F476749

General Info

Members Datasets Scaffolds Average Seq Length
711 315 1422 120

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100116159|Ga0070671_1001161591
Length 145
Sequence MVQDCERNSFARVAQLLLPDDNAPTMPTLISSPKRIEAAGNKPKIIDEFIGRVNTNEARLSIAKMRSPGGWVEPGQRPEFDEFTIVLAGMLRVRHQAGEMDVRAGQAVIAHAGEWVQYSTPLPEGAEYVAVCLPAFSPQTVHRDA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
229 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
230 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
231 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
267 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 5.49
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 26.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100116159 3300005355 Bacteria 2250
2 JGI25407J50210_10003243 3300003373 Bacteria 3873
3 Ga0065714_10127495 3300005288 Bacteria 1282
4 Ga0065712_10087744 3300005290 Bacteria 2558
5 Ga0065715_10176525 3300005293 Bacteria 1502
6 Ga0065715_10201003 3300005293 Unclassified 1361
7 Ga0070658_10508600 3300005327 Bacteria 1041
8 Ga0070676_10007960 3300005328 Bacteria 5699
9 Ga0070683_100708328 3300005329 Bacteria 964
10 Ga0070683_100781284 3300005329 Unclassified 915
11 Ga0070683_101012293 3300005329 Bacteria 798
12 Ga0070683_101754413 3300005329 Bacteria 597
13 Ga0070683_101953604 3300005329 Bacteria 564
14 Ga0070690_100011622 3300005330 Bacteria 5154
15 Ga0070690_100335967 3300005330 Bacteria 1093
16 Ga0070690_100496360 3300005330 Bacteria 912
17 Ga0070670_100243748 3300005331 Bacteria 1565
18 Ga0070677_10175705 3300005333 Bacteria 1016
19 Ga0068869_100029581 3300005334 Bacteria 3839
20 Ga0068869_102080226 3300005334 Viruses 510
21 Ga0070666_10004954 3300005335 Bacteria 8147
22 Ga0070680_100153569 3300005336 Unclassified 1933
23 Ga0070680_101688074 3300005336 Unclassified 549
24 Ga0070682_100272265 3300005337 Unclassified 1231
25 Ga0068868_100003031 3300005338 Bacteria 11688
26 Ga0068868_100753814 3300005338 Unclassified 875
27 Ga0068868_101626764 3300005338 Bacteria 607
28 Ga0070660_100134505 3300005339 Unclassified 1980
29 Ga0070660_100880036 3300005339 Bacteria 755
30 Ga0070689_100035731 3300005340 Bacteria 3798
31 Ga0070689_100048146 3300005340 Bacteria 3287
32 Ga0070689_100113864 3300005340 Unclassified 2154
33 Ga0070689_100425319 3300005340 Bacteria 1126
34 Ga0070689_100914762 3300005340 Bacteria 777
35 Ga0070689_101339850 3300005340 Unclassified 645
36 Ga0070687_100049730 3300005343 Unclassified 2162
37 Ga0070687_101025958 3300005343 Bacteria 599
38 Ga0070687_101497210 3300005343 Unclassified 507
39 Ga0070661_100256227 3300005344 Unclassified 1352
40 Ga0070668_100072976 3300005347 Bacteria 2675
41 Ga0070668_100250607 3300005347 Bacteria 1470
42 Ga0070675_100002091 3300005354 Bacteria 14780
43 Ga0070675_100383811 3300005354 Bacteria 1251
44 Ga0070675_100508929 3300005354 Bacteria 1086
45 Ga0070675_100586595 3300005354 Bacteria 1010
46 Ga0070671_100014097 3300005355 Bacteria 6453
47 Ga0070671_100063816 3300005355 Bacteria 3068
48 Ga0070671_100514247 3300005355 Bacteria 1031
49 Ga0070674_100082050 3300005356 Bacteria 2305
50 Ga0070674_101179634 3300005356 Unclassified 679
51 Ga0070673_100001866 3300005364 Bacteria 12602
52 Ga0070673_100041483 3300005364 Bacteria 3540
53 Ga0070673_100217490 3300005364 Bacteria 1652
54 Ga0070688_100170633 3300005365 Unclassified 1501
55 Ga0070688_100788901 3300005365 Bacteria 742
56 Ga0070659_100520134 3300005366 Bacteria 1016
57 Ga0070659_101032523 3300005366 Bacteria 723
58 Ga0070667_100098908 3300005367 Bacteria 2518
59 Ga0070667_100628465 3300005367 Unclassified 990
60 Ga0070667_100697503 3300005367 Bacteria 939
61 Ga0070709_10046062 3300005434 Bacteria 2710
62 Ga0070709_10651359 3300005434 Bacteria 815
63 Ga0070714_100023943 3300005435 Bacteria 5022
64 Ga0070714_100199606 3300005435 Bacteria 1829
65 Ga0070713_100003040 3300005436 Bacteria 11021
66 Ga0070713_100092067 3300005436 Bacteria 2609
67 Ga0070713_100178128 3300005436 Bacteria 1909
68 Ga0070713_100453573 3300005436 Bacteria 1205
69 Ga0070713_100598308 3300005436 Bacteria 1047
70 Ga0070713_100628758 3300005436 Bacteria 1021
71 Ga0070713_101494741 3300005436 Bacteria 655
72 Ga0070713_101830138 3300005436 Unclassified 589
73 Ga0070710_10165778 3300005437 Bacteria 1373
74 Ga0070710_10207399 3300005437 Bacteria 1240
75 Ga0070710_10305220 3300005437 Unclassified 1040
76 Ga0070710_10307434 3300005437 Unclassified 1036
77 Ga0070710_11027100 3300005437 Bacteria 602
78 Ga0070710_11190322 3300005437 Unclassified 563
79 Ga0070701_10225746 3300005438 Unclassified 1119
80 Ga0070711_100001779 3300005439 Bacteria 11997
81 Ga0070711_100619902 3300005439 Bacteria 904
82 Ga0070711_101208103 3300005439 Bacteria 654
83 Ga0070711_101317362 3300005439 Unclassified 627
84 Ga0070700_100000309 3300005441 Bacteria 25325
85 Ga0070700_100316924 3300005441 Bacteria 1144
86 Ga0070694_100531154 3300005444 Unclassified 940
87 Ga0070708_100037419 3300005445 Bacteria 4233
88 Ga0070708_101280672 3300005445 Bacteria 685
89 Ga0070663_100104475 3300005455 Bacteria 2119
90 Ga0070678_100001833 3300005456 Bacteria 11466
91 Ga0070678_100724985 3300005456 Bacteria 897
92 Ga0070678_101512418 3300005456 Unclassified 629
93 Ga0070662_100015483 3300005457 Bacteria 5110
94 Ga0070662_100022845 3300005457 Bacteria 4288
95 Ga0070662_100497717 3300005457 Bacteria 1016
96 Ga0068867_100848210 3300005459 Unclassified 818
97 Ga0070685_10020979 3300005466 Unclassified 3544
98 Ga0070685_10522199 3300005466 Bacteria 843
99 Ga0070706_100033932 3300005467 Bacteria 4711
100 Ga0070707_100009561 3300005468 Bacteria 9009
101 Ga0070698_100125179 3300005471 Bacteria 2527
102 Ga0070698_100301120 3300005471 Bacteria 1534
103 Ga0070699_100021961 3300005518 Bacteria 5499
104 Ga0070699_100031198 3300005518 Bacteria 4600
105 Ga0070699_100559245 3300005518 Unclassified 1042
106 Ga0070679_100482898 3300005530 Bacteria 1183
107 Ga0070679_100764100 3300005530 Bacteria 909
108 Ga0070684_100082902 3300005535 Bacteria 2840
109 Ga0070684_100113133 3300005535 Bacteria 2435
110 Ga0070684_100428258 3300005535 Bacteria 1222
111 Ga0070684_100753184 3300005535 Bacteria 909
112 Ga0070684_101282672 3300005535 Bacteria 689
113 Ga0070684_101469175 3300005535 Unclassified 642
114 Ga0070697_100013622 3300005536 Bacteria 6378
115 Ga0070697_101716396 3300005536 Unclassified 562
116 Ga0068853_100005285 3300005539 Bacteria 10107
117 Ga0068853_100197530 3300005539 Unclassified 1830
118 Ga0068853_100361731 3300005539 Bacteria 1352
119 Ga0068853_100980966 3300005539 Unclassified 813
120 Ga0068853_101224295 3300005539 Bacteria 725
121 Ga0070672_100898660 3300005543 Bacteria 782
122 Ga0070672_101067584 3300005543 Bacteria 717
