F476734

General Info

Members Datasets Scaffolds Average Seq Length
710 301 1420 117

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0000167|Ga0500641_0000167_2812_3162
Length 116
Sequence MARDQTEKKRVELLQGTLDLLILRTLLPGPSHGHAIAKHIQRTSDEVLQVEHGSLYPALHRLERKGWITSAWEQAQEKARPLKLYRLTPAGKTQLADESSKWDTLVAAMGRVLRPT

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
208 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
212 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
213 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
214 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
217 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
218 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
219 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
220 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
221 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
224 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
227 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
228 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
229 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
272 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
276 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
277 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
282 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
283 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
287 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
290 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
298 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0
Rhizoplane 3.66
Rhizosphere 91.97
Stem 0
Stem Tuber 0
Unclassified 33.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0000167 3300053096 Bacteria 24634
2 JGI24743J22301_10014051 3300001991 Bacteria 1473
3 rootL2_10262039 3300003322 Bacteria 1385
4 Ga0065704_10658921 3300005289 Bacteria 579
5 Ga0065712_10000858 3300005290 Bacteria 8226
6 Ga0065715_10102537 3300005293 Unclassified 3106
7 Ga0065715_10699123 3300005293 Bacteria 654
8 Ga0065707_10326157 3300005295 Bacteria 957
9 Ga0065707_10453001 3300005295 Unclassified 798
10 Ga0070676_10046511 3300005328 Bacteria 2531
11 Ga0070676_10336244 3300005328 Bacteria 1034
12 Ga0070683_100700140 3300005329 Bacteria 970
13 Ga0070690_100264864 3300005330 Bacteria 1220
14 Ga0070690_100283121 3300005330 Bacteria 1183
15 Ga0070690_100969788 3300005330 Unclassified 668
16 Ga0070670_100044501 3300005331 Bacteria 3817
17 Ga0070670_100092967 3300005331 Unclassified 2594
18 Ga0070670_101525378 3300005331 Unclassified 614
19 Ga0068869_100015133 3300005334 Bacteria 5166
20 Ga0068869_100283396 3300005334 Bacteria 1333
21 Ga0070666_10569230 3300005335 Bacteria 825
22 Ga0070680_100117990 3300005336 Bacteria 2213
23 Ga0068868_100274685 3300005338 Bacteria 1425
24 Ga0068868_100499447 3300005338 Bacteria 1065
25 Ga0068868_101070364 3300005338 Unclassified 741
26 Ga0070689_100185690 3300005340 Bacteria 1691
27 Ga0070689_100460126 3300005340 Bacteria 1084
28 Ga0070691_10668915 3300005341 Bacteria 620
29 Ga0070661_100187530 3300005344 Bacteria 1576
30 Ga0070669_100000399 3300005353 Bacteria 33282
31 Ga0070669_100370911 3300005353 Bacteria 1166
32 Ga0070669_100938466 3300005353 Bacteria 740
33 Ga0070669_101067608 3300005353 Bacteria 695
34 Ga0070669_101116203 3300005353 Unclassified 679
35 Ga0070675_100052467 3300005354 Unclassified 3353
36 Ga0070675_100077077 3300005354 Bacteria 2774
37 Ga0070675_100077376 3300005354 Bacteria 2769
38 Ga0070675_100141034 3300005354 Unclassified 2060
39 Ga0070675_100519752 3300005354 Bacteria 1074
40 Ga0070671_100024317 3300005355 Bacteria 4958
41 Ga0070671_100072477 3300005355 Unclassified 2876
42 Ga0070671_101296450 3300005355 Bacteria 642
43 Ga0070674_100140904 3300005356 Bacteria 1809
44 Ga0070674_100291652 3300005356 Bacteria 1297
45 Ga0070674_100340456 3300005356 Bacteria 1208
46 Ga0070674_101898748 3300005356 Unclassified 541
47 Ga0070673_100001008 3300005364 Bacteria 15996
48 Ga0070673_100027826 3300005364 Bacteria 4196
49 Ga0070673_100090357 3300005364 Unclassified 2501
50 Ga0070673_100167814 3300005364 Bacteria 1872
51 Ga0070673_100421949 3300005364 Bacteria 1196
52 Ga0070673_100582321 3300005364 Bacteria 1019
53 Ga0070688_100150727 3300005365 Bacteria 1589
54 Ga0070688_100629387 3300005365 Bacteria 824
55 Ga0070659_100361862 3300005366 Bacteria 1219
56 Ga0070659_101340081 3300005366 Bacteria 635
57 Ga0070667_100141088 3300005367 Bacteria 2110
58 Ga0070703_10343591 3300005406 Unclassified 635
59 Ga0070713_100004559 3300005436 Bacteria 9339
60 Ga0070701_10012249 3300005438 Unclassified 3861
61 Ga0070701_10112528 3300005438 Bacteria 1523
62 Ga0070711_100075565 3300005439 Bacteria 2386
63 Ga0070705_100924484 3300005440 Unclassified 703
64 Ga0070705_101471288 3300005440 Bacteria 570
65 Ga0070700_100001040 3300005441 Bacteria 13728
66 Ga0070700_100333781 3300005441 Bacteria 1118
67 Ga0070700_100436832 3300005441 Unclassified 993
68 Ga0070694_100120205 3300005444 Unclassified 1884
69 Ga0070694_100361809 3300005444 Unclassified 1127
70 Ga0070694_101542954 3300005444 Unclassified 563
71 Ga0070708_100448610 3300005445 Bacteria 1217
72 Ga0070708_100694379 3300005445 Unclassified 958
73 Ga0070708_102029320 3300005445 Unclassified 532
74 Ga0070663_100039397 3300005455 Unclassified 3301
75 Ga0070678_100018481 3300005456 Bacteria 4519
76 Ga0070678_100635856 3300005456 Unclassified 956
77 Ga0070662_100331618 3300005457 Unclassified 1243
78 Ga0070662_100580309 3300005457 Bacteria 942
79 Ga0070681_10226058 3300005458 Bacteria 1786
80 Ga0070681_10531069 3300005458 Bacteria 1090
81 Ga0070681_10968402 3300005458 Bacteria 770
82 Ga0068867_100489128 3300005459 Bacteria 1056
83 Ga0070685_10420773 3300005466 Bacteria 929
84 Ga0070685_10742072 3300005466 Bacteria 719
85 Ga0070685_11338116 3300005466 Bacteria 548
86 Ga0070706_100017477 3300005467 Bacteria 6619
87 Ga0070706_100081805 3300005467 Unclassified 2991
88 Ga0070706_100469754 3300005467 Bacteria 1170
89 Ga0070706_100731299 3300005467 Bacteria 917
90 Ga0070706_101015095 3300005467 Bacteria 765
91 Ga0070706_101229633 3300005467 Unclassified 688
92 Ga0070707_100220249 3300005468 Unclassified 1848
93 Ga0070698_100790859 3300005471 Bacteria 892
94 Ga0070698_101084331 3300005471 Bacteria 749
95 Ga0070699_100024641 3300005518 Bacteria 5187
96 Ga0070699_100185319 3300005518 Unclassified 1848
97 Ga0070684_100000428 3300005535 Bacteria 28847
98 Ga0070684_100835461 3300005535 Bacteria 862
99 Ga0070697_100032752 3300005536 Unclassified 4184
100 Ga0070697_100248381 3300005536 Bacteria 1521
101 Ga0070697_100829680 3300005536 Unclassified 819
102 Ga0070697_101632114 3300005536 Unclassified 577
103 Ga0070672_100002592 3300005543 Bacteria 11549
104 Ga0070672_100019934 3300005543 Bacteria 4881
105 Ga0070672_100197392 3300005543 Unclassified 1682
106 Ga0070672_100416145 3300005543 Bacteria 1154
107 Ga0070672_100470565 3300005543 Unclassified 1084
