F476700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 710 | 280 | 710 | 70 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10089003|Ga0099794_100890032 |
| Length | 82 |
| Sequence | MVSTTITLEANKMNLVPLGNIVAALVFAFVGIFIFVIAFMVMDKLTPYHLWKEIVQEHNMALAILVGAMSLGICIIIAAAIH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 188 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 1.41 |
| Rhizosphere | 97.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10115600 | 3300003203 | Bacteria | 792 |
| 2 | Ga0065715_10525617 | 3300005293 | Unclassified | 760 |
| 3 | Ga0065715_10556172 | 3300005293 | Bacteria | 737 |
| 4 | Ga0070658_10510016 | 3300005327 | Bacteria | 1039 |
| 5 | Ga0070676_10452113 | 3300005328 | Unclassified | 903 |
| 6 | Ga0070683_100000438 | 3300005329 | Bacteria | 28908 |
| 7 | Ga0070683_100103728 | 3300005329 | Unclassified | 2680 |
| 8 | Ga0070683_100707100 | 3300005329 | Bacteria | 965 |
| 9 | Ga0070683_100716157 | 3300005329 | Bacteria | 959 |
| 10 | Ga0070683_100955708 | 3300005329 | Bacteria | 822 |
| 11 | Ga0070690_100152886 | 3300005330 | Unclassified | 1576 |
| 12 | Ga0070690_100461251 | 3300005330 | Bacteria | 944 |
| 13 | Ga0070690_101705739 | 3300005330 | Unclassified | 512 |
| 14 | Ga0070670_100014132 | 3300005331 | Bacteria | 6848 |
| 15 | Ga0070670_100150745 | 3300005331 | Bacteria | 2012 |
| 16 | Ga0068869_100002425 | 3300005334 | Bacteria | 11241 |
| 17 | Ga0068869_101588449 | 3300005334 | Unclassified | 582 |
| 18 | Ga0068869_101604483 | 3300005334 | Unclassified | 579 |
| 19 | Ga0068869_101610022 | 3300005334 | Unclassified | 578 |
| 20 | Ga0070666_10178838 | 3300005335 | Bacteria | 1487 |
| 21 | Ga0070680_100103935 | 3300005336 | Unclassified | 2360 |
| 22 | Ga0070680_100358107 | 3300005336 | Bacteria | 1241 |
| 23 | Ga0070682_100764111 | 3300005337 | Bacteria | 781 |
| 24 | Ga0068868_100329462 | 3300005338 | Bacteria | 1303 |
| 25 | Ga0068868_100521159 | 3300005338 | Bacteria | 1043 |
| 26 | Ga0068868_100861687 | 3300005338 | Bacteria | 821 |
| 27 | Ga0068868_100880733 | 3300005338 | Bacteria | 812 |
| 28 | Ga0070660_101182708 | 3300005339 | Bacteria | 648 |
| 29 | Ga0070660_101688382 | 3300005339 | Bacteria | 539 |
| 30 | Ga0070660_101766881 | 3300005339 | Bacteria | 527 |
| 31 | Ga0070689_100583276 | 3300005340 | Bacteria | 967 |
| 32 | Ga0070689_101007275 | 3300005340 | Unclassified | 741 |
| 33 | Ga0070689_101379943 | 3300005340 | Bacteria | 636 |
| 34 | Ga0070691_10709065 | 3300005341 | Bacteria | 605 |
| 35 | Ga0070687_100926687 | 3300005343 | Unclassified | 626 |
| 36 | Ga0070661_100000289 | 3300005344 | Bacteria | 40642 |
| 37 | Ga0070661_100154423 | 3300005344 | Bacteria | 1736 |
| 38 | Ga0070661_100427738 | 3300005344 | Bacteria | 1050 |
| 39 | Ga0070692_10203432 | 3300005345 | Unclassified | 1161 |
| 40 | Ga0070668_100079427 | 3300005347 | Bacteria | 2569 |
| 41 | Ga0070668_100142760 | 3300005347 | Bacteria | 1931 |
| 42 | Ga0070669_100006617 | 3300005353 | Bacteria | 8344 |
| 43 | Ga0070675_100000911 | 3300005354 | Bacteria | 21029 |
| 44 | Ga0070675_101545372 | 3300005354 | Unclassified | 612 |
| 45 | Ga0070671_100013048 | 3300005355 | Bacteria | 6697 |
| 46 | Ga0070674_101079036 | 3300005356 | Bacteria | 708 |
| 47 | Ga0070667_100002851 | 3300005367 | Bacteria | 14921 |
| 48 | Ga0070703_10001660 | 3300005406 | Bacteria | 6604 |