123 Ga0070686_100021749 3300005544 Bacteria 3818
124 Ga0070686_101041123 3300005544 Unclassified 673
125 Ga0070696_100086722 3300005546 Bacteria 2223
126 Ga0070696_100606446 3300005546 Unclassified 883
127 Ga0070693_100028785 3300005547 Bacteria 3023
128 Ga0070693_100371817 3300005547 Unclassified 984
129 Ga0070665_100142704 3300005548 Bacteria 2398
130 Ga0070704_101549668 3300005549 Bacteria 610
131 Ga0070704_101797891 3300005549 Bacteria 567
132 Ga0068855_100012208 3300005563 Bacteria 10384
133 Ga0068855_100034416 3300005563 Bacteria 6043
134 Ga0068855_100127976 3300005563 Unclassified 2903
135 Ga0068855_101866771 3300005563 Unclassified 609
136 Ga0068855_101953980 3300005563 Unclassified 593
137 Ga0070664_100035862 3300005564 Bacteria 4164
138 Ga0070664_100273307 3300005564 Unclassified 1522
139 Ga0068857_100641328 3300005577 Bacteria 1006
140 Ga0068857_100658559 3300005577 Unclassified 993
141 Ga0068857_100861002 3300005577 Unclassified 868
142 Ga0068857_100995995 3300005577 Bacteria 806
143 Ga0068857_101180042 3300005577 Bacteria 741
144 Ga0068854_100106422 3300005578 Bacteria 2110
145 Ga0068854_100411298 3300005578 Unclassified 1121
146 Ga0068854_101287765 3300005578 Unclassified 658
147 Ga0068856_100030081 3300005614 Bacteria 5308
148 Ga0068856_100365055 3300005614 Bacteria 1462
149 Ga0068856_100411354 3300005614 Unclassified 1372
150 Ga0068856_100623515 3300005614 Unclassified 1099
151 Ga0068856_101979531 3300005614 Bacteria 593
152 Ga0070702_100722101 3300005615 Bacteria 762
153 Ga0068852_100024689 3300005616 Bacteria 4862
154 Ga0068852_100171281 3300005616 Bacteria 2035
155 Ga0068852_100687395 3300005616 Bacteria 1033
156 Ga0068852_100789256 3300005616 Unclassified 963
157 Ga0068852_101197795 3300005616 Unclassified 780
158 Ga0068859_100008089 3300005617 Bacteria 10660
159 Ga0068859_102546433 3300005617 Bacteria 563
160 Ga0068864_100303318 3300005618 Bacteria 1496
161 Ga0068864_100309780 3300005618 Unclassified 1480
162 Ga0068864_100495394 3300005618 Bacteria 1175
163 Ga0068864_102063744 3300005618 Bacteria 576
164 Ga0068866_10033149 3300005718 Bacteria 2503
165 Ga0068866_10369373 3300005718 Bacteria 917
166 Ga0068866_10466439 3300005718 Bacteria 829
167 Ga0068861_100041206 3300005719 Unclassified 3458
168 Ga0068861_100835521 3300005719 Unclassified 867
169 Ga0068861_100916866 3300005719 Unclassified 831
170 Ga0068861_101374160 3300005719 Unclassified 689
171 Ga0068851_10027047 3300005834 Bacteria 2824
172 Ga0068851_10209842 3300005834 Bacteria 1090
173 Ga0068851_10495596 3300005834 Bacteria 732
174 Ga0068870_11306483 3300005840 Unclassified 529
175 Ga0068863_100111625 3300005841 Bacteria 2604
176 Ga0068863_100176520 3300005841 Unclassified 2050
177 Ga0068863_101071737 3300005841 Unclassified 810
178 Ga0068863_101381039 3300005841 Bacteria 712
179 Ga0068863_101852172 3300005841 Bacteria 613
180 Ga0068863_101951593 3300005841 Unclassified 597
181 Ga0068858_101139081 3300005842 Unclassified 766
182 Ga0068858_101771358 3300005842 Bacteria 610
183 Ga0068860_100080628 3300005843 Bacteria 3094
184 Ga0068860_101284531 3300005843 Unclassified 753
185 Ga0068862_100404521 3300005844 Unclassified 1278
186 Ga0068862_101020084 3300005844 Bacteria 819
187 Ga0081455_10558238 3300005937 Bacteria 755
188 Ga0070717_10103999 3300006028 Bacteria 2415
189 Ga0070717_10186747 3300006028 Bacteria 1809
190 Ga0070717_10271819 3300006028 Bacteria 1501
191 Ga0070717_10443907 3300006028 Unclassified 1169
192 Ga0070717_10495635 3300006028 Bacteria 1104
193 Ga0070717_10622516 3300006028 Unclassified 979
194 Ga0070717_11129713 3300006028 Unclassified 713
195 Ga0070717_11487003 3300006028 Unclassified 614
196 Ga0070715_10000761 3300006163 Bacteria 8721
197 Ga0070715_10435409 3300006163 Unclassified 737
198 Ga0070716_100012229 3300006173 Bacteria 4346
199 Ga0070716_100082162 3300006173 Unclassified 1926
200 Ga0070716_100427182 3300006173 Unclassified 960
201 Ga0070716_100452456 3300006173 Unclassified 936
202 Ga0070712_100000604 3300006175 Bacteria 21049
203 Ga0070712_100000656 3300006175 Bacteria 20382
204 Ga0070712_100010519 3300006175 Bacteria 5841
205 Ga0070712_100175788 3300006175 Bacteria 1665
206 Ga0070712_100246745 3300006175 Unclassified 1424
207 Ga0070712_100328959 3300006175 Bacteria 1245
208 Ga0097621_100008726 3300006237 Bacteria 7322
209 Ga0097621_100164821 3300006237 Bacteria 1907
210 Ga0097621_100182689 3300006237 Bacteria 1813
211 Ga0097621_100274499 3300006237 Unclassified 1482
212 Ga0097621_100391556 3300006237 Unclassified 1243
213 Ga0097621_100862953 3300006237 Unclassified 841
214 Ga0097621_102012356 3300006237 Bacteria 552
215 Ga0068871_100036508 3300006358 Bacteria 3913
216 Ga0068871_100099974 3300006358 Bacteria 2429
217 Ga0068871_101077609 3300006358 Unclassified 751
218 Ga0068871_101306258 3300006358 Unclassified 682
219 Ga0075428_100307165 3300006844 Bacteria 1705
220 Ga0075430_100278817 3300006846 Bacteria 1383
221 Ga0075431_100429899 3300006847 Bacteria 1319
222 Ga0075433_10101077 3300006852 Unclassified 2553
223 Ga0075433_10199107 3300006852 Bacteria 1781
224 Ga0075434_100123052 3300006871 Unclassified 2610
225 Ga0075434_100312322 3300006871 Bacteria 1592
226 Ga0075434_100661904 3300006871 Bacteria 1062
227 Ga0075434_101159151 3300006871 Bacteria 785
228 Ga0075429_100687708 3300006880 Bacteria 896
229 Ga0068865_100035902 3300006881 Bacteria 3338
230 Ga0075436_101027302 3300006914 Unclassified 619
231 Ga0075436_101114481 3300006914 Unclassified 594
232 Ga0097620_100008090 3300006931 Bacteria 10660
233 Ga0097620_102545637 3300006931 Bacteria 563
234 Ga0075435_100158048 3300007076 Unclassified 1908
235 Ga0075435_100498679 3300007076 Bacteria 1052
236 Ga0105240_10001937 3300009093 Bacteria 34329
237 Ga0105240_10111031 3300009093 Bacteria 3317
238 Ga0105240_10401206 3300009093 Bacteria 1544
239 Ga0111539_10067936 3300009094 Bacteria 4208
240 Ga0111539_10174901 3300009094 Unclassified 2508
241 Ga0111539_10257806 3300009094 Bacteria 2030
242 Ga0111539_11260359 3300009094 Bacteria 858
243 Ga0105245_10076069 3300009098 Unclassified 3057
244 Ga0105245_10134842 3300009098 Unclassified 2319
245 Ga0105247_10331755 3300009101 Unclassified 1064
246 Ga0114129_11089773 3300009147 Bacteria 1001
247 Ga0105242_10006515 3300009176 Bacteria 8989
248 Ga0105242_10521856 3300009176 Unclassified 1133
249 Ga0105242_10824051 3300009176 Bacteria 921
250 Ga0105242_11062825 3300009176 Unclassified 821
251 Ga0105242_11311123 3300009176 Bacteria 748
252 Ga0105248_10327581 3300009177 Bacteria 1725
253 Ga0105248_10666373 3300009177 Bacteria 1174
254 Ga0105248_10871846 3300009177 Bacteria 1016
255 Ga0105248_11897403 3300009177 Unclassified 676