108 Ga0070672_100492228 3300005543 Unclassified 1060
109 Ga0070672_100953549 3300005543 Unclassified 759
110 Ga0070686_100085263 3300005544 Unclassified 2101
111 Ga0070695_100028422 3300005545 Bacteria 3470
112 Ga0070695_100284554 3300005545 Bacteria 1216
113 Ga0070696_100007979 3300005546 Bacteria 7068
114 Ga0070696_100758567 3300005546 Unclassified 795
115 Ga0070665_100698941 3300005548 Unclassified 1027
116 Ga0070665_100757138 3300005548 Bacteria 984
117 Ga0070665_101126951 3300005548 Bacteria 796
118 Ga0070665_101765706 3300005548 Bacteria 625
119 Ga0070704_100060278 3300005549 Bacteria 2711
120 Ga0070704_100382838 3300005549 Bacteria 1196
121 Ga0070704_100780780 3300005549 Unclassified 852
122 Ga0068855_100720750 3300005563 Bacteria 1066
123 Ga0070664_100530573 3300005564 Bacteria 1087
124 Ga0070664_100759718 3300005564 Bacteria 905
125 Ga0068857_100024489 3300005577 Bacteria 5314
126 Ga0068857_100133911 3300005577 Bacteria 2237
127 Ga0068856_100590746 3300005614 Bacteria 1131
128 Ga0070702_100067794 3300005615 Bacteria 2098
129 Ga0068852_101655350 3300005616 Unclassified 662
130 Ga0068859_100202376 3300005617 Bacteria 2070
131 Ga0068859_100452388 3300005617 Bacteria 1380
132 Ga0068859_101495956 3300005617 Bacteria 745
133 Ga0068864_100142426 3300005618 Bacteria 2164
134 Ga0068864_100301532 3300005618 Bacteria 1500
135 Ga0068864_100626346 3300005618 Bacteria 1046
136 Ga0068866_10376812 3300005718 Bacteria 909
137 Ga0068861_100592610 3300005719 Bacteria 1016
138 Ga0068861_101654197 3300005719 Bacteria 632
139 Ga0068861_101697709 3300005719 Unclassified 624
140 Ga0068870_10022124 3300005840 Bacteria 3120
141 Ga0068863_100000533 3300005841 Bacteria 38898
142 Ga0068863_100000950 3300005841 Bacteria 29089
143 Ga0068863_100143254 3300005841 Bacteria 2285
144 Ga0068858_100786284 3300005842 Unclassified 928
145 Ga0068858_101777035 3300005842 Unclassified 609
146 Ga0068860_101507318 3300005843 Bacteria 694
147 Ga0081455_10016794 3300005937 Bacteria 7042
148 Ga0081539_10039675 3300005985 Bacteria 2774
149 Ga0070717_10232322 3300006028 Unclassified 1624
150 Ga0070717_10422826 3300006028 Bacteria 1199
151 Ga0075365_10018013 3300006038 Bacteria 4335
152 Ga0075365_10873612 3300006038 Bacteria 634
153 Ga0075364_10215346 3300006051 Bacteria 1303
154 Ga0075364_10244454 3300006051 Bacteria 1219
155 Ga0075367_10332567 3300006178 Bacteria 958
156 Ga0075367_10433769 3300006178 Unclassified 832
157 Ga0075366_10099706 3300006195 Unclassified 1743
158 Ga0075366_10459713 3300006195 Unclassified 785
159 Ga0097621_100081442 3300006237 Unclassified 2694
160 Ga0097621_100685875 3300006237 Bacteria 942
161 Ga0075370_10845031 3300006353 Unclassified 559
162 Ga0068871_100953975 3300006358 Unclassified 797
163 Ga0075428_100002032 3300006844 Bacteria 21801
164 Ga0075428_100003509 3300006844 Bacteria 17182
165 Ga0075428_100019545 3300006844 Bacteria 7496
166 Ga0075428_100024044 3300006844 Bacteria 6743
167 Ga0075428_100217449 3300006844 Unclassified 2064
168 Ga0075428_100424273 3300006844 Bacteria 1425
169 Ga0075428_100929940 3300006844 Bacteria 922
170 Ga0075430_100002867 3300006846 Bacteria 14425
171 Ga0075430_100263440 3300006846 Bacteria 1427
172 Ga0075430_101070886 3300006846 Unclassified 664
173 Ga0075431_100000871 3300006847 Bacteria 26516
174 Ga0075431_100061217 3300006847 Unclassified 3885
175 Ga0075431_100077589 3300006847 Bacteria 3428
176 Ga0075431_100190819 3300006847 Bacteria 2099
177 Ga0075431_100312913 3300006847 Unclassified 1585
178 Ga0075431_100320565 3300006847 Unclassified 1563
179 Ga0075431_100675569 3300006847 Bacteria 1012
180 Ga0075431_101444470 3300006847 Bacteria 647
181 Ga0075433_10003691 3300006852 Bacteria 11843
182 Ga0075433_10005952 3300006852 Bacteria 9604
183 Ga0075433_10020120 3300006852 Bacteria 5574
184 Ga0075433_10165344 3300006852 Unclassified 1969
185 Ga0075433_10199250 3300006852 Bacteria 1780
186 Ga0075433_10254828 3300006852 Unclassified 1556
187 Ga0075433_10896976 3300006852 Unclassified 773
188 Ga0075433_11121180 3300006852 Bacteria 684
189 Ga0075434_100000014 3300006871 Bacteria 80310
190 Ga0075434_100049542 3300006871 Unclassified 4171
191 Ga0075434_100051546 3300006871 Bacteria 4090
192 Ga0075434_100051552 3300006871 Bacteria 4090
193 Ga0075434_100112674 3300006871 Bacteria 2731
194 Ga0075434_101383003 3300006871 Bacteria 714
195 Ga0075429_100002400 3300006880 Bacteria 15779
196 Ga0075429_100054575 3300006880 Bacteria 3476
197 Ga0075429_100081778 3300006880 Bacteria 2816
198 Ga0075429_100139274 3300006880 Unclassified 2124
199 Ga0075429_100184403 3300006880 Bacteria 1829
200 Ga0075429_100772204 3300006880 Unclassified 842
201 Ga0075429_100998062 3300006880 Unclassified 732
202 Ga0075436_100032850 3300006914 Unclassified 3576
203 Ga0075436_100307931 3300006914 Bacteria 1136
204 Ga0075436_100559949 3300006914 Bacteria 840
205 Ga0097620_100202371 3300006931 Bacteria 2070
206 Ga0097620_100452445 3300006931 Bacteria 1380
207 Ga0097620_100701236 3300006931 Unclassified 1103
208 Ga0097620_101496100 3300006931 Bacteria 745
209 Ga0097620_102144704 3300006931 Unclassified 617
210 Ga0075435_100004736 3300007076 Bacteria 9389
211 Ga0075435_100051789 3300007076 Unclassified 3307
212 Ga0075435_100192427 3300007076 Unclassified 1727
213 Ga0099794_10632644 3300007265 Unclassified 568
214 Ga0105240_10543240 3300009093 Unclassified 1287
215 Ga0105240_11044153 3300009093 Unclassified 872
216 Ga0111539_10014857 3300009094 Bacteria 9708
217 Ga0111539_10020364 3300009094 Bacteria 8170
218 Ga0111539_10023703 3300009094 Bacteria 7541
219 Ga0111539_10034052 3300009094 Bacteria 6180
220 Ga0111539_10056847 3300009094 Bacteria 4649
221 Ga0111539_10058671 3300009094 Bacteria 4565
222 Ga0111539_10090143 3300009094 Bacteria 3603
223 Ga0111539_10143446 3300009094 Bacteria 2795
224 Ga0111539_10781475 3300009094 Bacteria 1111
225 Ga0111539_10889486 3300009094 Bacteria 1036
226 Ga0111539_11116810 3300009094 Bacteria 916
227 Ga0111539_11136494 3300009094 Unclassified 907
228 Ga0111539_11227639 3300009094 Unclassified 870
229 Ga0105245_10134733 3300009098 Bacteria 2320
230 Ga0105245_11234615 3300009098 Bacteria 796
231 Ga0105245_12893760 3300009098 Bacteria 532
232 Ga0105245_12939399 3300009098 Bacteria 528
233 Ga0114129_10001269 3300009147 Bacteria 33716
234 Ga0114129_10006945 3300009147 Bacteria 16106
235 Ga0114129_10017242 3300009147 Bacteria 10286
236 Ga0114129_10022448 3300009147 Bacteria 8960
237 Ga0114129_10033413 3300009147 Bacteria 7269
238 Ga0114129_10033996 3300009147 Bacteria 7201
239 Ga0114129_10078445 3300009147 Bacteria 4593
240 Ga0114129_10085139 3300009147 Bacteria 4386
241 Ga0114129_10202486 3300009147 Bacteria 2688
242 Ga0114129_10218941 3300009147 Unclassified 2570
243 Ga0114129_10237540 3300009147 Bacteria 2451
244 Ga0114129_10371743 3300009147 Bacteria 1889
245 Ga0114129_10491057 3300009147 Bacteria 1605
246 Ga0114129_10609603 3300009147 Unclassified 1413
247 Ga0114129_10636017 3300009147 Bacteria 1378