| 49 | Ga0070703_10456501 | 3300005406 | Unclassified | 567 |
| 50 | Ga0070709_10000507 | 3300005434 | Bacteria | 22990 |
| 51 | Ga0070709_10045904 | 3300005434 | Bacteria | 2714 |
| 52 | Ga0070709_10154070 | 3300005434 | Unclassified | 1591 |
| 53 | Ga0070709_10264690 | 3300005434 | Bacteria | 1244 |
| 54 | Ga0070709_11124098 | 3300005434 | Bacteria | 629 |
| 55 | Ga0070714_100003128 | 3300005435 | Bacteria | 12293 |
| 56 | Ga0070714_100107226 | 3300005435 | Unclassified | 2469 |
| 57 | Ga0070714_100302845 | 3300005435 | Bacteria | 1490 |
| 58 | Ga0070714_100396821 | 3300005435 | Bacteria | 1303 |
| 59 | Ga0070714_101698467 | 3300005435 | Bacteria | 617 |
| 60 | Ga0070713_100001370 | 3300005436 | Bacteria | 15591 |
| 61 | Ga0070713_100010397 | 3300005436 | Bacteria | 6720 |
| 62 | Ga0070713_100030154 | 3300005436 | Bacteria | 4304 |
| 63 | Ga0070713_100084861 | 3300005436 | Bacteria | 2711 |
| 64 | Ga0070713_100095619 | 3300005436 | Unclassified | 2563 |
| 65 | Ga0070713_100161289 | 3300005436 | Unclassified | 2002 |
| 66 | Ga0070713_100323505 | 3300005436 | Bacteria | 1425 |
| 67 | Ga0070713_100360917 | 3300005436 | Unclassified | 1350 |
| 68 | Ga0070713_101734255 | 3300005436 | Unclassified | 606 |
| 69 | Ga0070710_10159850 | 3300005437 | Bacteria | 1396 |
| 70 | Ga0070710_10280676 | 3300005437 | Bacteria | 1081 |
| 71 | Ga0070710_11022945 | 3300005437 | Unclassified | 603 |
| 72 | Ga0070710_11160455 | 3300005437 | Unclassified | 569 |
| 73 | Ga0070710_11192641 | 3300005437 | Unclassified | 562 |
| 74 | Ga0070711_100018228 | 3300005439 | Bacteria | 4479 |
| 75 | Ga0070711_100072732 | 3300005439 | Unclassified | 2426 |
| 76 | Ga0070711_100125948 | 3300005439 | Bacteria | 1901 |
| 77 | Ga0070711_100723820 | 3300005439 | Bacteria | 839 |
| 78 | Ga0070711_100783166 | 3300005439 | Unclassified | 808 |
| 79 | Ga0070705_100003341 | 3300005440 | Bacteria | 7874 |
| 80 | Ga0070705_100130161 | 3300005440 | Bacteria | 1640 |
| 81 | Ga0070700_101218881 | 3300005441 | Unclassified | 629 |
| 82 | Ga0070694_100218210 | 3300005444 | Unclassified | 1429 |
| 83 | Ga0070694_100261432 | 3300005444 | Unclassified | 1313 |
| 84 | Ga0070708_100002244 | 3300005445 | Bacteria | 14935 |
| 85 | Ga0070708_101043203 | 3300005445 | Bacteria | 766 |
| 86 | Ga0070663_100040297 | 3300005455 | Bacteria | 3269 |
| 87 | Ga0070663_101175447 | 3300005455 | Bacteria | 673 |
| 88 | Ga0070663_101908968 | 3300005455 | Bacteria | 533 |
| 89 | Ga0070662_100172467 | 3300005457 | Bacteria | 1699 |
| 90 | Ga0068867_100625791 | 3300005459 | Bacteria | 942 |
| 91 | Ga0068867_100971251 | 3300005459 | Unclassified | 768 |
| 92 | Ga0070685_10398169 | 3300005466 | Bacteria | 953 |
| 93 | Ga0070706_100001656 | 3300005467 | Bacteria | 23195 |
| 94 | Ga0070706_100383998 | 3300005467 | Bacteria | 1308 |
| 95 | Ga0070698_101266250 | 3300005471 | Unclassified | 687 |
| 96 | Ga0070699_100015160 | 3300005518 | Bacteria | 6621 |
| 97 | Ga0070679_100017595 | 3300005530 | Bacteria | 6918 |
| 98 | Ga0070679_100979679 | 3300005530 | Bacteria | 789 |
| 99 | Ga0070684_100000161 | 3300005535 | Bacteria | 45787 |
| 100 | Ga0070684_100054118 | 3300005535 | Unclassified | 3496 |
| 101 | Ga0070684_100424625 | 3300005535 | Bacteria | 1227 |
| 102 | Ga0070684_101859047 | 3300005535 | Bacteria | 568 |