256 Ga0105248_13279560 3300009177 Unclassified 515
257 Ga0105237_10204276 3300009545 Bacteria 1976
258 Ga0105237_10274668 3300009545 Bacteria 1688
259 Ga0105237_11362078 3300009545 Unclassified 716
260 Ga0105237_11797312 3300009545 Bacteria 620
261 Ga0105238_10044921 3300009551 Unclassified 4465
262 Ga0105238_10098676 3300009551 Bacteria 2905
263 Ga0105238_10113717 3300009551 Bacteria 2686
264 Ga0105238_10272404 3300009551 Unclassified 1673
265 Ga0105238_11215822 3300009551 Bacteria 778
266 Ga0099796_10047901 3300010159 Bacteria 1472
267 Ga0105239_11401461 3300010375 Bacteria 807
268 Ga0105246_11112703 3300011119 Bacteria 722
269 Ga0105246_11489334 3300011119 Bacteria 635
270 Ga0157373_10654506 3300013100 Bacteria 767
271 Ga0157371_10041099 3300013102 Bacteria 3301
272 Ga0157371_11579473 3300013102 Unclassified 513
273 Ga0157370_11887189 3300013104 Unclassified 536
274 Ga0157369_10039378 3300013105 Bacteria 5166
275 Ga0157369_10088976 3300013105 Bacteria 3296
276 Ga0157369_10168561 3300013105 Bacteria 2308
277 Ga0157369_10193349 3300013105 Unclassified 2137
278 Ga0157369_10231771 3300013105 Unclassified 1930
279 Ga0157369_10392086 3300013105 Unclassified 1441
280 Ga0157369_10413377 3300013105 Bacteria 1399
281 Ga0157374_10162980 3300013296 Bacteria 2172
282 Ga0157374_10254856 3300013296 Bacteria 1727
283 Ga0157378_10007904 3300013297 Bacteria 9278
284 Ga0163162_10160730 3300013306 Bacteria 2368
285 Ga0163162_10363310 3300013306 Bacteria 1581
286 Ga0163162_11010581 3300013306 Unclassified 940
287 Ga0163162_11090162 3300013306 Unclassified 905
288 Ga0163162_11924217 3300013306 Unclassified 677
289 Ga0163162_11963275 3300013306 Unclassified 670
290 Ga0157372_10145825 3300013307 Bacteria 2730
291 Ga0157372_11205043 3300013307 Bacteria 875
292 Ga0157372_11471073 3300013307 Unclassified 785
293 Ga0157372_11527792 3300013307 Bacteria 769
294 Ga0157372_12512821 3300013307 Bacteria 591
295 Ga0157375_10001330 3300013308 Bacteria 21300
296 Ga0157375_10287525 3300013308 Bacteria 1807
297 Ga0157375_12887891 3300013308 Unclassified 574
298 Ga0163163_10104537 3300014325 Bacteria 2857
299 Ga0163163_10179028 3300014325 Bacteria 2167
300 Ga0163163_11508738 3300014325 Bacteria 733
301 Ga0157380_10498305 3300014326 Bacteria 1182
302 Ga0157380_11509279 3300014326 Bacteria 725
303 Ga0157380_11802453 3300014326 Unclassified 671
304 Ga0182008_10019118 3300014497 Bacteria 3540
305 Ga0157377_11774039 3300014745 Bacteria 500
306 Ga0157376_10160561 3300014969 Bacteria 2037
307 Ga0157376_10320941 3300014969 Bacteria 1472
308 Ga0157376_10455826 3300014969 Bacteria 1248
309 Ga0157376_10623134 3300014969 Bacteria 1076
310 Ga0157376_10924016 3300014969 Bacteria 892
311 Ga0157376_13087861 3300014969 Unclassified 504
312 Ga0213876_10001762 3300021384 Bacteria 13117
313 Ga0207697_10058062 3300025315 Bacteria 1607
314 Ga0207656_10125948 3300025321 Unclassified 1196
315 Ga0207682_10139941 3300025893 Bacteria 1086
316 Ga0207692_10222875 3300025898 Bacteria 1119
317 Ga0207692_10300291 3300025898 Unclassified 977
318 Ga0207642_10684176 3300025899 Bacteria 645
319 Ga0207642_10739955 3300025899 Bacteria 622
320 Ga0207688_10295959 3300025901 Bacteria 989
321 Ga0207680_10000609 3300025903 Bacteria 16895
322 Ga0207685_10003338 3300025905 Unclassified 3890
323 Ga0207685_10121124 3300025905 Unclassified 1149
324 Ga0207699_10026055 3300025906 Bacteria 3218
325 Ga0207699_10072295 3300025906 Bacteria 2112
326 Ga0207699_10239783 3300025906 Bacteria 1245
327 Ga0207699_10276971 3300025906 Bacteria 1164
328 Ga0207699_11223158 3300025906 Bacteria 556
329 Ga0207645_10014171 3300025907 Bacteria 5340
330 Ga0207705_10016699 3300025909 Bacteria 5257
331 Ga0207684_10000528 3300025910 Bacteria 47296
332 Ga0207654_10130987 3300025911 Unclassified 1587
333 Ga0207654_10201401 3300025911 Bacteria 1311
334 Ga0207707_10126866 3300025912 Bacteria 2232
335 Ga0207695_10013005 3300025913 Bacteria 9943
336 Ga0207695_10106124 3300025913 Bacteria 2795
337 Ga0207695_10389132 3300025913 Bacteria 1279
338 Ga0207695_10912225 3300025913 Bacteria 758
339 Ga0207671_10305728 3300025914 Unclassified 1257
340 Ga0207671_10394674 3300025914 Bacteria 1100
341 Ga0207693_10007491 3300025915 Bacteria 8972
342 Ga0207693_10011008 3300025915 Bacteria 7332
343 Ga0207693_10052551 3300025915 Bacteria 3196
344 Ga0207693_11159596 3300025915 Bacteria 584
345 Ga0207663_10001737 3300025916 Bacteria 10238
346 Ga0207663_10001826 3300025916 Bacteria 10039
347 Ga0207663_10891167 3300025916 Unclassified 711
348 Ga0207663_11139553 3300025916 Bacteria 627
349 Ga0207660_10213310 3300025917 Bacteria 1512
350 Ga0207660_10473280 3300025917 Unclassified 1015
351 Ga0207662_11376025 3300025918 Bacteria 501
352 Ga0207657_10011894 3300025919 Bacteria 8612
353 Ga0207657_10314326 3300025919 Bacteria 1239
354 Ga0207657_11353111 3300025919 Unclassified 536
355 Ga0207652_10087355 3300025921 Bacteria 2734
356 Ga0207652_11033488 3300025921 Bacteria 721
357 Ga0207646_10016078 3300025922 Bacteria 7030
358 Ga0207681_10261797 3300025923 Bacteria 1354
359 Ga0207694_10025935 3300025924 Bacteria 4456
360 Ga0207694_10027967 3300025924 Bacteria 4298
361 Ga0207694_10086678 3300025924 Bacteria 2466
362 Ga0207659_10007363 3300025926 Bacteria 6764
363 Ga0207687_10213044 3300025927 Unclassified 1517
364 Ga0207700_10032132 3300025928 Bacteria 3740
365 Ga0207700_10051864 3300025928 Bacteria 3064
366 Ga0207700_10261224 3300025928 Bacteria 1483
367 Ga0207700_10386688 3300025928 Bacteria 1224
368 Ga0207700_10434385 3300025928 Bacteria 1155
369 Ga0207700_10563441 3300025928 Unclassified 1012
370 Ga0207700_10829656 3300025928 Bacteria 827
371 Ga0207664_10359202 3300025929 Unclassified 1290
372 Ga0207664_10421343 3300025929 Bacteria 1189
373 Ga0207644_10118850 3300025931 Unclassified 2009
374 Ga0207690_10905490 3300025932 Bacteria 732
375 Ga0207690_10934927 3300025932 Bacteria 720
376 Ga0207706_10003901 3300025933 Bacteria 14155
377 Ga0207706_10059749 3300025933 Bacteria 3357
378 Ga0207686_10367787 3300025934 Bacteria 1087
379 Ga0207709_10331224 3300025935 Bacteria 1143
380 Ga0207670_10042199 3300025936 Bacteria 3004
381 Ga0207670_10203798 3300025936 Unclassified 1504
382 Ga0207669_10061568 3300025937 Bacteria 2307
383 Ga0207669_10345029 3300025937 Bacteria 1148
384 Ga0207704_10101939 3300025938 Bacteria 1916
385 Ga0207704_11773336 3300025938 Unclassified 531
386 Ga0207665_10023922 3300025939 Bacteria 4024
387 Ga0207665_10036240 3300025939 Unclassified 3279
388 Ga0207691_10000015 3300025940 Bacteria 142014
389 Ga0207711_10361069 3300025941 Bacteria 1346
390 Ga0207711_10480561 3300025941 Unclassified 1157
391 Ga0207689_10550359 3300025942 Bacteria 969
392 Ga0207661_10053608 3300025944 Bacteria 3228