248 Ga0114129_10653311 3300009147 Unclassified 1357
249 Ga0114129_11089957 3300009147 Unclassified 1000
250 Ga0114129_11726690 3300009147 Unclassified 763
251 Ga0114129_11895572 3300009147 Bacteria 723
252 Ga0114129_12943007 3300009147 Unclassified 562
253 Ga0105243_10425033 3300009148 Bacteria 1240
254 Ga0105243_10685733 3300009148 Unclassified 997
255 Ga0105243_11402446 3300009148 Unclassified 719
256 Ga0105243_11882729 3300009148 Unclassified 631
257 Ga0105243_12630246 3300009148 Unclassified 543
258 Ga0105241_10130755 3300009174 Bacteria 2032
259 Ga0105241_10574707 3300009174 Bacteria 1015
260 Ga0105241_10722259 3300009174 Bacteria 911
261 Ga0105242_10437390 3300009176 Bacteria 1230
262 Ga0105242_10763666 3300009176 Bacteria 953
263 Ga0105242_11052124 3300009176 Bacteria 825
264 Ga0105242_11489705 3300009176 Unclassified 707
265 Ga0105242_11806791 3300009176 Bacteria 650
266 Ga0105248_10534950 3300009177 Bacteria 1322
267 Ga0105248_10535651 3300009177 Unclassified 1321
268 Ga0105248_10693791 3300009177 Bacteria 1149
269 Ga0105248_10837845 3300009177 Unclassified 1038
270 Ga0105237_10239804 3300009545 Bacteria 1814
271 Ga0105237_10757039 3300009545 Unclassified 978
272 Ga0105238_10035765 3300009551 Bacteria 5049
273 Ga0105238_10296339 3300009551 Unclassified 1600
274 Ga0105238_11356294 3300009551 Bacteria 738
275 Ga0105249_10021312 3300009553 Bacteria 5801
276 Ga0105249_10129589 3300009553 Unclassified 2406
277 Ga0105249_10142495 3300009553 Bacteria 2299
278 Ga0105249_10227577 3300009553 Bacteria 1838
279 Ga0105249_10936780 3300009553 Unclassified 934
280 Ga0105249_11444222 3300009553 Bacteria 760
281 Ga0105249_12198278 3300009553 Unclassified 624
282 Ga0105249_12570374 3300009553 Bacteria 581
283 Ga0105239_11370227 3300010375 Bacteria 816
284 Ga0105246_10790779 3300011119 Unclassified 841
285 Ga0105246_10800372 3300011119 Unclassified 836
286 Ga0105246_11565757 3300011119 Unclassified 621
287 Ga0157370_10297821 3300013104 Bacteria 1489
288 Ga0157369_11687817 3300013105 Bacteria 644
289 Ga0157374_10158009 3300013296 Unclassified 2207
290 Ga0157374_10272475 3300013296 Unclassified 1669
291 Ga0157374_10926014 3300013296 Unclassified 890
292 Ga0157374_11072687 3300013296 Unclassified 826
293 Ga0157378_10155049 3300013297 Bacteria 2137
294 Ga0157378_10719327 3300013297 Bacteria 1019
295 Ga0157378_12480868 3300013297 Unclassified 570
296 Ga0157378_13258330 3300013297 Unclassified 504
297 Ga0163162_12281015 3300013306 Bacteria 622
298 Ga0163162_12524892 3300013306 Bacteria 591
299 Ga0157372_10211790 3300013307 Bacteria 2246
300 Ga0157372_10402026 3300013307 Bacteria 1596
301 Ga0157372_10953749 3300013307 Bacteria 994
302 Ga0157375_10838975 3300013308 Unclassified 1066
303 Ga0157375_11608739 3300013308 Unclassified 768
304 Ga0163163_10018521 3300014325 Bacteria 6521
305 Ga0163163_11059077 3300014325 Bacteria 874
306 Ga0163163_11428141 3300014325 Unclassified 753
307 Ga0157380_10008294 3300014326 Bacteria 7403
308 Ga0157380_10019870 3300014326 Bacteria 5012
309 Ga0157380_10333511 3300014326 Unclassified 1411
310 Ga0157380_10508256 3300014326 Bacteria 1172
311 Ga0157380_10691167 3300014326 Bacteria 1024
312 Ga0157380_10960466 3300014326 Bacteria 885
313 Ga0157380_11487700 3300014326 Bacteria 730
314 Ga0157377_10088304 3300014745 Unclassified 1826
315 Ga0157377_10394267 3300014745 Bacteria 941
316 Ga0157377_10996504 3300014745 Bacteria 634
317 Ga0157376_10130125 3300014969 Unclassified 2244
318 Ga0157376_10251900 3300014969 Bacteria 1650
319 Ga0157376_10997050 3300014969 Bacteria 860
320 Ga0157376_11754695 3300014969 Unclassified 656
321 Ga0157376_11886041 3300014969 Unclassified 634
322 Ga0213873_10043128 3300021358 Bacteria 1169
323 Ga0213874_10040974 3300021377 Bacteria 1385
324 Ga0213876_10002471 3300021384 Bacteria 10852
325 Ga0213875_10083260 3300021388 Unclassified 1493
326 Ga0213875_10087912 3300021388 Bacteria 1449
327 Ga0207666_1013737 3300025271 Bacteria 1139
328 Ga0207673_1047018 3300025290 Bacteria 609
329 Ga0207697_10002119 3300025315 Bacteria 10419
330 Ga0207697_10068845 3300025315 Unclassified 1481
331 Ga0207656_10195812 3300025321 Bacteria 975
332 Ga0207656_10399311 3300025321 Unclassified 691
333 Ga0207682_10629590 3300025893 Bacteria 505
334 Ga0207642_10815790 3300025899 Unclassified 594
335 Ga0207688_10004283 3300025901 Bacteria 7782
336 Ga0207680_10386347 3300025903 Bacteria 988
337 Ga0207645_10049233 3300025907 Bacteria 2691
338 Ga0207645_10261361 3300025907 Bacteria 1147
339 Ga0207643_10028604 3300025908 Bacteria 3096
340 Ga0207684_10054238 3300025910 Unclassified 3401
341 Ga0207684_10749266 3300025910 Bacteria 828
342 Ga0207684_11225352 3300025910 Bacteria 620
343 Ga0207654_10321987 3300025911 Bacteria 1057
344 Ga0207654_10937886 3300025911 Unclassified 628
345 Ga0207707_10330051 3300025912 Bacteria 1316
346 Ga0207707_10453857 3300025912 Bacteria 1097
347 Ga0207707_11045688 3300025912 Bacteria 668
348 Ga0207695_10084977 3300025913 Unclassified 3193
349 Ga0207695_10865159 3300025913 Unclassified 784
350 Ga0207671_10749001 3300025914 Bacteria 776
351 Ga0207663_11042931 3300025916 Unclassified 656
352 Ga0207663_11054047 3300025916 Unclassified 653
353 Ga0207660_10164139 3300025917 Bacteria 1716
354 Ga0207660_10191672 3300025917 Bacteria 1592
355 Ga0207657_10344445 3300025919 Bacteria 1176
356 Ga0207649_10141141 3300025920 Bacteria 1649
357 Ga0207649_10292302 3300025920 Bacteria 1189
358 Ga0207646_10289374 3300025922 Unclassified 1480
359 Ga0207646_10554752 3300025922 Bacteria 1033
360 Ga0207681_10016406 3300025923 Bacteria 4634
361 Ga0207681_10118507 3300025923 Bacteria 1938
362 Ga0207681_10860928 3300025923 Unclassified 758
363 Ga0207681_11602339 3300025923 Bacteria 545
364 Ga0207694_10127601 3300025924 Bacteria 2036
365 Ga0207694_10219623 3300025924 Unclassified 1550
366 Ga0207694_11524628 3300025924 Bacteria 564
367 Ga0207650_10019864 3300025925 Bacteria 4728
368 Ga0207650_10533873 3300025925 Bacteria 983
369 Ga0207650_10608685 3300025925 Bacteria 919
370 Ga0207650_11234298 3300025925 Unclassified 636
371 Ga0207659_10071838 3300025926 Bacteria 2528
372 Ga0207659_10121258 3300025926 Bacteria 2004
373 Ga0207659_10121387 3300025926 Bacteria 2003
374 Ga0207659_10357608 3300025926 Unclassified 1213
375 Ga0207659_10378972 3300025926 Unclassified 1179
376 Ga0207659_10655566 3300025926 Bacteria 897
377 Ga0207687_10042763 3300025927 Bacteria 3119
378 Ga0207687_10673876 3300025927 Bacteria 876
379 Ga0207700_10004313 3300025928 Bacteria 8362
380 Ga0207700_10150277 3300025928 Bacteria 1924
381 Ga0207644_10015932 3300025931 Bacteria 5055
382 Ga0207644_10065486 3300025931 Unclassified 2643
383 Ga0207644_10407877 3300025931 Bacteria 1112
384 Ga0207690_10127342 3300025932 Bacteria 1859
385 Ga0207706_10810023 3300025933 Bacteria 795
386 Ga0207686_10400433 3300025934 Unclassified 1045
387 Ga0207709_10517084 3300025935 Unclassified 934
388 Ga0207709_10525323 3300025935 Unclassified 927