| 103 | Ga0070697_100001122 | 3300005536 | Bacteria | 20239 |
| 104 | Ga0070697_100823441 | 3300005536 | Bacteria | 822 |
| 105 | Ga0068853_100002829 | 3300005539 | Bacteria | 13148 |
| 106 | Ga0068853_100053870 | 3300005539 | Bacteria | 3465 |
| 107 | Ga0068853_100243654 | 3300005539 | Bacteria | 1648 |
| 108 | Ga0068853_100383254 | 3300005539 | Bacteria | 1313 |
| 109 | Ga0070686_100814042 | 3300005544 | Unclassified | 754 |
| 110 | Ga0070695_100016838 | 3300005545 | Bacteria | 4430 |
| 111 | Ga0070695_100023474 | 3300005545 | Bacteria | 3791 |
| 112 | Ga0070695_100731539 | 3300005545 | Unclassified | 788 |
| 113 | Ga0070696_100002232 | 3300005546 | Bacteria | 12773 |
| 114 | Ga0070696_100580174 | 3300005546 | Bacteria | 902 |
| 115 | Ga0070693_100000295 | 3300005547 | Bacteria | 23286 |
| 116 | Ga0070693_100126091 | 3300005547 | Unclassified | 1594 |
| 117 | Ga0070693_100339103 | 3300005547 | Bacteria | 1025 |
| 118 | Ga0070665_100001033 | 3300005548 | Bacteria | 34868 |
| 119 | Ga0070665_100019217 | 3300005548 | Bacteria | 6854 |
| 120 | Ga0070665_100073606 | 3300005548 | Bacteria | 3422 |
| 121 | Ga0070704_100007127 | 3300005549 | Bacteria | 6640 |
| 122 | Ga0070704_101962432 | 3300005549 | Unclassified | 543 |
| 123 | Ga0068855_100003811 | 3300005563 | Bacteria | 18432 |
| 124 | Ga0068855_100360311 | 3300005563 | Bacteria | 1600 |
| 125 | Ga0070664_100238972 | 3300005564 | Unclassified | 1630 |
| 126 | Ga0068857_100003923 | 3300005577 | Bacteria | 12520 |
| 127 | Ga0068857_100004193 | 3300005577 | Bacteria | 12134 |
| 128 | Ga0068854_100109442 | 3300005578 | Unclassified | 2082 |
| 129 | Ga0068854_100351078 | 3300005578 | Bacteria | 1207 |
| 130 | Ga0068854_101390538 | 3300005578 | Unclassified | 634 |
| 131 | Ga0068856_100010164 | 3300005614 | Bacteria | 9146 |
| 132 | Ga0068856_100016286 | 3300005614 | Bacteria | 7194 |
| 133 | Ga0068856_100026736 | 3300005614 | Bacteria | 5626 |
| 134 | Ga0068856_100036270 | 3300005614 | Bacteria | 4835 |
| 135 | Ga0068852_100000168 | 3300005616 | Bacteria | 43887 |
| 136 | Ga0068852_100196217 | 3300005616 | Bacteria | 1908 |
| 137 | Ga0068852_100237394 | 3300005616 | Bacteria | 1740 |
| 138 | Ga0068859_100014850 | 3300005617 | Bacteria | 7820 |
| 139 | Ga0068859_100367443 | 3300005617 | Bacteria | 1534 |
| 140 | Ga0068859_100820700 | 3300005617 | Bacteria | 1017 |
| 141 | Ga0068859_101039209 | 3300005617 | Unclassified | 900 |
| 142 | Ga0068859_101272925 | 3300005617 | Unclassified | 810 |
| 143 | Ga0068864_100000766 | 3300005618 | Bacteria | 27024 |
| 144 | Ga0068864_100092675 | 3300005618 | Bacteria | 2667 |
| 145 | Ga0068864_102024714 | 3300005618 | Unclassified | 582 |
| 146 | Ga0068866_10055421 | 3300005718 | Bacteria | 2036 |
| 147 | Ga0068866_10157226 | 3300005718 | Unclassified | 1322 |
| 148 | Ga0068866_10394531 | 3300005718 | Bacteria | 891 |
| 149 | Ga0068861_100120644 | 3300005719 | Bacteria | 2115 |
| 150 | Ga0068861_100459299 | 3300005719 | Bacteria | 1143 |
| 151 | Ga0068861_101368875 | 3300005719 | Unclassified | 690 |
| 152 | Ga0068861_101412505 | 3300005719 | Unclassified | 680 |
| 153 | Ga0068851_10020291 | 3300005834 | Bacteria | 3216 |
| 154 | Ga0068851_10197177 | 3300005834 | Unclassified | 1122 |
| 155 | Ga0068851_11021028 | 3300005834 | Unclassified | 522 |
| 156 | Ga0068870_10625745 | 3300005840 | Bacteria | 734 |