393 Ga0207661_10471210 3300025944 Unclassified 1145
394 Ga0207661_11001302 3300025944 Bacteria 770
395 Ga0207661_11342706 3300025944 Unclassified 656
396 Ga0207661_11415282 3300025944 Unclassified 638
397 Ga0207679_10048332 3300025945 Bacteria 3096
398 Ga0207679_11326920 3300025945 Unclassified 660
399 Ga0207679_11569255 3300025945 Bacteria 603
400 Ga0207667_10041502 3300025949 Bacteria 4893
401 Ga0207667_10442264 3300025949 Bacteria 1322
402 Ga0207667_11015779 3300025949 Bacteria 816
403 Ga0207651_10000145 3300025960 Bacteria 31036
404 Ga0207651_10135582 3300025960 Bacteria 1893
405 Ga0207651_10996138 3300025960 Bacteria 749
406 Ga0207651_11636456 3300025960 Bacteria 580
407 Ga0207668_10250274 3300025972 Unclassified 1439
408 Ga0207668_10575790 3300025972 Bacteria 978
409 Ga0207668_10736252 3300025972 Bacteria 869
410 Ga0207640_10772276 3300025981 Unclassified 830
411 Ga0207640_11649067 3300025981 Unclassified 578
412 Ga0207658_10418251 3300025986 Bacteria 1181
413 Ga0207658_11136931 3300025986 Bacteria 714
414 Ga0207677_10571251 3300026023 Bacteria 988
415 Ga0207703_10668729 3300026035 Bacteria 986
416 Ga0207703_11331010 3300026035 Bacteria 691
417 Ga0207639_10028765 3300026041 Bacteria 4061
418 Ga0207639_10085079 3300026041 Unclassified 2514
419 Ga0207639_10898407 3300026041 Unclassified 828
420 Ga0207678_11672955 3300026067 Bacteria 559
421 Ga0207702_10292499 3300026078 Bacteria 1543
422 Ga0207702_10739882 3300026078 Unclassified 970
423 Ga0207702_10744899 3300026078 Unclassified 967
424 Ga0207702_12305087 3300026078 Unclassified 526
425 Ga0207641_10131961 3300026088 Unclassified 2244
426 Ga0207641_11825502 3300026088 Unclassified 610
427 Ga0207641_12007439 3300026088 Unclassified 580
428 Ga0207676_10283126 3300026095 Unclassified 1506
429 Ga0207676_10332767 3300026095 Unclassified 1398
430 Ga0207676_11570016 3300026095 Bacteria 656
431 Ga0207674_10108951 3300026116 Unclassified 2746
432 Ga0207674_10693789 3300026116 Viruses 983
433 Ga0207674_11030523 3300026116 Unclassified 792
434 Ga0207675_100120550 3300026118 Bacteria 2481
435 Ga0207675_100269722 3300026118 Bacteria 1651
436 Ga0207675_100392006 3300026118 Bacteria 1367
437 Ga0207675_101580700 3300026118 Bacteria 676
438 Ga0207675_102058641 3300026118 Unclassified 588
439 Ga0207683_10000241 3300026121 Bacteria 48819
440 Ga0207683_10380575 3300026121 Bacteria 1297
441 Ga0207683_10568798 3300026121 Bacteria 1048
442 Ga0207698_10411495 3300026142 Bacteria 1295
443 Ga0207698_10580678 3300026142 Unclassified 1102
444 Ga0207698_10609643 3300026142 Bacteria 1077
445 Ga0207428_10012039 3300027907 Bacteria 7612
446 Ga0207428_10397101 3300027907 Bacteria 1010
447 Ga0207428_11200901 3300027907 Bacteria 528
448 Ga0268266_10011940 3300028379 Bacteria 7521
449 Ga0268266_11394091 3300028379 Unclassified 676
450 Ga0268264_10076243 3300028381 Unclassified 2852
451 Ga0268264_11174289 3300028381 Bacteria 777
452 Ga0265318_10058804 3300028577 Bacteria 1434
453 Ga0265336_10035422 3300028666 Bacteria 1539
454 Ga0265338_10159515 3300028800 Bacteria 1743
455 Ga0265338_10211239 3300028800 Bacteria 1456
456 Ga0265338_10271871 3300028800 Bacteria 1242
457 Ga0265760_10164723 3300031090 Unclassified 733
458 Ga0265330_10002559 3300031235 Bacteria 9883
459 Ga0265330_10013945 3300031235 Bacteria 3736
460 Ga0265330_10302068 3300031235 Bacteria 675
461 Ga0265332_10000034 3300031238 Bacteria 140429
462 Ga0265332_10067697 3300031238 Unclassified 1522
463 Ga0265328_10000714 3300031239 Bacteria 15386
464 Ga0265328_10005359 3300031239 Bacteria 5495
465 Ga0265320_10074711 3300031240 Bacteria 1591
466 Ga0265325_10036951 3300031241 Bacteria 2584
467 Ga0265325_10457233 3300031241 Bacteria 556
468 Ga0265329_10004001 3300031242 Bacteria 6280
469 Ga0265329_10005451 3300031242 Bacteria 5141
470 Ga0265329_10006349 3300031242 Unclassified 4693
471 Ga0265340_10097042 3300031247 Bacteria 1373
472 Ga0265339_10062745 3300031249 Bacteria 1997
473 Ga0265331_10000052 3300031250 Bacteria 180662
474 Ga0265331_10222236 3300031250 Bacteria 849
475 Ga0265316_10000027 3300031344 Bacteria 164765
476 Ga0265316_10040156 3300031344 Bacteria 3753
477 Ga0265316_10089422 3300031344 Bacteria 2350
478 Ga0265316_10130014 3300031344 Unclassified 1897
479 Ga0307509_10121554 3300031507 Bacteria 2588
480 Ga0265313_10189313 3300031595 Bacteria 861
481 Ga0316575_10133618 3300031665 Unclassified 1019
482 Ga0265314_10000118 3300031711 Bacteria 122891
483 Ga0265314_10000230 3300031711 Bacteria 83421
484 Ga0265314_10105961 3300031711 Bacteria 1797
485 Ga0265314_10519235 3300031711 Bacteria 624
486 Ga0265342_10011500 3300031712 Bacteria 6055
487 Ga0265342_10196037 3300031712 Unclassified 1100
488 Ga0307407_10485926 3300031903 Bacteria 903
489 Ga0307412_11006009 3300031911 Bacteria 737
490 Ga0307409_102008041 3300031995 Bacteria 608
491 Ga0307416_100653895 3300032002 Bacteria 1136
492 Ga0307416_102283769 3300032002 Unclassified 642
493 Ga0373938_0171762 3300034957 Unclassified 587
494 Ga0373923_0340740 3300035111 Bacteria 715
495 Ga0373953_0279359 3300035117 Bacteria 727
496 Ga0373954_0021386 3300035118 Bacteria 2929
497 Ga0373954_0380426 3300035118 Bacteria 698
498 Ga0373954_0527433 3300035118 Unclassified 585
499 Ga0373956_0024038 3300035119 Bacteria 2620
500 Ga0373956_0395211 3300035119 Bacteria 659
501 Ga0373956_0570281 3300035119 Bacteria 540
502 Ga0373957_0077493 3300035120 Bacteria 1308
503 Ga0373943_0061522 3300035170 Bacteria 1877
504 Ga0373946_0013268 3300035171 Bacteria 3095
505 Ga0373946_0571072 3300035171 Bacteria 585
506 Ga0373955_0144389 3300035172 Bacteria 1397
507 Ga0373924_0004041 3300035410 Bacteria 5099
508 Ga0373924_0239514 3300035410 Bacteria 802
509 Ga0373935_0042951 3300035692 Bacteria 2844
510 Ga0373935_0075105 3300035692 Bacteria 2186
511 Ga0373935_1208366 3300035692 Unclassified 564
512 Ga0373927_0650682 3300035695 Bacteria 696
513 Ga0373927_0703828 3300035695 Bacteria 667
514 Ga0373933_0048908 3300035724 Bacteria 2519
515 Ga0373933_0280010 3300035724 Bacteria 1078
516 Ga0373933_0315328 3300035724 Bacteria 1013
517 Ga0373933_0851671 3300035724 Unclassified 600
518 Ga0373947_0007532 3300035725 Bacteria 6298
519 Ga0373947_0374668 3300035725 Bacteria 957
520 Ga0373937_0000027 3300036401 Bacteria 123975
521 Ga0373937_0106506 3300036401 Bacteria 2606
522 Ga0373937_0115071 3300036401 Bacteria 2504
523 Ga0373937_0275087 3300036401 Bacteria 1589
524 Ga0373937_0506485 3300036401 Bacteria 1147
525 Ga0373937_1238348 3300036401 Bacteria 694
526 Ga0373937_2065139 3300036401 Bacteria 516
527 Ga0316584_0222409 3300036712 Bacteria 1386
528 Ga0373925_0000268 3300037068 Bacteria 54347
529 Ga0373925_0049264 3300037068 Bacteria 3139
530 Ga0373925_0061531 3300037068 Bacteria 2820