389 Ga0207670_10305179 3300025936 Bacteria 1248
390 Ga0207670_10342573 3300025936 Bacteria 1182
391 Ga0207670_10448850 3300025936 Bacteria 1039
392 Ga0207669_10023134 3300025937 Bacteria 3313
393 Ga0207669_10380685 3300025937 Bacteria 1099
394 Ga0207704_10250211 3300025938 Bacteria 1330
395 Ga0207704_11002527 3300025938 Unclassified 706
396 Ga0207665_10235055 3300025939 Bacteria 1348
397 Ga0207691_10016519 3300025940 Bacteria 7008
398 Ga0207691_10025294 3300025940 Bacteria 5575
399 Ga0207691_10057564 3300025940 Bacteria 3537
400 Ga0207691_10219680 3300025940 Bacteria 1648
401 Ga0207691_10228508 3300025940 Unclassified 1612
402 Ga0207691_10483058 3300025940 Unclassified 1053
403 Ga0207691_11453123 3300025940 Unclassified 562
404 Ga0207711_10406891 3300025941 Bacteria 1265
405 Ga0207711_10703483 3300025941 Bacteria 942
406 Ga0207711_11039926 3300025941 Unclassified 759
407 Ga0207711_11496350 3300025941 Unclassified 618
408 Ga0207689_10024462 3300025942 Bacteria 5068
409 Ga0207689_10280943 3300025942 Bacteria 1379
410 Ga0207689_10533468 3300025942 Bacteria 985
411 Ga0207679_10158715 3300025945 Bacteria 1849
412 Ga0207679_10175497 3300025945 Unclassified 1768
413 Ga0207679_11021261 3300025945 Bacteria 758
414 Ga0207651_10017111 3300025960 Bacteria 4272
415 Ga0207651_10181710 3300025960 Bacteria 1669
416 Ga0207651_10221449 3300025960 Unclassified 1530
417 Ga0207651_10329864 3300025960 Bacteria 1278
418 Ga0207651_10665740 3300025960 Bacteria 915
419 Ga0207651_11256634 3300025960 Bacteria 665
420 Ga0207712_10201027 3300025961 Bacteria 1580
421 Ga0207712_10205352 3300025961 Unclassified 1565
422 Ga0207712_10352896 3300025961 Bacteria 1223
423 Ga0207712_10498643 3300025961 Unclassified 1040
424 Ga0207712_10656633 3300025961 Unclassified 912
425 Ga0207712_11097508 3300025961 Unclassified 708
426 Ga0207668_10330408 3300025972 Bacteria 1268
427 Ga0207640_11899500 3300025981 Unclassified 539
428 Ga0207658_10190801 3300025986 Bacteria 1703
429 Ga0207658_10628260 3300025986 Unclassified 967
430 Ga0207677_10114744 3300026023 Unclassified 2014
431 Ga0207677_10274159 3300026023 Bacteria 1381
432 Ga0207703_10128003 3300026035 Bacteria 2189
433 Ga0207703_10417416 3300026035 Bacteria 1248
434 Ga0207708_10001605 3300026075 Bacteria 16838
435 Ga0207708_10152205 3300026075 Unclassified 1822
436 Ga0207708_10159482 3300026075 Bacteria 1781
437 Ga0207708_10314974 3300026075 Unclassified 1275
438 Ga0207708_10359641 3300026075 Bacteria 1196
439 Ga0207708_10427275 3300026075 Bacteria 1099
440 Ga0207708_10695992 3300026075 Unclassified 868
441 Ga0207708_11189449 3300026075 Unclassified 666
442 Ga0207708_11585961 3300026075 Bacteria 575
443 Ga0207702_11053248 3300026078 Bacteria 807
444 Ga0207641_10000939 3300026088 Bacteria 30094
445 Ga0207641_10001001 3300026088 Bacteria 28894
446 Ga0207641_10358123 3300026088 Bacteria 1392
447 Ga0207648_10561754 3300026089 Bacteria 1049
448 Ga0207648_11493610 3300026089 Unclassified 635
449 Ga0207676_10538723 3300026095 Bacteria 1114
450 Ga0207676_11458100 3300026095 Unclassified 681
451 Ga0207676_12350731 3300026095 Bacteria 530
452 Ga0207674_10034110 3300026116 Bacteria 5322
453 Ga0207674_10573074 3300026116 Bacteria 1090
454 Ga0207675_100272147 3300026118 Unclassified 1644
455 Ga0207675_100750149 3300026118 Bacteria 987
456 Ga0207675_101128861 3300026118 Unclassified 804
457 Ga0207683_10023829 3300026121 Bacteria 5266
458 Ga0207683_10641817 3300026121 Unclassified 983
459 Ga0207683_11198201 3300026121 Bacteria 704
460 Ga0207698_10758930 3300026142 Unclassified 969
461 Ga0207698_11974932 3300026142 Bacteria 598
462 Ga0209998_10128123 3300027717 Unclassified 643
463 Ga0209974_10165490 3300027876 Bacteria 804
464 Ga0207428_10000641 3300027907 Bacteria 41168
465 Ga0207428_10008378 3300027907 Bacteria 9337
466 Ga0207428_10083138 3300027907 Unclassified 2498
467 Ga0207428_10092744 3300027907 Bacteria 2343
468 Ga0207428_10191459 3300027907 Unclassified 1542
469 Ga0207428_10227231 3300027907 Bacteria 1397
470 Ga0207428_10351578 3300027907 Bacteria 1084
471 Ga0207428_10438193 3300027907 Bacteria 954
472 Ga0268266_10577690 3300028379 Unclassified 1078
473 Ga0268266_11992030 3300028379 Bacteria 554
474 Ga0268265_10012552 3300028380 Bacteria 5743
475 Ga0268265_10680294 3300028380 Unclassified 992
476 Ga0268264_11043322 3300028381 Bacteria 825
477 Ga0265331_10041327 3300031250 Bacteria 2241
478 Ga0265316_10035728 3300031344 Bacteria 4024
479 Ga0265316_10394735 3300031344 Bacteria 997
480 Ga0307509_10625947 3300031507 Unclassified 747
481 Ga0307408_100164356 3300031548 Bacteria 1766
482 Ga0307408_100689695 3300031548 Unclassified 917
483 Ga0307408_101938699 3300031548 Unclassified 565
484 Ga0265313_10438339 3300031595 Bacteria 509
485 Ga0307405_10075604 3300031731 Bacteria 2182
486 Ga0307405_12077262 3300031731 Bacteria 510
487 Ga0307413_10976090 3300031824 Bacteria 724
488 Ga0307410_11420985 3300031852 Unclassified 609
489 Ga0307406_10340467 3300031901 Bacteria 1168
490 Ga0307406_11859678 3300031901 Bacteria 536
491 Ga0307412_10029222 3300031911 Bacteria 3458
492 Ga0307412_10481023 3300031911 Bacteria 1030
493 Ga0307412_10763267 3300031911 Archaea 836
494 Ga0307409_100774574 3300031995 Bacteria 965
495 Ga0307416_100192831 3300032002 Bacteria 1924
496 Ga0307416_100227943 3300032002 Bacteria 1793
497 Ga0307416_103876822 3300032002 Bacteria 501
498 Ga0307414_10044210 3300032004 Bacteria 3040
499 Ga0307411_11288430 3300032005 Unclassified 665
500 Ga0307415_100011314 3300032126 Bacteria 5100
501 Ga0307415_100320886 3300032126 Unclassified 1291
502 Ga0307415_101761305 3300032126 Unclassified 599
503 Ga0373926_0108048 3300035083 Unclassified 1044
504 Ga0373944_0061829 3300035089 Bacteria 1203
505 Ga0373949_0180483 3300035090 Unclassified 625
506 Ga0373932_0103481 3300035112 Bacteria 930
507 Ga0373939_0044230 3300035114 Unclassified 1355
508 Ga0373945_0400446 3300035116 Bacteria 601
509 Ga0373956_0346717 3300035119 Unclassified 708
510 Ga0373960_0351755 3300035121 Unclassified 559
511 Ga0373961_0178031 3300035241 Unclassified 739
512 Ga0373935_0169210 3300035692 Bacteria 1494
513 Ga0373927_0003185 3300035695 Bacteria 11834
514 Ga0373927_1163766 3300035695 Bacteria 509
515 Ga0373925_0022328 3300037068 Bacteria 4615
516 Ga0373925_0452612 3300037068 Unclassified 1051
517 Ga0373925_1337746 3300037068 Bacteria 587
518 Ga0373925_1571390 3300037068 Unclassified 538
519 Ga0395898_0306886 3300037466 Bacteria 1514
520 Ga0395905_0893081 3300037471 Unclassified 792
521 Ga0436364_0646974 3300037853 Unclassified 3621
522 Ga0436364_0731417 3300037853 Bacteria 805
523 Ga0436364_1190728 3300037853 Bacteria 2965
524 Ga0436365_1596339 3300039437 Bacteria 2017
525 Ga0436365_1830276 3300039437 Bacteria 12279
526 Ga0436363_0237146 3300039450 Bacteria 5789
527 Ga0436362_0029453 3300039453 Bacteria 1317
528 Ga0439461_0221614 3300041410 Bacteria 516
529 Ga0451789_0012155 3300041443 Bacteria 696
530 Ga0451798_0774197 3300041458 Bacteria 521