| 157 | Ga0068863_100056211 | 3300005841 | Unclassified | 3726 |
| 158 | Ga0068863_101368418 | 3300005841 | Bacteria | 715 |
| 159 | Ga0068863_101530890 | 3300005841 | Bacteria | 676 |
| 160 | Ga0068858_100001558 | 3300005842 | Bacteria | 23497 |
| 161 | Ga0068858_100035778 | 3300005842 | Bacteria | 4605 |
| 162 | Ga0068858_100251338 | 3300005842 | Unclassified | 1679 |
| 163 | Ga0068860_100000853 | 3300005843 | Bacteria | 34017 |
| 164 | Ga0068860_100271543 | 3300005843 | Unclassified | 1655 |
| 165 | Ga0068860_100313462 | 3300005843 | Bacteria | 1539 |
| 166 | Ga0068860_101003503 | 3300005843 | Bacteria | 853 |
| 167 | Ga0068862_100073831 | 3300005844 | Unclassified | 2948 |
| 168 | Ga0081455_10729459 | 3300005937 | Bacteria | 628 |
| 169 | Ga0081539_10007242 | 3300005985 | Bacteria | 10194 |
| 170 | Ga0070717_10012117 | 3300006028 | Bacteria | 6571 |
| 171 | Ga0070717_10374526 | 3300006028 | Unclassified | 1276 |
| 172 | Ga0070717_10630547 | 3300006028 | Bacteria | 973 |
| 173 | Ga0070717_10709328 | 3300006028 | Unclassified | 914 |
| 174 | Ga0070717_11457961 | 3300006028 | Bacteria | 621 |
| 175 | Ga0070715_10000253 | 3300006163 | Bacteria | 12883 |
| 176 | Ga0070715_10034982 | 3300006163 | Bacteria | 2063 |
| 177 | Ga0070715_10215973 | 3300006163 | Bacteria | 983 |
| 178 | Ga0070715_10238212 | 3300006163 | Unclassified | 945 |
| 179 | Ga0070715_10557938 | 3300006163 | Bacteria | 665 |
| 180 | Ga0070716_100000178 | 3300006173 | Bacteria | 24984 |
| 181 | Ga0070716_100000490 | 3300006173 | Bacteria | 16446 |
| 182 | Ga0070716_100042800 | 3300006173 | Bacteria | 2530 |
| 183 | Ga0070716_100368242 | 3300006173 | Bacteria | 1023 |
| 184 | Ga0070716_100495241 | 3300006173 | Bacteria | 900 |
| 185 | Ga0070712_100000621 | 3300006175 | Bacteria | 20835 |
| 186 | Ga0070712_100018290 | 3300006175 | Unclassified | 4549 |
| 187 | Ga0070712_100154487 | 3300006175 | Bacteria | 1765 |
| 188 | Ga0070712_100195428 | 3300006175 | Bacteria | 1586 |
| 189 | Ga0070712_100226607 | 3300006175 | Bacteria | 1482 |
| 190 | Ga0070712_100286398 | 3300006175 | Unclassified | 1329 |
| 191 | Ga0070712_100471613 | 3300006175 | Bacteria | 1048 |
| 192 | Ga0070712_100547975 | 3300006175 | Bacteria | 974 |
| 193 | Ga0070712_100818760 | 3300006175 | Bacteria | 800 |
| 194 | Ga0097621_100002181 | 3300006237 | Bacteria | 13401 |
| 195 | Ga0097621_100046304 | 3300006237 | Bacteria | 3519 |
| 196 | Ga0097621_100279714 | 3300006237 | Bacteria | 1469 |
| 197 | Ga0097621_101366303 | 3300006237 | Bacteria | 670 |
| 198 | Ga0068871_100041280 | 3300006358 | Unclassified | 3698 |
| 199 | Ga0068871_100052553 | 3300006358 | Bacteria | 3300 |
| 200 | Ga0068871_100332729 | 3300006358 | Bacteria | 1340 |
| 201 | Ga0068871_101000732 | 3300006358 | Unclassified | 778 |
| 202 | Ga0075428_100001386 | 3300006844 | Bacteria | 25810 |
| 203 | Ga0075428_100077778 | 3300006844 | Bacteria | 3621 |
| 204 | Ga0075428_100166723 | 3300006844 | Bacteria | 2389 |
| 205 | Ga0075430_100016434 | 3300006846 | Bacteria | 6301 |
| 206 | Ga0075431_100001716 | 3300006847 | Bacteria | 20598 |
| 207 | Ga0075431_100944516 | 3300006847 | Bacteria | 831 |
| 208 | Ga0075431_100982536 | 3300006847 | Unclassified | 812 |
| 209 | Ga0075433_10070444 | 3300006852 | Bacteria | 3073 |
| 210 | Ga0075433_10146922 | 3300006852 | Bacteria | 2096 |