531 Ga0373925_0330379 3300037068 Bacteria 1235
532 Ga0373925_0428973 3300037068 Bacteria 1081
533 Ga0395899_0268229 3300037312 Bacteria 1165
534 Ga0395900_0070707 3300037418 Bacteria 3588
535 Ga0395898_0242219 3300037466 Bacteria 1720
536 Ga0395898_1779917 3300037466 Unclassified 537
537 Ga0395905_0003641 3300037471 Bacteria 16369
538 Ga0395905_0356682 3300037471 Bacteria 1355
539 Ga0395905_0566762 3300037471 Bacteria 1037
540 Ga0436364_0877093 3300037853 Bacteria 3386
541 Ga0395901_0038574 3300038443 Bacteria 4942
542 Ga0436365_0175425 3300039437 Bacteria 8028
543 Ga0436365_1113729 3300039437 Bacteria 2842
544 Ga0436360_0808792 3300039438 Unclassified 944
545 Ga0436362_0781830 3300039453 Bacteria 1237
546 Ga0436362_1105140 3300039453 Bacteria 745
547 Ga0451800_0920910 3300041459 Bacteria 702
548 Ga0451841_1301703 3300041498 Bacteria 871
549 Ga0450896_030422 3300042133 Bacteria 816
550 Ga0451577_0384518 3300042876 Bacteria 1274
551 Ga0453683_0705755 3300044673 Unclassified 661
552 Ga0466963_0411875 3300044694 Bacteria 953
553 Ga0466964_0806126 3300044706 Bacteria 531
554 Ga0453684_0020798 3300044712 Bacteria 9862
555 Ga0453684_0054262 3300044712 Bacteria 5222
556 Ga0453684_1214252 3300044712 Bacteria 791
557 Ga0466971_0191832 3300044719 Bacteria 963
558 Ga0466957_0099400 3300044842 Bacteria 1832
559 Ga0466960_0188390 3300044901 Bacteria 1122
560 Ga0451576_0070347 3300045051 Bacteria 3642
561 Ga0451576_1149827 3300045051 Unclassified 811
562 Ga0466967_0353557 3300045976 Bacteria 1423
563 Ga0466967_0553407 3300045976 Bacteria 1132
564 Ga0466967_1935490 3300045976 Bacteria 586
565 Ga0495592_0070014 3300046454 Bacteria 2557
566 Ga0495592_0233376 3300046454 Unclassified 1224
567 Ga0495603_0238843 3300046455 Unclassified 1047
568 Ga0495629_0667797 3300046459 Unclassified 692
569 Ga0495651_0029937 3300046462 Unclassified 4245
570 Ga0495651_0761337 3300046462 Unclassified 600
571 Ga0495653_0121089 3300046463 Bacteria 1865
572 Ga0495580_0004172 3300046472 Bacteria 12155
573 Ga0495580_0005613 3300046472 Bacteria 10332
574 Ga0495580_0024317 3300046472 Bacteria 4438
575 Ga0495580_0245834 3300046472 Unclassified 1226
576 Ga0495580_0880787 3300046472 Unclassified 576
577 Ga0495582_0026310 3300046473 Unclassified 3189
578 Ga0495582_0539064 3300046473 Bacteria 675
579 Ga0495639_0630840 3300046475 Unclassified 552
580 Ga0495639_0706013 3300046475 Bacteria 521
581 Ga0495662_0061838 3300046476 Bacteria 1809
582 Ga0495664_0012989 3300046477 Unclassified 4720
583 Ga0495608_0071594 3300046511 Unclassified 2262
584 Ga0495608_0173238 3300046511 Bacteria 1368
585 Ga0495608_0369313 3300046511 Unclassified 881
586 Ga0495618_0082931 3300046514 Bacteria 2048
587 Ga0495628_0054698 3300046516 Unclassified 3146
588 Ga0495628_0094666 3300046516 Bacteria 2308
589 Ga0495628_0225077 3300046516 Bacteria 1408
590 Ga0495630_0003548 3300046517 Bacteria 10864
591 Ga0495630_0052386 3300046517 Bacteria 3055
592 Ga0495630_0159211 3300046517 Bacteria 1719
593 Ga0495666_0158404 3300046526 Bacteria 1051
594 Ga0495666_0166435 3300046526 Bacteria 1021
595 Ga0495652_0227038 3300046529 Bacteria 1399
596 Ga0495665_0110086 3300046531 Bacteria 1445
597 Ga0495640_0075403 3300046533 Bacteria 2253
598 Ga0495586_0743701 3300046535 Bacteria 566
599 Ga0495587_0038047 3300046536 Bacteria 2886
600 Ga0495587_0365840 3300046536 Bacteria 803
601 Ga0495587_0476366 3300046536 Unclassified 691
602 Ga0495667_0046633 3300046559 Unclassified 2865
603 Ga0495667_0049452 3300046559 Bacteria 2776
604 Ga0495656_0167331 3300046615 Bacteria 1072
605 Ga0495634_0027780 3300046642 Bacteria 3934
606 Ga0495635_0117089 3300046663 Bacteria 1818
607 Ga0495635_1075774 3300046663 Bacteria 510
608 Ga0495657_0094592 3300046675 Bacteria 1911
609 Ga0495657_0201774 3300046675 Bacteria 1212
610 Ga0495657_0766667 3300046675 Bacteria 552
611 Ga0495599_0001056 3300046678 Bacteria 15485
612 Ga0495599_0024713 3300046678 Unclassified 3757
613 Ga0495599_0237934 3300046678 Bacteria 1111
614 Ga0495599_0660341 3300046678 Unclassified 605
615 Ga0495623_0008691 3300046679 Bacteria 6593
616 Ga0495623_0020491 3300046679 Bacteria 4274
617 Ga0495646_0047813 3300046680 Bacteria 2602
618 Ga0495658_0494111 3300046683 Bacteria 783
619 Ga0495669_0277354 3300046684 Bacteria 806
620 Ga0495613_0009556 3300046689 Bacteria 7202
621 Ga0495613_0036690 3300046689 Bacteria 3635
622 Ga0495624_0122775 3300046690 Bacteria 1595
623 Ga0495600_0722357 3300046809 Bacteria 598
624 Ga0495600_0892084 3300046809 Unclassified 525
625 Ga0495581_0464248 3300047315 Bacteria 737
626 Ga0495674_0085089 3300047319 Bacteria 2709
627 Ga0495674_0111853 3300047319 Bacteria 2314
628 Ga0495674_0553659 3300047319 Unclassified 915
629 Ga0495674_0632667 3300047319 Bacteria 845
630 Ga0495680_0035164 3300047322 Unclassified 4038
631 Ga0495684_0005508 3300047471 Bacteria 9857
632 Ga0495684_0014567 3300047471 Bacteria 6051
633 Ga0495684_0483411 3300047471 Unclassified 855
634 Ga0495684_0574709 3300047471 Bacteria 764
635 Ga0495684_0576786 3300047471 Bacteria 762
636 Ga0495684_0601453 3300047471 Bacteria 742
637 Ga0495684_0871071 3300047471 Bacteria 583
638 Ga0495593_0215795 3300047673 Bacteria 963
639 Ga0495602_0025195 3300048088 Bacteria 5759
640 Ga0496100_0249250 3300048903 Bacteria 1313
641 Ga0496101_0209361 3300048904 Bacteria 1510
642 Ga0496102_0511374 3300048905 Unclassified 1123
643 Ga0496102_1614416 3300048905 Bacteria 567
644 Ga0496102_1629012 3300048905 Bacteria 564
645 Ga0496104_0027233 3300048907 Bacteria 5290
646 Ga0496104_0309540 3300048907 Bacteria 1492
647 Ga0496104_0372825 3300048907 Bacteria 1340
648 Ga0496105_0003500 3300048908 Bacteria 11630
649 Ga0496105_0087042 3300048908 Bacteria 2582
650 Ga0496106_0093250 3300048909 Bacteria 2327
651 Ga0496106_0541746 3300048909 Bacteria 934
652 Ga0496107_0568720 3300048910 Bacteria 839
653 Ga0496107_0802014 3300048910 Bacteria 689
654 Ga0496108_0164007 3300048911 Bacteria 1921
655 Ga0496108_0267336 3300048911 Bacteria 1488
656 Ga0496108_0922918 3300048911 Bacteria 749
657 Ga0496109_0016746 3300048912 Bacteria 6414
658 Ga0496109_0076208 3300048912 Bacteria 3085
659 Ga0496109_0557494 3300048912 Bacteria 1081
660 Ga0496109_1044450 3300048912 Bacteria 754
661 Ga0496109_1391665 3300048912 Unclassified 637
662 Ga0496110_0150837 3300048913 Bacteria 2105
663 Ga0496110_0218495 3300048913 Bacteria 1733
664 Ga0496110_0245999 3300048913 Bacteria 1628
665 Ga0496111_0755110 3300048914 Bacteria 705
666 Ga0496112_0269421 3300048915 Unclassified 1651
667 Ga0496112_0552203 3300048915 Bacteria 1085
668 Ga0496112_1275917 3300048915 Bacteria 650
669 Ga0496113_0353562 3300048916 Bacteria 1179
670 Ga0496113_0659975 3300048916 Bacteria 836