531 Ga0451807_0343017 3300041486 Bacteria 567
532 Ga0451845_0448117 3300041501 Unclassified 626
533 Ga0451851_1358438 3300041507 Bacteria 779
534 Ga0439431_0006595 3300041997 Bacteria 2572
535 Ga0439433_0016514 3300041999 Bacteria 1636
536 Ga0439443_060279 3300042003 Unclassified 678
537 Ga0439449_0075659 3300042007 Bacteria 1241
538 Ga0439449_0225421 3300042007 Bacteria 703
539 Ga0439462_0041800 3300042015 Bacteria 1224
540 Ga0450921_018972 3300042123 Bacteria 642
541 Ga0450923_029099 3300042125 Unclassified 1118
542 Ga0439446_0014825 3300042156 Bacteria 2156
543 Ga0439435_0002156 3300042436 Bacteria 3840
544 Ga0439444_0040699 3300042437 Unclassified 911
545 Ga0439459_0140542 3300042438 Unclassified 624
546 Ga0439464_0111079 3300042439 Bacteria 839
547 Ga0439464_0148990 3300042439 Unclassified 731
548 Ga0450916_085240 3300042530 Unclassified 544
549 Ga0450893_0030954 3300042532 Unclassified 954
550 Ga0453683_0551541 3300044673 Unclassified 750
551 Ga0451576_0077706 3300045051 Bacteria 3454
552 Ga0451576_0354285 3300045051 Bacteria 1537
553 Ga0451576_1128817 3300045051 Bacteria 820
554 Ga0466958_0832297 3300045836 Unclassified 602
555 Ga0495629_0640740 3300046459 Bacteria 709
556 Ga0495638_0030934 3300046460 Bacteria 3442
557 Ga0495580_0104887 3300046472 Bacteria 1964
558 Ga0495580_0571291 3300046472 Bacteria 749
559 Ga0495580_1065100 3300046472 Unclassified 513
560 Ga0495628_0369084 3300046516 Bacteria 1053
561 Ga0495665_0439846 3300046531 Bacteria 660
562 Ga0495621_0004261 3300046539 Bacteria 4004
563 Ga0495659_0232011 3300046664 Unclassified 765
564 Ga0495647_0128449 3300046681 Unclassified 1072
565 Ga0495669_0090562 3300046684 Bacteria 1412
566 Ga0495670_0771100 3300046691 Bacteria 525
567 Ga0495581_0394329 3300047315 Unclassified 808
568 Ga0495604_0624305 3300047317 Unclassified 689
569 Ga0495636_0033192 3300047318 Bacteria 2120
570 Ga0495672_0313945 3300047320 Bacteria 738
571 Ga0495676_0843254 3300047321 Unclassified 589
572 Ga0496100_0282791 3300048903 Unclassified 1237
573 Ga0496100_1091068 3300048903 Bacteria 629
574 Ga0496101_1117435 3300048904 Unclassified 618
575 Ga0496102_0247685 3300048905 Bacteria 1680
576 Ga0496102_0940125 3300048905 Bacteria 786
577 Ga0496104_0004429 3300048907 Bacteria 12238
578 Ga0496104_0670579 3300048907 Unclassified 945
579 Ga0496105_0045182 3300048908 Unclassified 3634
580 Ga0496106_0590842 3300048909 Bacteria 890
581 Ga0496106_1473405 3300048909 Bacteria 524
582 Ga0496108_0004961 3300048911 Bacteria 10754
583 Ga0496108_0203650 3300048911 Bacteria 1717
584 Ga0496109_0002196 3300048912 Bacteria 16197
585 Ga0496110_0004328 3300048913 Bacteria 10988
586 Ga0496110_1126747 3300048913 Unclassified 693
587 Ga0496111_1205199 3300048914 Unclassified 536
588 Ga0496112_0004771 3300048915 Bacteria 11561
589 Ga0496112_0822972 3300048915 Unclassified 853
590 Ga0496113_0092965 3300048916 Unclassified 2327
591 Ga0496113_0807883 3300048916 Unclassified 745
592 Ga0496114_1091181 3300048917 Bacteria 683
593 Ga0496115_0252061 3300048918 Unclassified 1453
594 Ga0496115_0714534 3300048918 Unclassified 787
595 Ga0501299_113442 3300049522 Unclassified 644
596 Ga0501036_1542231 3300049572 Unclassified 537
597 Ga0501040_0377624 3300049576 Unclassified 1017
598 Ga0501040_0601806 3300049576 Bacteria 794
599 Ga0501042_0094336 3300049578 Bacteria 2149
600 Ga0501048_0540551 3300049582 Unclassified 836
601 Ga0501068_0324669 3300049584 Bacteria 987
602 Ga0501068_0974072 3300049584 Unclassified 559
603 Ga0501071_0064158 3300049587 Plasmid 2665
604 Ga0501072_0324074 3300049588 Unclassified 1224
605 Ga0501072_1495501 3300049588 Unclassified 521
606 Ga0501073_0005902 3300049589 Bacteria 9139
607 Ga0501073_0017662 3300049589 Bacteria 5164
608 Ga0501074_0166424 3300049590 Bacteria 1574
609 Ga0501075_0152382 3300049591 Bacteria 1762
610 Ga0501075_0167912 3300049591 Bacteria 1674
611 Ga0501075_0515518 3300049591 Bacteria 912
612 Ga0501075_1371317 3300049591 Unclassified 535
613 Ga0501076_0346396 3300049592 Bacteria 1220
614 Ga0501076_1075998 3300049592 Bacteria 662
615 Ga0501202_179043 3300049652 Unclassified 571
616 Ga0501233_140685 3300049668 Bacteria 666
617 Ga0501235_217919 3300049669 Unclassified 523
618 Ga0501260_039680 3300049689 Unclassified 568
619 Ga0501261_103637 3300049690 Unclassified 544
620 Ga0501079_0124789 3300049741 Unclassified 2003
621 Ga0501079_0807356 3300049741 Unclassified 739
622 Ga0501080_0881259 3300049742 Unclassified 781
623 Ga0501081_0382717 3300049743 Bacteria 1040
624 Ga0501264_023382 3300049761 Unclassified 670
625 Ga0501270_091862 3300049767 Unclassified 621
626 Ga0501283_046384 3300049779 Unclassified 762
627 Ga0501045_0167627 3300049824 Bacteria 1636
628 nmdc:mga00v17_441770_c1 3300050491 Bacteria 845
629 nmdc:mga0k408_530861_c1 3300050493 Bacteria 696
630 nmdc:mga06z11_136969_c1 3300050494 Bacteria 1380
631 nmdc:mga06z11_206674_c1 3300050494 Bacteria 1142
632 nmdc:mga05p37_1053700_c1 3300050507 Bacteria 857
633 nmdc:mga05p37_111518_c1 3300050507 Bacteria 3364
634 nmdc:mga05p37_1252657_c1 3300050507 Bacteria 761
635 nmdc:mga05p37_135137_c1 3300050507 Unclassified 3025
636 nmdc:mga05p37_15131_c1 3300050507 Bacteria 9265
637 nmdc:mga05p37_167274_c1 3300050507 Bacteria 2683
638 nmdc:mga05p37_173551_c1 3300050507 Bacteria 2628
639 nmdc:mga05p37_17799_c1 3300050507 Bacteria 8575
640 nmdc:mga05p37_2670_c1 3300050507 Bacteria 20778
641 nmdc:mga05p37_272650_c1 3300050507 Bacteria 2021
642 nmdc:mga05p37_30924_c1 3300050507 Bacteria 6536
643 nmdc:mga05p37_659235_c1 3300050507 Bacteria 1170
644 nmdc:mga05p37_65975_c1 3300050507 Bacteria 3197
645 nmdc:mga05p37_897193_c1 3300050507 Bacteria 956
646 nmdc:mga09592_1003449_c1 3300050508 Bacteria 698
647 nmdc:mga09592_1058952_c1 3300050508 Unclassified 676
648 nmdc:mga09592_11439_c1 3300050508 Bacteria 7217
649 nmdc:mga09592_150741_c1 3300050508 Bacteria 2006
650 nmdc:mga09592_962353_c1 3300050508 Unclassified 715
651 nmdc:mga0qj67_207537_c1 3300050509 Bacteria 1591
652 nmdc:mga0qj67_2887_c1 3300050509 Bacteria 12334
653 nmdc:mga0qj67_432259_c1 3300050509 Bacteria 1061
654 nmdc:mga0qj67_749842_c1 3300050509 Bacteria 775
655 nmdc:mga0qj67_835366_c1 3300050509 Unclassified 728
656 nmdc:mga0qj67_97562_c1 3300050509 Unclassified 2367
657 nmdc:mga06r32_1323206_c1 3300050510 Bacteria 664
658 nmdc:mga06r32_1629_c1 3300050510 Bacteria 20260
659 nmdc:mga06r32_1885792_c1 3300050510 Bacteria 532
660 nmdc:mga06r32_309725_c1 3300050510 Archaea 1565
661 nmdc:mga06r32_494286_c1 3300050510 Bacteria 1201
662 nmdc:mga06r32_554706_c1 3300050510 Unclassified 1123
663 nmdc:mga06r32_638888_c1 3300050510 Bacteria 1033
664 nmdc:mga06r32_652417_c1 3300050510 Bacteria 1020
665 nmdc:mga06r32_661978_c1 3300050510 Bacteria 1012
666 nmdc:mga08y16_102003_c1 3300050511 Bacteria 2987
667 nmdc:mga08y16_156785_c1 3300050511 Unclassified 2366
668 nmdc:mga08y16_1899413_c1 3300050511 Unclassified 546
669 nmdc:mga08y16_317982_c1 3300050511 Bacteria 1603
670 nmdc:mga08y16_418324_c1 3300050511 Bacteria 1370