| 211 | Ga0075433_10354082 | 3300006852 | Bacteria | 1297 |
| 212 | Ga0075433_11002137 | 3300006852 | Unclassified | 728 |
| 213 | Ga0075434_100010157 | 3300006871 | Bacteria | 8819 |
| 214 | Ga0075434_100032344 | 3300006871 | Bacteria | 5159 |
| 215 | Ga0075434_100200547 | 3300006871 | Bacteria | 2015 |
| 216 | Ga0075434_100304454 | 3300006871 | Bacteria | 1614 |
| 217 | Ga0075434_101379297 | 3300006871 | Unclassified | 715 |
| 218 | Ga0075434_101555358 | 3300006871 | Bacteria | 670 |
| 219 | Ga0075434_101805847 | 3300006871 | Unclassified | 618 |
| 220 | Ga0075429_100035141 | 3300006880 | Bacteria | 4357 |
| 221 | Ga0075429_101549598 | 3300006880 | Bacteria | 576 |
| 222 | Ga0068865_100054311 | 3300006881 | Bacteria | 2783 |
| 223 | Ga0068865_100874566 | 3300006881 | Bacteria | 780 |
| 224 | Ga0068865_101425863 | 3300006881 | Bacteria | 619 |
| 225 | Ga0075436_100000734 | 3300006914 | Bacteria | 21719 |
| 226 | Ga0075436_100023339 | 3300006914 | Bacteria | 4249 |
| 227 | Ga0075436_100258236 | 3300006914 | Bacteria | 1242 |
| 228 | Ga0097620_100014850 | 3300006931 | Bacteria | 7820 |
| 229 | Ga0097620_100367417 | 3300006931 | Bacteria | 1534 |
| 230 | Ga0097620_100820571 | 3300006931 | Bacteria | 1017 |
| 231 | Ga0097620_101038901 | 3300006931 | Unclassified | 900 |
| 232 | Ga0097620_101272729 | 3300006931 | Unclassified | 810 |
| 233 | Ga0075435_100049318 | 3300007076 | Bacteria | 3386 |
| 234 | Ga0075435_100139239 | 3300007076 | Bacteria | 2035 |
| 235 | Ga0075435_100675337 | 3300007076 | Bacteria | 897 |
| 236 | Ga0099794_10014819 | 3300007265 | Bacteria | 3426 |
| 237 | Ga0099794_10089003 | 3300007265 | Bacteria | 1530 |
| 238 | Ga0099794_10145911 | 3300007265 | Bacteria | 1200 |
| 239 | Ga0099794_10184624 | 3300007265 | Bacteria | 1065 |
| 240 | Ga0099794_10253522 | 3300007265 | Unclassified | 908 |
| 241 | Ga0099794_10275485 | 3300007265 | Bacteria | 869 |
| 242 | Ga0099794_10324344 | 3300007265 | Bacteria | 799 |
| 243 | Ga0099794_10471416 | 3300007265 | Bacteria | 659 |
| 244 | Ga0099795_10009030 | 3300007788 | Unclassified | 2875 |
| 245 | Ga0105240_10000594 | 3300009093 | Bacteria | 67129 |
| 246 | Ga0105240_10004531 | 3300009093 | Bacteria | 21107 |
| 247 | Ga0105240_10008135 | 3300009093 | Bacteria | 15045 |
| 248 | Ga0105240_10015824 | 3300009093 | Bacteria | 10232 |
| 249 | Ga0105240_10095144 | 3300009093 | Bacteria | 3632 |
| 250 | Ga0105240_10951919 | 3300009093 | Unclassified | 921 |
| 251 | Ga0105240_11867307 | 3300009093 | Bacteria | 625 |
| 252 | Ga0111539_10646729 | 3300009094 | Unclassified | 1231 |
| 253 | Ga0105245_10002548 | 3300009098 | Bacteria | 16410 |
| 254 | Ga0105245_10007961 | 3300009098 | Bacteria | 9267 |
| 255 | Ga0105245_10038935 | 3300009098 | Bacteria | 4231 |
| 256 | Ga0105245_10179032 | 3300009098 | Bacteria | 2024 |
| 257 | Ga0105247_10000309 | 3300009101 | Bacteria | 43841 |
| 258 | Ga0105247_10030211 | 3300009101 | Bacteria | 3284 |
| 259 | Ga0105247_10350217 | 3300009101 | Bacteria | 1038 |
| 260 | Ga0105247_11074752 | 3300009101 | Bacteria | 633 |
| 261 | Ga0114129_10000075 | 3300009147 | Bacteria | 91461 |
| 262 | Ga0114129_10027832 | 3300009147 | Bacteria | 8006 |
| 263 | Ga0114129_10986889 | 3300009147 | Unclassified | 1061 |
| 264 | Ga0105243_10320718 | 3300009148 | Unclassified | 1412 |
