1232 Ga0496108_0015349
1233 Ga0496108_0027601
1234 Ga0496108_0071147
1235 Ga0496108_0092744
1236 Ga0496108_1465829
1237 Ga0496108_1665710
1238 Ga0496109_0033413
1239 Ga0496109_0246123
1240 Ga0496109_0556233
1241 Ga0496109_0744891
1242 Ga0496110_0001844
1243 Ga0496110_0007298
1244 Ga0496110_0031151
1245 Ga0496110_0128509
1246 Ga0496110_0200233
1247 Ga0496111_0056730
1248 Ga0496111_0217219
1249 Ga0496111_0314360
1250 Ga0496111_0353554
1251 Ga0496112_0183421
1252 Ga0496112_0191616
1253 Ga0496112_0222777
1254 Ga0496113_0034741
1255 Ga0496113_0348887
1256 Ga0496113_0847519
1257 Ga0496114_0005890
1258 Ga0496114_0036154
1259 Ga0496114_0046637
1260 Ga0496115_0001067
1261 Ga0496115_0035479
1262 Ga0496115_0083069
1263 Ga0496119_0536224
1264 Ga0501031_0216768
1265 Ga0501032_0135004
1266 Ga0501032_0265890
1267 Ga0501034_0009570
1268 Ga0501034_0341376
1269 Ga0501036_0025031
1270 Ga0501037_0043124
1271 Ga0501037_0198107
1272 Ga0501037_1084211
1273 Ga0501038_0036367
1274 Ga0501039_0149097
1275 Ga0501039_0192224
1276 Ga0501039_0249042
1277 Ga0501040_0035626
1278 Ga0501040_0156082
1279 Ga0501040_0173746
1280 Ga0501040_0486853
1281 Ga0501041_0027454
1282 Ga0501041_0242884
1283 Ga0501041_0471623
1284 Ga0501041_0721783
1285 Ga0501042_0061289
1286 Ga0501042_0991480
1287 Ga0501043_0330668
1288 Ga0501046_0376814
1289 Ga0501046_0576022
1290 Ga0501048_0274794
1291 Ga0501067_0001744
1292 Ga0501067_0155389
1293 Ga0501067_0713952
1294 Ga0501068_0239495
1295 Ga0501069_0508423
1296 Ga0501070_0269089
1297 Ga0501071_0901497
1298 Ga0501072_0039562
1299 Ga0501072_0779419
1300 Ga0501073_0195125
1301 Ga0501074_0112138
1302 Ga0501074_0116892
1303 Ga0501074_0504094
1304 Ga0501075_0005939
1305 Ga0501075_0195066
1306 Ga0501075_0206971
1307 Ga0501076_0015278
1308 Ga0501076_0401135
1309 Ga0501076_0431945
1310 Ga0501076_0436564
1311 Ga0501076_0616756
1312 Ga0501077_0068353
1313 Ga0501077_0482521
1314 Ga0501077_0562838
1315 Ga0501077_0807714
1316 Ga0501077_0924845
1317 Ga0501079_0062339
1318 Ga0501079_0090574
1319 Ga0501079_0191365
1320 Ga0501079_0361261
1321 Ga0501079_1072340
1322 Ga0501080_0062699
1323 Ga0501080_0227481
1324 Ga0501080_0240687
1325 Ga0501080_0677360
1326 Ga0501080_0811657
1327 Ga0501080_1202068
1328 Ga0501081_0025414
1329 Ga0501081_0051720
1330 Ga0501081_0117096
1331 Ga0501081_1259221
1332 Ga0501083_0017441
1333 Ga0501083_0028037
1334 Ga0501083_0052513
1335 Ga0501083_0420247
1336 Ga0501083_0444554
1337 Ga0501035_0245428
1338 Ga0501044_0242532
1339 Ga0501044_1053901
1340 Ga0501045_0188174
1341 Ga0501045_0728181
1342 nmdc:mga03n38_303_c1
1343 nmdc:mga03n38_5304_c1
1344 nmdc:mga03n38_682641_c1
1345 nmdc:mga00v17_596629_c1
1346 nmdc:mga00v17_88117_c1
1347 nmdc:mga0yw44_416810_c1
1348 nmdc:mga0yw44_5626_c1
1349 nmdc:mga0k408_27706_c1
1350 nmdc:mga0k408_3565_c1
1351 nmdc:mga06z11_1093_c1
1352 nmdc:mga06z11_1406_c1
1353 nmdc:mga06z11_1533_c1
1354 nmdc:mga04h51_10879_c1
1355 nmdc:mga04h51_211784_c1
1356 nmdc:mga04h51_22136_c1
1357 nmdc:mga05p37_133337_c1
1358 nmdc:mga05p37_1370857_c1
1359 nmdc:mga05p37_1472359_c1
1360 nmdc:mga05p37_313624_c1
1361 nmdc:mga05p37_525908_c2
1362 nmdc:mga05p37_885435_c1
1363 nmdc:mga09592_1048432_c1
1364 nmdc:mga09592_199910_c1
1365 nmdc:mga09592_277563_c1
1366 nmdc:mga09592_281099_c1
1367 nmdc:mga0qj67_13558_c1
1368 nmdc:mga0qj67_136570_c1
1369 nmdc:mga0qj67_183834_c1
1370 nmdc:mga0qj67_226329_c1
1371 nmdc:mga0qj67_24345_c1
1372 nmdc:mga0qj67_575886_c1
1373 nmdc:mga06r32_121796_c1
1374 nmdc:mga06r32_1267705_c1
1375 nmdc:mga06r32_433296_c1
1376 nmdc:mga06r32_48108_c1
1377 nmdc:mga06r32_517515_c1
1378 nmdc:mga06r32_629079_c1
1379 nmdc:mga06r32_6618_c1
1380 nmdc:mga08y16_1169839_c1
1381 nmdc:mga08y16_170570_c1
1382 nmdc:mga08y16_275453_c1
1383 nmdc:mga08y16_323338_c1
1384 nmdc:mga08y16_524199_c1
1385 nmdc:mga08y16_674083_c1
1386 nmdc:mga08y16_781949_c1
1387 nmdc:mga08y16_89761_c1
1388 nmdc:mga0n895_136398_c1
1389 nmdc:mga0n895_141505_c1
1390 nmdc:mga0n895_694795_c1
1391 nmdc:mga0n895_8117_c1
1392 nmdc:mga0rr50_116996_c1
1393 nmdc:mga0rr50_343113_c1
1394 nmdc:mga0rr50_947124_c1
1395 nmdc:mga0rr50_9893_c1
1396 nmdc:mga08x19_547354_c1
1397 nmdc:mga0a205_151595_c1
1398 nmdc:mga0a205_270574_c1
1399 nmdc:mga0a205_2998_c1
1400 nmdc:mga0a205_70058_c1
1401 nmdc:mga0a205_834006_c1
1402 Ga0495619_0209830
1403 Ga0495619_0322001
1404 Ga0500608_105598
1405 Ga0500590_066511
1406 Ga0501084_0006560
1407 Ga0501084_0093435
1408 Ga0501084_0106686
1409 Ga0501084_0259778
1410 Ga0501084_0468891
1411 Ga0501084_0995090
1412 Ga0501082_0002773
1413 Ga0501082_0019935
1414 Ga0501082_0150797
1415 Ga0501082_0242787
1416 Ga0501082_1606064
1417 Ga0530510_0031615
1418 Ga0530510_0261482
1419 Ga0530510_0401628
1420 Ga0530510_0589688
1421 Ga0530510_0842352
1422 2828309285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