671 Ga0496113_1044034 3300048916 Unclassified 642
672 Ga0496114_0016840 3300048917 Bacteria 5894
673 Ga0496114_0045032 3300048917 Bacteria 3663
674 Ga0496114_1702104 3300048917 Unclassified 519
675 Ga0496115_0179270 3300048918 Bacteria 1752
676 Ga0496115_0255886 3300048918 Bacteria 1441
677 Ga0496115_0502744 3300048918 Bacteria 974
678 Ga0501296_023169 3300049519 Bacteria 803
679 Ga0501031_0401803 3300049568 Bacteria 886
680 Ga0501033_0454930 3300049570 Bacteria 889
681 Ga0501047_0662102 3300049581 Bacteria 863
682 Ga0501075_1321972 3300049591 Bacteria 546
683 Ga0501083_0635204 3300049744 Bacteria 694
684 Ga0501035_0082505 3300049822 Bacteria 2837
685 nmdc:mga0k408_473976_c1 3300050493 Bacteria 742
686 nmdc:mga09592_1485435_c1 3300050508 Bacteria 552
687 nmdc:mga06r32_492845_c1 3300050510 Bacteria 1203
688 nmdc:mga08y16_15383_c1 3300050511 Bacteria 8046
689 nmdc:mga08y16_2186_c1 3300050511 Bacteria 20060
690 nmdc:mga08y16_256041_c1 3300050511 Bacteria 1808
691 nmdc:mga08y16_627800_c1 3300050511 Bacteria 1081
692 nmdc:mga08y16_714594_c1 3300050511 Unclassified 1001
693 nmdc:mga08y16_878281_c1 3300050511 Unclassified 884
694 nmdc:mga0n895_120924_c1 3300050512 Bacteria 2640
695 nmdc:mga0n895_1362221_c1 3300050512 Bacteria 679
696 nmdc:mga0n895_148365_c1 3300050512 Bacteria 1215
697 nmdc:mga0n895_149297_c1 3300050512 Unclassified 2367
698 nmdc:mga0n895_422373_c1 3300050512 Bacteria 1347
699 nmdc:mga0rr50_176020_c1 3300050513 Bacteria 1746
700 nmdc:mga0rr50_560133_c1 3300050513 Bacteria 973
701 nmdc:mga08x19_718024_c1 3300050514 Unclassified 709
702 nmdc:mga0a205_177039_c1 3300050515 Unclassified 2028
703 nmdc:mga0a205_208529_c1 3300050515 Bacteria 1843
704 Ga0495601_0032218 3300053077 Unclassified 3262
705 Ga0495601_0771065 3300053077 Bacteria 611
706 Ga0495619_0164853 3300053085 Unclassified 1531
707 Ga0500646_0348897 3300053090 Bacteria 539
708 Ga0587073_0019227 3300059492 Unclassified 1287
709 Ga0587122_003144 3300059628 Unclassified 1251
710 Ga0530510_0245134 3300061734 Bacteria 1335
711 Ga0530510_0572094 3300061734 Bacteria 859
712 Ga0070671_100116159
713 JGI25407J50210_10003243
714 Ga0065714_10127495
715 Ga0065712_10087744
716 Ga0065715_10176525
717 Ga0065715_10201003
718 Ga0070658_10508600
719 Ga0070676_10007960
720 Ga0070683_100708328
721 Ga0070683_100781284
722 Ga0070683_101012293
723 Ga0070683_101754413
724 Ga0070683_101953604
725 Ga0070690_100011622
726 Ga0070690_100335967
727 Ga0070690_100496360
728 Ga0070670_100243748
729 Ga0070677_10175705
730 Ga0068869_100029581
731 Ga0068869_102080226
732 Ga0070666_10004954
733 Ga0070680_100153569
734 Ga0070680_101688074
735 Ga0070682_100272265
736 Ga0068868_100003031
737 Ga0068868_100753814
738 Ga0068868_101626764
739 Ga0070660_100134505
740 Ga0070660_100880036
741 Ga0070689_100035731
742 Ga0070689_100048146
743 Ga0070689_100113864
744 Ga0070689_100425319
745 Ga0070689_100914762
746 Ga0070689_101339850
747 Ga0070687_100049730
748 Ga0070687_101025958
749 Ga0070687_101497210
750 Ga0070661_100256227
751 Ga0070668_100072976
752 Ga0070668_100250607
753 Ga0070675_100002091
754 Ga0070675_100383811
755 Ga0070675_100508929
756 Ga0070675_100586595
757 Ga0070671_100014097
758 Ga0070671_100063816
759 Ga0070671_100514247
760 Ga0070674_100082050
761 Ga0070674_101179634
762 Ga0070673_100001866
763 Ga0070673_100041483
764 Ga0070673_100217490
765 Ga0070688_100170633
766 Ga0070688_100788901
767 Ga0070659_100520134
768 Ga0070659_101032523
769 Ga0070667_100098908
770 Ga0070667_100628465
771 Ga0070667_100697503
772 Ga0070709_10046062
773 Ga0070709_10651359
774 Ga0070714_100023943
775 Ga0070714_100199606
776 Ga0070713_100003040
777 Ga0070713_100092067
778 Ga0070713_100178128
779 Ga0070713_100453573
780 Ga0070713_100598308
781 Ga0070713_100628758
782 Ga0070713_101494741
783 Ga0070713_101830138
784 Ga0070710_10165778
785 Ga0070710_10207399
786 Ga0070710_10305220
787 Ga0070710_10307434
788 Ga0070710_11027100
789 Ga0070710_11190322
790 Ga0070701_10225746
791 Ga0070711_100001779
792 Ga0070711_100619902
793 Ga0070711_101208103
794 Ga0070711_101317362
795 Ga0070700_100000309
796 Ga0070700_100316924
797 Ga0070694_100531154
798 Ga0070708_100037419
799 Ga0070708_101280672
800 Ga0070663_100104475
801 Ga0070678_100001833
802 Ga0070678_100724985
803 Ga0070678_101512418
804 Ga0070662_100015483
805 Ga0070662_100022845
806 Ga0070662_100497717
807 Ga0068867_100848210
808 Ga0070685_10020979
809 Ga0070685_10522199
810 Ga0070706_100033932
811 Ga0070707_100009561
812 Ga0070698_100125179
813 Ga0070698_100301120
814 Ga0070699_100021961
815 Ga0070699_100031198
816 Ga0070699_100559245
817 Ga0070679_100482898
818 Ga0070679_100764100
819 Ga0070684_100082902
820 Ga0070684_100113133
821 Ga0070684_100428258
822 Ga0070684_100753184
823 Ga0070684_101282672
824 Ga0070684_101469175
825 Ga0070697_100013622
826 Ga0070697_101716396
827 Ga0068853_100005285
828 Ga0068853_100197530
829 Ga0068853_100361731
830 Ga0068853_100980966
831 Ga0068853_101224295
832 Ga0070672_100898660
833 Ga0070672_101067584
834 Ga0070686_100021749
835 Ga0070686_101041123
836 Ga0070696_100086722
837 Ga0070696_100606446
838 Ga0070693_100028785
839 Ga0070693_100371817
840 Ga0070665_100142704
841 Ga0070704_101549668
842 Ga0070704_101797891
843 Ga0068855_100012208
844 Ga0068855_100034416
845 Ga0068855_100127976
846 Ga0068855_101866771
847 Ga0068855_101953980
848 Ga0070664_100035862
849 Ga0070664_100273307
850 Ga0068857_100641328
851 Ga0068857_100658559
852 Ga0068857_100861002
853 Ga0068857_100995995
854 Ga0068857_101180042
855 Ga0068854_100106422
856 Ga0068854_100411298
857 Ga0068854_101287765
858 Ga0068856_100030081
859 Ga0068856_100365055
860 Ga0068856_100411354
861 Ga0068856_100623515
862 Ga0068856_101979531
863 Ga0070702_100722101
864 Ga0068852_100024689
865 Ga0068852_100171281
866 Ga0068852_100687395
867 Ga0068852_100789256
868 Ga0068852_101197795
869 Ga0068859_100008089
870 Ga0068859_102546433
871 Ga0068864_100303318
872 Ga0068864_100309780
873 Ga0068864_100495394
874 Ga0068864_102063744
875 Ga0068866_10033149
876 Ga0068866_10369373
877 Ga0068866_10466439
878 Ga0068861_100041206
879 Ga0068861_100835521
880 Ga0068861_100916866
881 Ga0068861_101374160
882 Ga0068851_10027047
883 Ga0068851_10209842
884 Ga0068851_10495596
885 Ga0068870_11306483
886 Ga0068863_100111625
887 Ga0068863_100176520
888 Ga0068863_101071737
889 Ga0068863_101381039
890 Ga0068863_101852172
891 Ga0068863_101951593
892 Ga0068858_101139081
893 Ga0068858_101771358
894 Ga0068860_100080628
895 Ga0068860_101284531
896 Ga0068862_100404521
897 Ga0068862_101020084
898 Ga0081455_10558238
899 Ga0070717_10103999
900 Ga0070717_10186747
901 Ga0070717_10271819
902 Ga0070717_10443907
903 Ga0070717_10495635
904 Ga0070717_10622516