| 265 | Ga0105243_10859482 | 3300009148 | Bacteria | 899 |
| 266 | Ga0105241_10000484 | 3300009174 | Bacteria | 30045 |
| 267 | Ga0105241_10002430 | 3300009174 | Bacteria | 13979 |
| 268 | Ga0105241_10025344 | 3300009174 | Bacteria | 4406 |
| 269 | Ga0105241_10217895 | 3300009174 | Bacteria | 1602 |
| 270 | Ga0105241_10272123 | 3300009174 | Bacteria | 1443 |
| 271 | Ga0105241_10322899 | 3300009174 | Bacteria | 1332 |
| 272 | Ga0105241_10473236 | 3300009174 | Bacteria | 1112 |
| 273 | Ga0105241_10902298 | 3300009174 | Bacteria | 821 |
| 274 | Ga0105241_12438448 | 3300009174 | Unclassified | 523 |
| 275 | Ga0105241_12560763 | 3300009174 | Unclassified | 512 |
| 276 | Ga0105242_10028411 | 3300009176 | Bacteria | 4453 |
| 277 | Ga0105242_10156317 | 3300009176 | Bacteria | 1992 |
| 278 | Ga0105242_11495424 | 3300009176 | Bacteria | 706 |
| 279 | Ga0105248_10002507 | 3300009177 | Bacteria | 20434 |
| 280 | Ga0105248_10021050 | 3300009177 | Bacteria | 7226 |
| 281 | Ga0105248_10440821 | 3300009177 | Bacteria | 1467 |
| 282 | Ga0105237_10006164 | 3300009545 | Bacteria | 13401 |
| 283 | Ga0105237_10013070 | 3300009545 | Bacteria | 8717 |
| 284 | Ga0105237_10070700 | 3300009545 | Bacteria | 3486 |
| 285 | Ga0105237_10099970 | 3300009545 | Bacteria | 2891 |
| 286 | Ga0105237_10207649 | 3300009545 | Bacteria | 1959 |
| 287 | Ga0105237_10740213 | 3300009545 | Bacteria | 990 |
| 288 | Ga0105238_10000158 | 3300009551 | Bacteria | 74148 |
| 289 | Ga0105238_10003457 | 3300009551 | Bacteria | 15713 |
| 290 | Ga0105238_10003686 | 3300009551 | Bacteria | 15258 |
| 291 | Ga0105238_10063836 | 3300009551 | Bacteria | 3684 |
| 292 | Ga0105238_10818623 | 3300009551 | Bacteria | 947 |
| 293 | Ga0105249_10018782 | 3300009553 | Bacteria | 6160 |
| 294 | Ga0105249_10151901 | 3300009553 | Bacteria | 2230 |
| 295 | Ga0105239_10002973 | 3300010375 | Bacteria | 21140 |
| 296 | Ga0105239_10005034 | 3300010375 | Bacteria | 15602 |
| 297 | Ga0105239_10006631 | 3300010375 | Bacteria | 13401 |
| 298 | Ga0105239_10161015 | 3300010375 | Bacteria | 2507 |
| 299 | Ga0105239_10308132 | 3300010375 | Bacteria | 1784 |
| 300 | Ga0105239_10532499 | 3300010375 | Bacteria | 1337 |
| 301 | Ga0105239_11307544 | 3300010375 | Unclassified | 836 |
| 302 | Ga0105239_11858183 | 3300010375 | Unclassified | 698 |
| 303 | Ga0105239_13611574 | 3300010375 | Unclassified | 503 |
| 304 | Ga0105246_10097058 | 3300011119 | Unclassified | 2137 |
| 305 | Ga0105246_10440380 | 3300011119 | Bacteria | 1093 |
| 306 | Ga0157373_10854251 | 3300013100 | Bacteria | 673 |
| 307 | Ga0157371_10958241 | 3300013102 | Unclassified | 651 |
| 308 | Ga0157370_10370282 | 3300013104 | Bacteria | 1320 |
| 309 | Ga0157369_10012629 | 3300013105 | Bacteria | 9577 |
| 310 | Ga0157369_10040898 | 3300013105 | Bacteria | 5059 |
| 311 | Ga0157369_10164003 | 3300013105 | Unclassified | 2344 |
| 312 | Ga0157369_10285123 | 3300013105 | Bacteria | 1720 |
| 313 | Ga0157374_10003280 | 3300013296 | Bacteria | 13597 |
| 314 | Ga0157374_10023342 | 3300013296 | Bacteria | 5532 |
| 315 | Ga0157374_10036252 | 3300013296 | Bacteria | 4517 |
| 316 | Ga0157374_10060655 | 3300013296 | Bacteria | 3540 |
| 317 | Ga0157374_10100913 | 3300013296 | Bacteria | 2767 |
| 318 | Ga0157374_10229993 | 3300013296 | Bacteria | 1821 |
| 319 | Ga0157374_10914933 | 3300013296 | Bacteria | 895 |