671 nmdc:mga08y16_57446_c1 3300050511 Bacteria 4066
672 nmdc:mga08y16_605591_c1 3300050511 Bacteria 1104
673 nmdc:mga08y16_686624_c1 3300050511 Bacteria 1025
674 nmdc:mga08y16_690593_c1 3300050511 Unclassified 1021
675 nmdc:mga08y16_8694_c1 3300050511 Bacteria 10650
676 nmdc:mga08y16_893_c1 3300050511 Bacteria 28802
677 nmdc:mga0n895_1294605_c1 3300050512 Bacteria 700
678 nmdc:mga0n895_133479_c1 3300050512 Bacteria 2508
679 nmdc:mga0n895_1573701_c1 3300050512 Bacteria 622
680 nmdc:mga0n895_1794723_c1 3300050512 Unclassified 574
681 nmdc:mga0n895_243576_c1 3300050512 Bacteria 1825
682 nmdc:mga0n895_39730_c1 3300050512 Bacteria 4567
683 nmdc:mga0n895_53193_c1 3300050512 Unclassified 3978
684 nmdc:mga0n895_633200_c1 3300050512 Bacteria 1069
685 nmdc:mga0n895_868_c1 3300050512 Bacteria 21737
686 nmdc:mga0rr50_165435_c1 3300050513 Bacteria 1798
687 nmdc:mga0rr50_1731960_c1 3300050513 Unclassified 526
688 nmdc:mga0rr50_18339_c1 3300050513 Bacteria 4698
689 nmdc:mga0rr50_1887028_c1 3300050513 Unclassified 502
690 nmdc:mga0rr50_29974_c1 3300050513 Unclassified 3845
691 nmdc:mga0rr50_89391_c1 3300050513 Bacteria 2395
692 nmdc:mga08x19_140309_c1 3300050514 Bacteria 1632
693 nmdc:mga08x19_23823_c1 3300050514 Bacteria 3799
694 nmdc:mga08x19_458083_c1 3300050514 Bacteria 898
695 nmdc:mga08x19_802575_c1 3300050514 Bacteria 668
696 nmdc:mga0a205_108637_c1 3300050515 Bacteria 2672
697 nmdc:mga0a205_125953_c1 3300050515 Bacteria 2461
698 nmdc:mga0a205_196274_c1 3300050515 Bacteria 1909
699 nmdc:mga0a205_28361_c1 3300050515 Bacteria 5353
700 nmdc:mga0a205_36148_c1 3300050515 Bacteria 4745
701 nmdc:mga0a205_3665_c1 3300050515 Bacteria 13763
702 nmdc:mga0a205_5907_c1 3300050515 Bacteria 11027
703 nmdc:mga0a205_9446_c1 3300050515 Bacteria 8917
704 nmdc:mga0a205_954238_c1 3300050515 Unclassified 704
705 Ga0500593_143359 3300053117 Bacteria 937
706 Ga0500628_088040 3300053129 Bacteria 805
707 Ga0500568_0001139 3300053139 Bacteria 17840
708 Ga0501082_0633709 3300060353 Unclassified 935
709 Ga0501082_1405951 3300060353 Bacteria 609
710 Ga0530510_0254512 3300061734 Bacteria 1309
711 Ga0500641_0000167
712 JGI24743J22301_10014051
713 rootL2_10262039
714 Ga0065704_10658921
715 Ga0065712_10000858
716 Ga0065715_10102537
717 Ga0065715_10699123
718 Ga0065707_10326157
719 Ga0065707_10453001
720 Ga0070676_10046511
721 Ga0070676_10336244
722 Ga0070683_100700140
723 Ga0070690_100264864
724 Ga0070690_100283121
725 Ga0070690_100969788
726 Ga0070670_100044501
727 Ga0070670_100092967
728 Ga0070670_101525378
729 Ga0068869_100015133
730 Ga0068869_100283396
731 Ga0070666_10569230
732 Ga0070680_100117990
733 Ga0068868_100274685
734 Ga0068868_100499447
735 Ga0068868_101070364
736 Ga0070689_100185690
737 Ga0070689_100460126
738 Ga0070691_10668915
739 Ga0070661_100187530
740 Ga0070669_100000399
741 Ga0070669_100370911
742 Ga0070669_100938466
743 Ga0070669_101067608
744 Ga0070669_101116203
745 Ga0070675_100052467
746 Ga0070675_100077077
747 Ga0070675_100077376
748 Ga0070675_100141034
749 Ga0070675_100519752
750 Ga0070671_100024317
751 Ga0070671_100072477
752 Ga0070671_101296450
753 Ga0070674_100140904
754 Ga0070674_100291652
755 Ga0070674_100340456
756 Ga0070674_101898748
757 Ga0070673_100001008
758 Ga0070673_100027826
759 Ga0070673_100090357
760 Ga0070673_100167814
761 Ga0070673_100421949
762 Ga0070673_100582321
763 Ga0070688_100150727
764 Ga0070688_100629387
765 Ga0070659_100361862
766 Ga0070659_101340081
767 Ga0070667_100141088
768 Ga0070703_10343591
769 Ga0070713_100004559
770 Ga0070701_10012249
771 Ga0070701_10112528
772 Ga0070711_100075565
773 Ga0070705_100924484
774 Ga0070705_101471288
775 Ga0070700_100001040
776 Ga0070700_100333781
777 Ga0070700_100436832
778 Ga0070694_100120205
779 Ga0070694_100361809
780 Ga0070694_101542954
781 Ga0070708_100448610
782 Ga0070708_100694379
783 Ga0070708_102029320
784 Ga0070663_100039397
785 Ga0070678_100018481
786 Ga0070678_100635856
787 Ga0070662_100331618
788 Ga0070662_100580309
789 Ga0070681_10226058
790 Ga0070681_10531069
791 Ga0070681_10968402
792 Ga0068867_100489128
793 Ga0070685_10420773
794 Ga0070685_10742072
795 Ga0070685_11338116
796 Ga0070706_100017477
797 Ga0070706_100081805
798 Ga0070706_100469754
799 Ga0070706_100731299
800 Ga0070706_101015095
801 Ga0070706_101229633
802 Ga0070707_100220249
803 Ga0070698_100790859
804 Ga0070698_101084331
805 Ga0070699_100024641
806 Ga0070699_100185319
807 Ga0070684_100000428
808 Ga0070684_100835461
809 Ga0070697_100032752
810 Ga0070697_100248381
811 Ga0070697_100829680
812 Ga0070697_101632114
813 Ga0070672_100002592
814 Ga0070672_100019934
815 Ga0070672_100197392
816 Ga0070672_100416145
817 Ga0070672_100470565
818 Ga0070672_100492228
819 Ga0070672_100953549
820 Ga0070686_100085263
821 Ga0070695_100028422
822 Ga0070695_100284554
823 Ga0070696_100007979
824 Ga0070696_100758567
825 Ga0070665_100698941
826 Ga0070665_100757138
827 Ga0070665_101126951
828 Ga0070665_101765706
829 Ga0070704_100060278
830 Ga0070704_100382838
831 Ga0070704_100780780
832 Ga0068855_100720750
833 Ga0070664_100530573
834 Ga0070664_100759718
835 Ga0068857_100024489
836 Ga0068857_100133911
837 Ga0068856_100590746
838 Ga0070702_100067794
839 Ga0068852_101655350
840 Ga0068859_100202376
841 Ga0068859_100452388
842 Ga0068859_101495956
843 Ga0068864_100142426
844 Ga0068864_100301532
845 Ga0068864_100626346
846 Ga0068866_10376812
847 Ga0068861_100592610
848 Ga0068861_101654197
849 Ga0068861_101697709
850 Ga0068870_10022124
851 Ga0068863_100000533
852 Ga0068863_100000950
853 Ga0068863_100143254
854 Ga0068858_100786284
855 Ga0068858_101777035
856 Ga0068860_101507318
857 Ga0081455_10016794
858 Ga0081539_10039675
859 Ga0070717_10232322
860 Ga0070717_10422826
861 Ga0075365_10018013
862 Ga0075365_10873612
863 Ga0075364_10215346
864 Ga0075364_10244454
865 Ga0075367_10332567
866 Ga0075367_10433769
867 Ga0075366_10099706
868 Ga0075366_10459713
869 Ga0097621_100081442
870 Ga0097621_100685875
871 Ga0075370_10845031
872 Ga0068871_100953975
873 Ga0075428_100002032
874 Ga0075428_100003509
875 Ga0075428_100019545
876 Ga0075428_100024044
877 Ga0075428_100217449
878 Ga0075428_100424273
879 Ga0075428_100929940
880 Ga0075430_100002867
881 Ga0075430_100263440
882 Ga0075430_101070886
883 Ga0075431_100000871
884 Ga0075431_100061217
885 Ga0075431_100077589
886 Ga0075431_100190819
887 Ga0075431_100312913
888 Ga0075431_100320565
889 Ga0075431_100675569
890 Ga0075431_101444470
891 Ga0075433_10003691
892 Ga0075433_10005952
893 Ga0075433_10020120
894 Ga0075433_10165344
895 Ga0075433_10199250
896 Ga0075433_10254828
897 Ga0075433_10896976
898 Ga0075433_11121180
899 Ga0075434_100000014
900 Ga0075434_100049542
901 Ga0075434_100051546
902 Ga0075434_100051552
903 Ga0075434_100112674
904 Ga0075434_101383003
905 Ga0075429_100002400
906 Ga0075429_100054575
907 Ga0075429_100081778
908 Ga0075429_100139274
909 Ga0075429_100184403
910 Ga0075429_100772204
911 Ga0075429_100998062
912 Ga0075436_100032850
913 Ga0075436_100307931