905 Ga0070717_11129713
906 Ga0070717_11487003
907 Ga0070715_10000761
908 Ga0070715_10435409
909 Ga0070716_100012229
910 Ga0070716_100082162
911 Ga0070716_100427182
912 Ga0070716_100452456
913 Ga0070712_100000604
914 Ga0070712_100000656
915 Ga0070712_100010519
916 Ga0070712_100175788
917 Ga0070712_100246745
918 Ga0070712_100328959
919 Ga0097621_100008726
920 Ga0097621_100164821
921 Ga0097621_100182689
922 Ga0097621_100274499
923 Ga0097621_100391556
924 Ga0097621_100862953
925 Ga0097621_102012356
926 Ga0068871_100036508
927 Ga0068871_100099974
928 Ga0068871_101077609
929 Ga0068871_101306258
930 Ga0075428_100307165
931 Ga0075430_100278817
932 Ga0075431_100429899
933 Ga0075433_10101077
934 Ga0075433_10199107
935 Ga0075434_100123052
936 Ga0075434_100312322
937 Ga0075434_100661904
938 Ga0075434_101159151
939 Ga0075429_100687708
940 Ga0068865_100035902
941 Ga0075436_101027302
942 Ga0075436_101114481
943 Ga0097620_100008090
944 Ga0097620_102545637
945 Ga0075435_100158048
946 Ga0075435_100498679
947 Ga0105240_10001937
948 Ga0105240_10111031
949 Ga0105240_10401206
950 Ga0111539_10067936
951 Ga0111539_10174901
952 Ga0111539_10257806
953 Ga0111539_11260359
954 Ga0105245_10076069
955 Ga0105245_10134842
956 Ga0105247_10331755
957 Ga0114129_11089773
958 Ga0105242_10006515
959 Ga0105242_10521856
960 Ga0105242_10824051
961 Ga0105242_11062825
962 Ga0105242_11311123
963 Ga0105248_10327581
964 Ga0105248_10666373
965 Ga0105248_10871846
966 Ga0105248_11897403
967 Ga0105248_13279560
968 Ga0105237_10204276
969 Ga0105237_10274668
970 Ga0105237_11362078
971 Ga0105237_11797312
972 Ga0105238_10044921
973 Ga0105238_10098676
974 Ga0105238_10113717
975 Ga0105238_10272404
976 Ga0105238_11215822
977 Ga0099796_10047901
978 Ga0105239_11401461
979 Ga0105246_11112703
980 Ga0105246_11489334
981 Ga0157373_10654506
982 Ga0157371_10041099
983 Ga0157371_11579473
984 Ga0157370_11887189
985 Ga0157369_10039378
986 Ga0157369_10088976
987 Ga0157369_10168561
988 Ga0157369_10193349
989 Ga0157369_10231771
990 Ga0157369_10392086
991 Ga0157369_10413377
992 Ga0157374_10162980
993 Ga0157374_10254856
994 Ga0157378_10007904
995 Ga0163162_10160730
996 Ga0163162_10363310
997 Ga0163162_11010581
998 Ga0163162_11090162
999 Ga0163162_11924217
1000 Ga0163162_11963275
1001 Ga0157372_10145825
1002 Ga0157372_11205043
1003 Ga0157372_11471073
1004 Ga0157372_11527792
1005 Ga0157372_12512821
1006 Ga0157375_10001330
1007 Ga0157375_10287525
1008 Ga0157375_12887891
1009 Ga0163163_10104537
1010 Ga0163163_10179028
1011 Ga0163163_11508738
1012 Ga0157380_10498305
1013 Ga0157380_11509279
1014 Ga0157380_11802453
1015 Ga0182008_10019118
1016 Ga0157377_11774039
1017 Ga0157376_10160561
1018 Ga0157376_10320941
1019 Ga0157376_10455826
1020 Ga0157376_10623134
1021 Ga0157376_10924016
1022 Ga0157376_13087861
1023 Ga0213876_10001762
1024 Ga0207697_10058062
1025 Ga0207656_10125948
1026 Ga0207682_10139941
1027 Ga0207692_10222875
1028 Ga0207692_10300291
1029 Ga0207642_10684176
1030 Ga0207642_10739955
1031 Ga0207688_10295959
1032 Ga0207680_10000609
1033 Ga0207685_10003338
1034 Ga0207685_10121124
1035 Ga0207699_10026055
1036 Ga0207699_10072295
1037 Ga0207699_10239783
1038 Ga0207699_10276971
1039 Ga0207699_11223158
1040 Ga0207645_10014171
1041 Ga0207705_10016699
1042 Ga0207684_10000528
1043 Ga0207654_10130987
1044 Ga0207654_10201401
1045 Ga0207707_10126866
1046 Ga0207695_10013005
1047 Ga0207695_10106124
1048 Ga0207695_10389132
1049 Ga0207695_10912225
1050 Ga0207671_10305728
1051 Ga0207671_10394674
1052 Ga0207693_10007491
1053 Ga0207693_10011008
1054 Ga0207693_10052551
1055 Ga0207693_11159596
1056 Ga0207663_10001737
1057 Ga0207663_10001826
1058 Ga0207663_10891167
1059 Ga0207663_11139553
1060 Ga0207660_10213310
1061 Ga0207660_10473280
1062 Ga0207662_11376025
1063 Ga0207657_10011894
1064 Ga0207657_10314326
1065 Ga0207657_11353111
1066 Ga0207652_10087355
1067 Ga0207652_11033488
1068 Ga0207646_10016078
1069 Ga0207681_10261797
1070 Ga0207694_10025935
1071 Ga0207694_10027967
1072 Ga0207694_10086678
1073 Ga0207659_10007363
1074 Ga0207687_10213044
1075 Ga0207700_10032132
1076 Ga0207700_10051864
1077 Ga0207700_10261224
1078 Ga0207700_10386688
1079 Ga0207700_10434385
1080 Ga0207700_10563441
1081 Ga0207700_10829656
1082 Ga0207664_10359202
1083 Ga0207664_10421343
1084 Ga0207644_10118850
1085 Ga0207690_10905490
1086 Ga0207690_10934927
1087 Ga0207706_10003901
1088 Ga0207706_10059749
1089 Ga0207686_10367787
1090 Ga0207709_10331224
1091 Ga0207670_10042199
1092 Ga0207670_10203798
1093 Ga0207669_10061568
1094 Ga0207669_10345029
1095 Ga0207704_10101939
1096 Ga0207704_11773336
1097 Ga0207665_10023922
1098 Ga0207665_10036240
1099 Ga0207691_10000015
1100 Ga0207711_10361069
1101 Ga0207711_10480561
1102 Ga0207689_10550359
1103 Ga0207661_10053608
1104 Ga0207661_10471210
1105 Ga0207661_11001302
1106 Ga0207661_11342706
1107 Ga0207661_11415282
1108 Ga0207679_10048332
1109 Ga0207679_11326920
1110 Ga0207679_11569255
1111 Ga0207667_10041502
1112 Ga0207667_10442264
1113 Ga0207667_11015779
1114 Ga0207651_10000145
1115 Ga0207651_10135582
1116 Ga0207651_10996138
1117 Ga0207651_11636456
1118 Ga0207668_10250274
1119 Ga0207668_10575790
1120 Ga0207668_10736252
1121 Ga0207640_10772276
1122 Ga0207640_11649067
1123 Ga0207658_10418251
1124 Ga0207658_11136931
1125 Ga0207677_10571251
1126 Ga0207703_10668729
1127 Ga0207703_11331010
1128 Ga0207639_10028765
1129 Ga0207639_10085079
1130 Ga0207639_10898407
1131 Ga0207678_11672955
1132 Ga0207702_10292499
1133 Ga0207702_10739882
1134 Ga0207702_10744899
1135 Ga0207702_12305087
1136 Ga0207641_10131961
1137 Ga0207641_11825502
1138 Ga0207641_12007439
1139 Ga0207676_10283126
1140 Ga0207676_10332767
1141 Ga0207676_11570016
1142 Ga0207674_10108951
1143 Ga0207674_10693789
1144 Ga0207674_11030523
1145 Ga0207675_100120550
1146 Ga0207675_100269722
1147 Ga0207675_100392006
1148 Ga0207675_101580700
1149 Ga0207675_102058641
1150 Ga0207683_10000241
1151 Ga0207683_10380575
1152 Ga0207683_10568798
1153 Ga0207698_10411495
1154 Ga0207698_10580678
1155 Ga0207698_10609643
1156 Ga0207428_10012039
1157 Ga0207428_10397101
1158 Ga0207428_11200901
1159 Ga0268266_10011940
1160 Ga0268266_11394091
1161 Ga0268264_10076243
1162 Ga0268264_11174289
1163 Ga0265318_10058804
1164 Ga0265336_10035422
1165 Ga0265338_10159515
1166 Ga0265338_10211239
1167 Ga0265338_10271871
1168 Ga0265760_10164723
1169 Ga0265330_10002559
1170 Ga0265330_10013945
1171 Ga0265330_10302068
1172 Ga0265332_10000034
1173 Ga0265332_10067697
1174 Ga0265328_10000714
1175 Ga0265328_10005359
1176 Ga0265320_10074711
1177 Ga0265325_10036951
1178 Ga0265325_10457233
1179 Ga0265329_10004001
1180 Ga0265329_10005451
1181 Ga0265329_10006349
1182 Ga0265340_10097042
1183 Ga0265339_10062745
1184 Ga0265331_10000052