| 320 | Ga0157378_10001627 | 3300013297 | Bacteria | 20310 |
| 321 | Ga0157378_10015460 | 3300013297 | Bacteria | 6686 |
| 322 | Ga0157378_10019350 | 3300013297 | Bacteria | 5986 |
| 323 | Ga0157378_10052473 | 3300013297 | Unclassified | 3628 |
| 324 | Ga0157378_10398606 | 3300013297 | Bacteria | 1355 |
| 325 | Ga0157378_10937446 | 3300013297 | Unclassified | 898 |
| 326 | Ga0157378_11578690 | 3300013297 | Bacteria | 702 |
| 327 | Ga0163162_10038434 | 3300013306 | Bacteria | 4776 |
| 328 | Ga0163162_10042583 | 3300013306 | Bacteria | 4545 |
| 329 | Ga0163162_10054169 | 3300013306 | Bacteria | 4034 |
| 330 | Ga0163162_10216306 | 3300013306 | Unclassified | 2046 |
| 331 | Ga0163162_10349710 | 3300013306 | Unclassified | 1611 |
| 332 | Ga0163162_10973049 | 3300013306 | Bacteria | 959 |
| 333 | Ga0163162_12918810 | 3300013306 | Bacteria | 550 |
| 334 | Ga0157372_10008726 | 3300013307 | Bacteria | 10767 |
| 335 | Ga0157372_10031843 | 3300013307 | Bacteria | 5779 |
| 336 | Ga0157372_10112498 | 3300013307 | Bacteria | 3119 |
| 337 | Ga0157372_10113109 | 3300013307 | Bacteria | 3111 |
| 338 | Ga0157372_10242079 | 3300013307 | Bacteria | 2093 |
| 339 | Ga0157372_10362242 | 3300013307 | Bacteria | 1690 |
| 340 | Ga0157375_10001472 | 3300013308 | Bacteria | 20241 |
| 341 | Ga0157375_10006442 | 3300013308 | Bacteria | 10225 |
| 342 | Ga0157375_10265626 | 3300013308 | Bacteria | 1878 |
| 343 | Ga0157375_10667818 | 3300013308 | Unclassified | 1194 |
| 344 | Ga0163163_10406866 | 3300014325 | Bacteria | 1419 |
| 345 | Ga0163163_10794279 | 3300014325 | Bacteria | 1010 |
| 346 | Ga0163163_12209526 | 3300014325 | Unclassified | 609 |
| 347 | Ga0157380_10147330 | 3300014326 | Bacteria | 2030 |
| 348 | Ga0157377_10048888 | 3300014745 | Bacteria | 2375 |
| 349 | Ga0157377_10197526 | 3300014745 | Bacteria | 1275 |
| 350 | Ga0157379_10009173 | 3300014968 | Bacteria | 8618 |
| 351 | Ga0157379_10145884 | 3300014968 | Bacteria | 2134 |
| 352 | Ga0157379_11237236 | 3300014968 | Unclassified | 719 |
| 353 | Ga0157379_11695134 | 3300014968 | Bacteria | 619 |
| 354 | Ga0157379_11723075 | 3300014968 | Bacteria | 614 |
| 355 | Ga0157376_10000792 | 3300014969 | Bacteria | 20695 |
| 356 | Ga0157376_10001580 | 3300014969 | Bacteria | 15053 |
| 357 | Ga0157376_10047148 | 3300014969 | Bacteria | 3556 |
| 358 | Ga0157376_10458529 | 3300014969 | Bacteria | 1245 |
| 359 | Ga0157376_10541961 | 3300014969 | Bacteria | 1150 |
| 360 | Ga0163161_10325414 | 3300017792 | Bacteria | 1216 |
| 361 | Ga0213872_10416486 | 3300021361 | Unclassified | 543 |
| 362 | Ga0228598_1006840 | 3300024227 | Bacteria | 2344 |
| 363 | Ga0207697_10052748 | 3300025315 | Bacteria | 1683 |
| 364 | Ga0207656_10026621 | 3300025321 | Bacteria | 2360 |
| 365 | Ga0207656_10057595 | 3300025321 | Bacteria | 1696 |
| 366 | Ga0207656_10086396 | 3300025321 | Bacteria | 1417 |
| 367 | Ga0207653_10001051 | 3300025885 | Bacteria | 9083 |
| 368 | Ga0207692_10199554 | 3300025898 | Bacteria | 1175 |
| 369 | Ga0207692_10455578 | 3300025898 | Bacteria | 806 |
| 370 | Ga0207692_10787837 | 3300025898 | Bacteria | 621 |
| 371 | Ga0207642_10317225 | 3300025899 | Bacteria | 909 |
| 372 | Ga0207642_10561542 | 3300025899 | Bacteria | 706 |
| 373 | Ga0207710_10000259 | 3300025900 | Bacteria | 43990 |
| 374 | Ga0207710_10238097 | 3300025900 | Bacteria | 907 |