17

107

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.9234 4 95
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.8998 14 92
3f42-assembly1.cif.gz_A-2 crystal structure of uncharacterized protein hp0035 from helicobacter pylori 0.8867 4 95
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.8835 19 92
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.8693 14 92
ID Description Score Start End Superfamily
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8653 20 88 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8622 18 88 3.30.1310.10
af_Q2G0T4_1_105_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.854 3 100 3.30.1310.10
af_Q4DVG2_30_117_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8449 11 97 3.30.1310.10
af_O82230_71_179_3.30.1310.10 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.844 1 103 3.30.1310.10
ID Description Score Start End GO Terms
AF-A0A7C6AZH6-F1-model_v4 Nucleoid-associated protein ENX85_00020 0.9682 1 100 GO:0003677
GO:0005829
GO:0043590
AF-A0A2G6KDU8-F1-model_v4 Nucleoid-associated protein CSA56_10170 0.9615 5 103 GO:0003677
GO:0005829
GO:0043590
AF-A0A081BZU0-F1-model_v4 Nucleoid-associated protein U27_04817 0.9598 3 103 GO:0003677
GO:0005829
GO:0043590
AF-G2I5Y0-F1-model_v4 Nucleoid-associated protein GLX_11150 0.9583 1 105 GO:0003677
GO:0005829
GO:0043590
AF-A0A660PY50-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9546 3 93 GO:0003677
GO:0005829

Map