914 Ga0075436_100559949
915 Ga0097620_100202371
916 Ga0097620_100452445
917 Ga0097620_100701236
918 Ga0097620_101496100
919 Ga0097620_102144704
920 Ga0075435_100004736
921 Ga0075435_100051789
922 Ga0075435_100192427
923 Ga0099794_10632644
924 Ga0105240_10543240
925 Ga0105240_11044153
926 Ga0111539_10014857
927 Ga0111539_10020364
928 Ga0111539_10023703
929 Ga0111539_10034052
930 Ga0111539_10056847
931 Ga0111539_10058671
932 Ga0111539_10090143
933 Ga0111539_10143446
934 Ga0111539_10781475
935 Ga0111539_10889486
936 Ga0111539_11116810
937 Ga0111539_11136494
938 Ga0111539_11227639
939 Ga0105245_10134733
940 Ga0105245_11234615
941 Ga0105245_12893760
942 Ga0105245_12939399
943 Ga0114129_10001269
944 Ga0114129_10006945
945 Ga0114129_10017242
946 Ga0114129_10022448
947 Ga0114129_10033413
948 Ga0114129_10033996
949 Ga0114129_10078445
950 Ga0114129_10085139
951 Ga0114129_10202486
952 Ga0114129_10218941
953 Ga0114129_10237540
954 Ga0114129_10371743
955 Ga0114129_10491057
956 Ga0114129_10609603
957 Ga0114129_10636017
958 Ga0114129_10653311
959 Ga0114129_11089957
960 Ga0114129_11726690
961 Ga0114129_11895572
962 Ga0114129_12943007
963 Ga0105243_10425033
964 Ga0105243_10685733
965 Ga0105243_11402446
966 Ga0105243_11882729
967 Ga0105243_12630246
968 Ga0105241_10130755
969 Ga0105241_10574707
970 Ga0105241_10722259
971 Ga0105242_10437390
972 Ga0105242_10763666
973 Ga0105242_11052124
974 Ga0105242_11489705
975 Ga0105242_11806791
976 Ga0105248_10534950
977 Ga0105248_10535651
978 Ga0105248_10693791
979 Ga0105248_10837845
980 Ga0105237_10239804
981 Ga0105237_10757039
982 Ga0105238_10035765
983 Ga0105238_10296339
984 Ga0105238_11356294
985 Ga0105249_10021312
986 Ga0105249_10129589
987 Ga0105249_10142495
988 Ga0105249_10227577
989 Ga0105249_10936780
990 Ga0105249_11444222
991 Ga0105249_12198278
992 Ga0105249_12570374
993 Ga0105239_11370227
994 Ga0105246_10790779
995 Ga0105246_10800372
996 Ga0105246_11565757
997 Ga0157370_10297821
998 Ga0157369_11687817
999 Ga0157374_10158009
1000 Ga0157374_10272475
1001 Ga0157374_10926014
1002 Ga0157374_11072687
1003 Ga0157378_10155049
1004 Ga0157378_10719327
1005 Ga0157378_12480868
1006 Ga0157378_13258330
1007 Ga0163162_12281015
1008 Ga0163162_12524892
1009 Ga0157372_10211790
1010 Ga0157372_10402026
1011 Ga0157372_10953749
1012 Ga0157375_10838975
1013 Ga0157375_11608739
1014 Ga0163163_10018521
1015 Ga0163163_11059077
1016 Ga0163163_11428141
1017 Ga0157380_10008294
1018 Ga0157380_10019870
1019 Ga0157380_10333511
1020 Ga0157380_10508256
1021 Ga0157380_10691167
1022 Ga0157380_10960466
1023 Ga0157380_11487700
1024 Ga0157377_10088304
1025 Ga0157377_10394267
1026 Ga0157377_10996504
1027 Ga0157376_10130125
1028 Ga0157376_10251900
1029 Ga0157376_10997050
1030 Ga0157376_11754695
1031 Ga0157376_11886041
1032 Ga0213873_10043128
1033 Ga0213874_10040974
1034 Ga0213876_10002471
1035 Ga0213875_10083260
1036 Ga0213875_10087912
1037 Ga0207666_1013737
1038 Ga0207673_1047018
1039 Ga0207697_10002119
1040 Ga0207697_10068845
1041 Ga0207656_10195812
1042 Ga0207656_10399311
1043 Ga0207682_10629590
1044 Ga0207642_10815790
1045 Ga0207688_10004283
1046 Ga0207680_10386347
1047 Ga0207645_10049233
1048 Ga0207645_10261361
1049 Ga0207643_10028604
1050 Ga0207684_10054238
1051 Ga0207684_10749266
1052 Ga0207684_11225352
1053 Ga0207654_10321987
1054 Ga0207654_10937886
1055 Ga0207707_10330051
1056 Ga0207707_10453857
1057 Ga0207707_11045688
1058 Ga0207695_10084977
1059 Ga0207695_10865159
1060 Ga0207671_10749001
1061 Ga0207663_11042931
1062 Ga0207663_11054047
1063 Ga0207660_10164139
1064 Ga0207660_10191672
1065 Ga0207657_10344445
1066 Ga0207649_10141141
1067 Ga0207649_10292302
1068 Ga0207646_10289374
1069 Ga0207646_10554752
1070 Ga0207681_10016406
1071 Ga0207681_10118507
1072 Ga0207681_10860928
1073 Ga0207681_11602339
1074 Ga0207694_10127601
1075 Ga0207694_10219623
1076 Ga0207694_11524628
1077 Ga0207650_10019864
1078 Ga0207650_10533873
1079 Ga0207650_10608685
1080 Ga0207650_11234298
1081 Ga0207659_10071838
1082 Ga0207659_10121258
1083 Ga0207659_10121387
1084 Ga0207659_10357608
1085 Ga0207659_10378972
1086 Ga0207659_10655566
1087 Ga0207687_10042763
1088 Ga0207687_10673876
1089 Ga0207700_10004313
1090 Ga0207700_10150277
1091 Ga0207644_10015932
1092 Ga0207644_10065486
1093 Ga0207644_10407877
1094 Ga0207690_10127342
1095 Ga0207706_10810023
1096 Ga0207686_10400433
1097 Ga0207709_10517084
1098 Ga0207709_10525323
1099 Ga0207670_10305179
1100 Ga0207670_10342573
1101 Ga0207670_10448850
1102 Ga0207669_10023134
1103 Ga0207669_10380685
1104 Ga0207704_10250211
1105 Ga0207704_11002527
1106 Ga0207665_10235055
1107 Ga0207691_10016519
1108 Ga0207691_10025294
1109 Ga0207691_10057564
1110 Ga0207691_10219680
1111 Ga0207691_10228508
1112 Ga0207691_10483058
1113 Ga0207691_11453123
1114 Ga0207711_10406891
1115 Ga0207711_10703483
1116 Ga0207711_11039926
1117 Ga0207711_11496350
1118 Ga0207689_10024462
1119 Ga0207689_10280943
1120 Ga0207689_10533468
1121 Ga0207679_10158715
1122 Ga0207679_10175497
1123 Ga0207679_11021261
1124 Ga0207651_10017111
1125 Ga0207651_10181710
1126 Ga0207651_10221449
1127 Ga0207651_10329864
1128 Ga0207651_10665740
1129 Ga0207651_11256634
1130 Ga0207712_10201027
1131 Ga0207712_10205352
1132 Ga0207712_10352896
1133 Ga0207712_10498643
1134 Ga0207712_10656633
1135 Ga0207712_11097508
1136 Ga0207668_10330408
1137 Ga0207640_11899500
1138 Ga0207658_10190801
1139 Ga0207658_10628260
1140 Ga0207677_10114744
1141 Ga0207677_10274159
1142 Ga0207703_10128003
1143 Ga0207703_10417416
1144 Ga0207708_10001605
1145 Ga0207708_10152205
1146 Ga0207708_10159482
1147 Ga0207708_10314974
1148 Ga0207708_10359641
1149 Ga0207708_10427275
1150 Ga0207708_10695992
1151 Ga0207708_11189449
1152 Ga0207708_11585961
1153 Ga0207702_11053248
1154 Ga0207641_10000939
1155 Ga0207641_10001001
1156 Ga0207641_10358123
1157 Ga0207648_10561754
1158 Ga0207648_11493610
1159 Ga0207676_10538723
1160 Ga0207676_11458100
1161 Ga0207676_12350731
1162 Ga0207674_10034110
1163 Ga0207674_10573074
1164 Ga0207675_100272147
1165 Ga0207675_100750149
1166 Ga0207675_101128861
1167 Ga0207683_10023829
1168 Ga0207683_10641817
1169 Ga0207683_11198201
1170 Ga0207698_10758930
1171 Ga0207698_11974932
1172 Ga0209998_10128123
1173 Ga0209974_10165490
1174 Ga0207428_10000641
1175 Ga0207428_10008378
1176 Ga0207428_10083138
1177 Ga0207428_10092744
1178 Ga0207428_10191459
1179 Ga0207428_10227231
1180 Ga0207428_10351578
1181 Ga0207428_10438193
1182 Ga0268266_10577690
1183 Ga0268266_11992030
1184 Ga0268265_10012552
1185 Ga0268265_10680294
1186 Ga0268264_11043322
1187 Ga0265331_10041327
1188 Ga0265316_10035728
1189 Ga0265316_10394735
1190 Ga0307509_10625947
1191 Ga0307408_100164356
1192 Ga0307408_100689695
1193 Ga0307408_101938699
1194 Ga0265313_10438339
1195 Ga0307405_10075604
1196 Ga0307405_12077262
1197 Ga0307413_10976090
1198 Ga0307410_11420985
1199 Ga0307406_10340467
1200 Ga0307406_11859678
1201 Ga0307412_10029222
1202 Ga0307412_10481023
1203 Ga0307412_10763267
1204 Ga0307409_100774574