1185 Ga0265331_10222236
1186 Ga0265316_10000027
1187 Ga0265316_10040156
1188 Ga0265316_10089422
1189 Ga0265316_10130014
1190 Ga0307509_10121554
1191 Ga0265313_10189313
1192 Ga0316575_10133618
1193 Ga0265314_10000118
1194 Ga0265314_10000230
1195 Ga0265314_10105961
1196 Ga0265314_10519235
1197 Ga0265342_10011500
1198 Ga0265342_10196037
1199 Ga0307407_10485926
1200 Ga0307412_11006009
1201 Ga0307409_102008041
1202 Ga0307416_100653895
1203 Ga0307416_102283769
1204 Ga0373938_0171762
1205 Ga0373923_0340740
1206 Ga0373953_0279359
1207 Ga0373954_0021386
1208 Ga0373954_0380426
1209 Ga0373954_0527433
1210 Ga0373956_0024038
1211 Ga0373956_0395211
1212 Ga0373956_0570281
1213 Ga0373957_0077493
1214 Ga0373943_0061522
1215 Ga0373946_0013268
1216 Ga0373946_0571072
1217 Ga0373955_0144389
1218 Ga0373924_0004041
1219 Ga0373924_0239514
1220 Ga0373935_0042951
1221 Ga0373935_0075105
1222 Ga0373935_1208366
1223 Ga0373927_0650682
1224 Ga0373927_0703828
1225 Ga0373933_0048908
1226 Ga0373933_0280010
1227 Ga0373933_0315328
1228 Ga0373933_0851671
1229 Ga0373947_0007532
1230 Ga0373947_0374668
1231 Ga0373937_0000027
1232 Ga0373937_0106506
1233 Ga0373937_0115071
1234 Ga0373937_0275087
1235 Ga0373937_0506485
1236 Ga0373937_1238348
1237 Ga0373937_2065139
1238 Ga0316584_0222409
1239 Ga0373925_0000268
1240 Ga0373925_0049264
1241 Ga0373925_0061531
1242 Ga0373925_0330379
1243 Ga0373925_0428973
1244 Ga0395899_0268229
1245 Ga0395900_0070707
1246 Ga0395898_0242219
1247 Ga0395898_1779917
1248 Ga0395905_0003641
1249 Ga0395905_0356682
1250 Ga0395905_0566762
1251 Ga0436364_0877093
1252 Ga0395901_0038574
1253 Ga0436365_0175425
1254 Ga0436365_1113729
1255 Ga0436360_0808792
1256 Ga0436362_0781830
1257 Ga0436362_1105140
1258 Ga0451800_0920910
1259 Ga0451841_1301703
1260 Ga0450896_030422
1261 Ga0451577_0384518
1262 Ga0453683_0705755
1263 Ga0466963_0411875
1264 Ga0466964_0806126
1265 Ga0453684_0020798
1266 Ga0453684_0054262
1267 Ga0453684_1214252
1268 Ga0466971_0191832
1269 Ga0466957_0099400
1270 Ga0466960_0188390
1271 Ga0451576_0070347
1272 Ga0451576_1149827
1273 Ga0466967_0353557
1274 Ga0466967_0553407
1275 Ga0466967_1935490
1276 Ga0495592_0070014
1277 Ga0495592_0233376
1278 Ga0495603_0238843
1279 Ga0495629_0667797
1280 Ga0495651_0029937
1281 Ga0495651_0761337
1282 Ga0495653_0121089
1283 Ga0495580_0004172
1284 Ga0495580_0005613
1285 Ga0495580_0024317
1286 Ga0495580_0245834
1287 Ga0495580_0880787
1288 Ga0495582_0026310
1289 Ga0495582_0539064
1290 Ga0495639_0630840
1291 Ga0495639_0706013
1292 Ga0495662_0061838
1293 Ga0495664_0012989
1294 Ga0495608_0071594
1295 Ga0495608_0173238
1296 Ga0495608_0369313
1297 Ga0495618_0082931
1298 Ga0495628_0054698
1299 Ga0495628_0094666
1300 Ga0495628_0225077
1301 Ga0495630_0003548
1302 Ga0495630_0052386
1303 Ga0495630_0159211
1304 Ga0495666_0158404
1305 Ga0495666_0166435
1306 Ga0495652_0227038
1307 Ga0495665_0110086
1308 Ga0495640_0075403
1309 Ga0495586_0743701
1310 Ga0495587_0038047
1311 Ga0495587_0365840
1312 Ga0495587_0476366
1313 Ga0495667_0046633
1314 Ga0495667_0049452
1315 Ga0495656_0167331
1316 Ga0495634_0027780
1317 Ga0495635_0117089
1318 Ga0495635_1075774
1319 Ga0495657_0094592
1320 Ga0495657_0201774
1321 Ga0495657_0766667
1322 Ga0495599_0001056
1323 Ga0495599_0024713
1324 Ga0495599_0237934
1325 Ga0495599_0660341
1326 Ga0495623_0008691
1327 Ga0495623_0020491
1328 Ga0495646_0047813
1329 Ga0495658_0494111
1330 Ga0495669_0277354
1331 Ga0495613_0009556
1332 Ga0495613_0036690
1333 Ga0495624_0122775
1334 Ga0495600_0722357
1335 Ga0495600_0892084
1336 Ga0495581_0464248
1337 Ga0495674_0085089
1338 Ga0495674_0111853
1339 Ga0495674_0553659
1340 Ga0495674_0632667
1341 Ga0495680_0035164
1342 Ga0495684_0005508
1343 Ga0495684_0014567
1344 Ga0495684_0483411
1345 Ga0495684_0574709
1346 Ga0495684_0576786
1347 Ga0495684_0601453
1348 Ga0495684_0871071
1349 Ga0495593_0215795
1350 Ga0495602_0025195
1351 Ga0496100_0249250
1352 Ga0496101_0209361
1353 Ga0496102_0511374
1354 Ga0496102_1614416
1355 Ga0496102_1629012
1356 Ga0496104_0027233
1357 Ga0496104_0309540
1358 Ga0496104_0372825
1359 Ga0496105_0003500
1360 Ga0496105_0087042
1361 Ga0496106_0093250
1362 Ga0496106_0541746
1363 Ga0496107_0568720
1364 Ga0496107_0802014
1365 Ga0496108_0164007
1366 Ga0496108_0267336
1367 Ga0496108_0922918
1368 Ga0496109_0016746
1369 Ga0496109_0076208
1370 Ga0496109_0557494
1371 Ga0496109_1044450
1372 Ga0496109_1391665
1373 Ga0496110_0150837
1374 Ga0496110_0218495
1375 Ga0496110_0245999
1376 Ga0496111_0755110
1377 Ga0496112_0269421
1378 Ga0496112_0552203
1379 Ga0496112_1275917
1380 Ga0496113_0353562
1381 Ga0496113_0659975
1382 Ga0496113_1044034
1383 Ga0496114_0016840
1384 Ga0496114_0045032
1385 Ga0496114_1702104
1386 Ga0496115_0179270
1387 Ga0496115_0255886
1388 Ga0496115_0502744
1389 Ga0501296_023169
1390 Ga0501031_0401803
1391 Ga0501033_0454930
1392 Ga0501047_0662102
1393 Ga0501075_1321972
1394 Ga0501083_0635204
1395 Ga0501035_0082505
1396 nmdc:mga0k408_473976_c1
1397 nmdc:mga09592_1485435_c1
1398 nmdc:mga06r32_492845_c1
1399 nmdc:mga08y16_15383_c1
1400 nmdc:mga08y16_2186_c1
1401 nmdc:mga08y16_256041_c1
1402 nmdc:mga08y16_627800_c1
1403 nmdc:mga08y16_714594_c1
1404 nmdc:mga08y16_878281_c1
1405 nmdc:mga0n895_120924_c1
1406 nmdc:mga0n895_1362221_c1
1407 nmdc:mga0n895_148365_c1
1408 nmdc:mga0n895_149297_c1
1409 nmdc:mga0n895_422373_c1
1410 nmdc:mga0rr50_176020_c1
1411 nmdc:mga0rr50_560133_c1
1412 nmdc:mga08x19_718024_c1
1413 nmdc:mga0a205_177039_c1
1414 nmdc:mga0a205_208529_c1
1415 Ga0495601_0032218
1416 Ga0495601_0771065
1417 Ga0495619_0164853
1418 Ga0500646_0348897
1419 Ga0587073_0019227
1420 Ga0587122_003144
1421 Ga0530510_0245134
1422 Ga0530510_0572094

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9286 32 106
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9018 34 104
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8955 35 106
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8842 35 108
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.8817 12 109
ID Description Score Start End Superfamily
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9451 32 106 2.60.120.10
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9338 39 107 2.60.120.10
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8995 33 112 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8983 34 106 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8961 51 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2N1W3A6-F1-model_v4 Cupin 0.9993 3 118
AF-A0A7C3JX00-F1-model_v4 Cupin domain-containing protein 0.9989 1 118
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9954 1 118
AF-Q2IDL1-F1-model_v4 Cupin domain protein 0.9942 1 118
AF-A0A2V8UH96-F1-model_v4 Cupin 0.9942 11 118

Map