1205 Ga0307416_100192831
1206 Ga0307416_100227943
1207 Ga0307416_103876822
1208 Ga0307414_10044210
1209 Ga0307411_11288430
1210 Ga0307415_100011314
1211 Ga0307415_100320886
1212 Ga0307415_101761305
1213 Ga0373926_0108048
1214 Ga0373944_0061829
1215 Ga0373949_0180483
1216 Ga0373932_0103481
1217 Ga0373939_0044230
1218 Ga0373945_0400446
1219 Ga0373956_0346717
1220 Ga0373960_0351755
1221 Ga0373961_0178031
1222 Ga0373935_0169210
1223 Ga0373927_0003185
1224 Ga0373927_1163766
1225 Ga0373925_0022328
1226 Ga0373925_0452612
1227 Ga0373925_1337746
1228 Ga0373925_1571390
1229 Ga0395898_0306886
1230 Ga0395905_0893081
1231 Ga0436364_0646974
1232 Ga0436364_0731417
1233 Ga0436364_1190728
1234 Ga0436365_1596339
1235 Ga0436365_1830276
1236 Ga0436363_0237146
1237 Ga0436362_0029453
1238 Ga0439461_0221614
1239 Ga0451789_0012155
1240 Ga0451798_0774197
1241 Ga0451807_0343017
1242 Ga0451845_0448117
1243 Ga0451851_1358438
1244 Ga0439431_0006595
1245 Ga0439433_0016514
1246 Ga0439443_060279
1247 Ga0439449_0075659
1248 Ga0439449_0225421
1249 Ga0439462_0041800
1250 Ga0450921_018972
1251 Ga0450923_029099
1252 Ga0439446_0014825
1253 Ga0439435_0002156
1254 Ga0439444_0040699
1255 Ga0439459_0140542
1256 Ga0439464_0111079
1257 Ga0439464_0148990
1258 Ga0450916_085240
1259 Ga0450893_0030954
1260 Ga0453683_0551541
1261 Ga0451576_0077706
1262 Ga0451576_0354285
1263 Ga0451576_1128817
1264 Ga0466958_0832297
1265 Ga0495629_0640740
1266 Ga0495638_0030934
1267 Ga0495580_0104887
1268 Ga0495580_0571291
1269 Ga0495580_1065100
1270 Ga0495628_0369084
1271 Ga0495665_0439846
1272 Ga0495621_0004261
1273 Ga0495659_0232011
1274 Ga0495647_0128449
1275 Ga0495669_0090562
1276 Ga0495670_0771100
1277 Ga0495581_0394329
1278 Ga0495604_0624305
1279 Ga0495636_0033192
1280 Ga0495672_0313945
1281 Ga0495676_0843254
1282 Ga0496100_0282791
1283 Ga0496100_1091068
1284 Ga0496101_1117435
1285 Ga0496102_0247685
1286 Ga0496102_0940125
1287 Ga0496104_0004429
1288 Ga0496104_0670579
1289 Ga0496105_0045182
1290 Ga0496106_0590842
1291 Ga0496106_1473405
1292 Ga0496108_0004961
1293 Ga0496108_0203650
1294 Ga0496109_0002196
1295 Ga0496110_0004328
1296 Ga0496110_1126747
1297 Ga0496111_1205199
1298 Ga0496112_0004771
1299 Ga0496112_0822972
1300 Ga0496113_0092965
1301 Ga0496113_0807883
1302 Ga0496114_1091181
1303 Ga0496115_0252061
1304 Ga0496115_0714534
1305 Ga0501299_113442
1306 Ga0501036_1542231
1307 Ga0501040_0377624
1308 Ga0501040_0601806
1309 Ga0501042_0094336
1310 Ga0501048_0540551
1311 Ga0501068_0324669
1312 Ga0501068_0974072
1313 Ga0501071_0064158
1314 Ga0501072_0324074
1315 Ga0501072_1495501
1316 Ga0501073_0005902
1317 Ga0501073_0017662
1318 Ga0501074_0166424
1319 Ga0501075_0152382
1320 Ga0501075_0167912
1321 Ga0501075_0515518
1322 Ga0501075_1371317
1323 Ga0501076_0346396
1324 Ga0501076_1075998
1325 Ga0501202_179043
1326 Ga0501233_140685
1327 Ga0501235_217919
1328 Ga0501260_039680
1329 Ga0501261_103637
1330 Ga0501079_0124789
1331 Ga0501079_0807356
1332 Ga0501080_0881259
1333 Ga0501081_0382717
1334 Ga0501264_023382
1335 Ga0501270_091862
1336 Ga0501283_046384
1337 Ga0501045_0167627
1338 nmdc:mga00v17_441770_c1
1339 nmdc:mga0k408_530861_c1
1340 nmdc:mga06z11_136969_c1
1341 nmdc:mga06z11_206674_c1
1342 nmdc:mga05p37_1053700_c1
1343 nmdc:mga05p37_111518_c1
1344 nmdc:mga05p37_1252657_c1
1345 nmdc:mga05p37_135137_c1
1346 nmdc:mga05p37_15131_c1
1347 nmdc:mga05p37_167274_c1
1348 nmdc:mga05p37_173551_c1
1349 nmdc:mga05p37_17799_c1
1350 nmdc:mga05p37_2670_c1
1351 nmdc:mga05p37_272650_c1
1352 nmdc:mga05p37_30924_c1
1353 nmdc:mga05p37_659235_c1
1354 nmdc:mga05p37_65975_c1
1355 nmdc:mga05p37_897193_c1
1356 nmdc:mga09592_1003449_c1
1357 nmdc:mga09592_1058952_c1
1358 nmdc:mga09592_11439_c1
1359 nmdc:mga09592_150741_c1
1360 nmdc:mga09592_962353_c1
1361 nmdc:mga0qj67_207537_c1
1362 nmdc:mga0qj67_2887_c1
1363 nmdc:mga0qj67_432259_c1
1364 nmdc:mga0qj67_749842_c1
1365 nmdc:mga0qj67_835366_c1
1366 nmdc:mga0qj67_97562_c1
1367 nmdc:mga06r32_1323206_c1
1368 nmdc:mga06r32_1629_c1
1369 nmdc:mga06r32_1885792_c1
1370 nmdc:mga06r32_309725_c1
1371 nmdc:mga06r32_494286_c1
1372 nmdc:mga06r32_554706_c1
1373 nmdc:mga06r32_638888_c1
1374 nmdc:mga06r32_652417_c1
1375 nmdc:mga06r32_661978_c1
1376 nmdc:mga08y16_102003_c1
1377 nmdc:mga08y16_156785_c1
1378 nmdc:mga08y16_1899413_c1
1379 nmdc:mga08y16_317982_c1
1380 nmdc:mga08y16_418324_c1
1381 nmdc:mga08y16_57446_c1
1382 nmdc:mga08y16_605591_c1
1383 nmdc:mga08y16_686624_c1
1384 nmdc:mga08y16_690593_c1
1385 nmdc:mga08y16_8694_c1
1386 nmdc:mga08y16_893_c1
1387 nmdc:mga0n895_1294605_c1
1388 nmdc:mga0n895_133479_c1
1389 nmdc:mga0n895_1573701_c1
1390 nmdc:mga0n895_1794723_c1
1391 nmdc:mga0n895_243576_c1
1392 nmdc:mga0n895_39730_c1
1393 nmdc:mga0n895_53193_c1
1394 nmdc:mga0n895_633200_c1
1395 nmdc:mga0n895_868_c1
1396 nmdc:mga0rr50_165435_c1
1397 nmdc:mga0rr50_1731960_c1
1398 nmdc:mga0rr50_18339_c1
1399 nmdc:mga0rr50_1887028_c1
1400 nmdc:mga0rr50_29974_c1
1401 nmdc:mga0rr50_89391_c1
1402 nmdc:mga08x19_140309_c1
1403 nmdc:mga08x19_23823_c1
1404 nmdc:mga08x19_458083_c1
1405 nmdc:mga08x19_802575_c1
1406 nmdc:mga0a205_108637_c1
1407 nmdc:mga0a205_125953_c1
1408 nmdc:mga0a205_196274_c1
1409 nmdc:mga0a205_28361_c1
1410 nmdc:mga0a205_36148_c1
1411 nmdc:mga0a205_3665_c1
1412 nmdc:mga0a205_5907_c1
1413 nmdc:mga0a205_9446_c1
1414 nmdc:mga0a205_954238_c1
1415 Ga0500593_143359
1416 Ga0500628_088040
1417 Ga0500568_0001139
1418 Ga0501082_0633709
1419 Ga0501082_1405951
1420 Ga0530510_0254512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

22

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yg2-assembly1.cif.gz_A-2 structure of the vibrio cholerae virulence activator apha 0.9128 15 93
7cbv-assembly2.cif.gz_B crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.9118 15 95
5y8t-assembly2.cif.gz_B crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8977 15 95
5y8t-assembly1.cif.gz_A-2 crystal structure of bacillus subtilis padr in complex with p-coumaric acid 0.8934 15 95
6jyi-assembly1.cif.gz_B crystal structure of the padr-like transcriptional regulator bc1756 from bacillus cereus 0.8903 15 95
ID Description Score Start End Superfamily
af_B5DF89_682_764_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9265 12 68 1.10.10.10
af_B3DIU1_680_762_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9262 12 68 1.10.10.10
1yg2A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 15 93 1.10.10.10
5y8tC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 15 95 1.10.10.10
af_A0A2R8QBE5_694_776_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8975 8 68 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9FL99-F1-model_v4 PadR family transcriptional regulator 0.953 1 98
AF-A0A2V9ZD40-F1-model_v4 PadR family transcriptional regulator 0.9495 7 88
AF-A0A7V6RLJ2-F1-model_v4 PadR family transcriptional regulator 0.9353 14 95
AF-A0A2V9FL99-F1-model_v4 PadR family transcriptional regulator 0.9345 1 98
AF-A0A2E8E4B1-F1-model_v4 GAF domain-containing protein 0.9336 15 103 GO:0016791

Map