| 375 | Ga0207710_10554229 | 3300025900 | Unclassified | 599 |
| 376 | Ga0207680_10251332 | 3300025903 | Bacteria | 1221 |
| 377 | Ga0207680_10754606 | 3300025903 | Bacteria | 697 |
| 378 | Ga0207647_10203928 | 3300025904 | Bacteria | 1143 |
| 379 | Ga0207685_10004549 | 3300025905 | Unclassified | 3544 |
| 380 | Ga0207685_10034299 | 3300025905 | Bacteria | 1842 |
| 381 | Ga0207685_10414292 | 3300025905 | Unclassified | 693 |
| 382 | Ga0207685_10578928 | 3300025905 | Bacteria | 600 |
| 383 | Ga0207699_10001122 | 3300025906 | Bacteria | 12669 |
| 384 | Ga0207699_10051030 | 3300025906 | Bacteria | 2443 |
| 385 | Ga0207699_11186629 | 3300025906 | Bacteria | 565 |
| 386 | Ga0207643_10732606 | 3300025908 | Bacteria | 640 |
| 387 | Ga0207705_10167405 | 3300025909 | Bacteria | 1654 |
| 388 | Ga0207705_10551370 | 3300025909 | Bacteria | 896 |
| 389 | Ga0207705_11108553 | 3300025909 | Bacteria | 609 |
| 390 | Ga0207684_10054909 | 3300025910 | Bacteria | 3380 |
| 391 | Ga0207654_10000151 | 3300025911 | Bacteria | 43832 |
| 392 | Ga0207654_10000976 | 3300025911 | Bacteria | 15728 |
| 393 | Ga0207654_10004755 | 3300025911 | Bacteria | 6877 |
| 394 | Ga0207654_10626877 | 3300025911 | Bacteria | 769 |
| 395 | Ga0207654_10720851 | 3300025911 | Bacteria | 717 |
| 396 | Ga0207654_10976403 | 3300025911 | Bacteria | 616 |
| 397 | Ga0207695_10000188 | 3300025913 | Bacteria | 178721 |
| 398 | Ga0207695_10001158 | 3300025913 | Bacteria | 45742 |
| 399 | Ga0207695_10001234 | 3300025913 | Bacteria | 43772 |
| 400 | Ga0207695_10089462 | 3300025913 | Bacteria | 3096 |
| 401 | Ga0207695_10171220 | 3300025913 | Unclassified | 2097 |
| 402 | Ga0207695_10412675 | 3300025913 | Bacteria | 1235 |
| 403 | Ga0207671_10000942 | 3300025914 | Bacteria | 36249 |
| 404 | Ga0207671_10003174 | 3300025914 | Bacteria | 16603 |
| 405 | Ga0207671_10060323 | 3300025914 | Bacteria | 2814 |
| 406 | Ga0207671_10398154 | 3300025914 | Bacteria | 1095 |
| 407 | Ga0207671_11356380 | 3300025914 | Unclassified | 552 |
| 408 | Ga0207693_10000087 | 3300025915 | Bacteria | 82834 |
| 409 | Ga0207693_10012010 | 3300025915 | Bacteria | 7001 |
| 410 | Ga0207693_10058732 | 3300025915 | Bacteria | 3013 |
| 411 | Ga0207693_10277123 | 3300025915 | Bacteria | 1314 |
| 412 | Ga0207693_10331581 | 3300025915 | Bacteria | 1191 |
| 413 | Ga0207693_10900236 | 3300025915 | Unclassified | 679 |
| 414 | Ga0207663_10007120 | 3300025916 | Bacteria | 5779 |
| 415 | Ga0207663_10023743 | 3300025916 | Bacteria | 3524 |
| 416 | Ga0207663_10081288 | 3300025916 | Bacteria | 2121 |
| 417 | Ga0207663_10257266 | 3300025916 | Bacteria | 1288 |
| 418 | Ga0207663_10435253 | 3300025916 | Bacteria | 1009 |
| 419 | Ga0207663_10594328 | 3300025916 | Unclassified | 869 |
| 420 | Ga0207660_10098100 | 3300025917 | Unclassified | 2185 |
| 421 | Ga0207660_10272638 | 3300025917 | Bacteria | 1341 |
| 422 | Ga0207662_10315445 | 3300025918 | Bacteria | 1043 |
| 423 | Ga0207662_11001301 | 3300025918 | Bacteria | 593 |
| 424 | Ga0207657_11452719 | 3300025919 | Bacteria | 514 |
| 425 | Ga0207649_10026172 | 3300025920 | Unclassified | 3411 |
| 426 | Ga0207649_10139682 | 3300025920 | Bacteria | 1656 |
| 427 | Ga0207652_10013414 | 3300025921 | Bacteria | 6632 |
| 428 | Ga0207646_11643632 | 3300025922 | Bacteria | 553 |
| 429 | Ga0207681_10419035 | 3300025923 | Bacteria | 1084 |
| 430 | Ga0207694_10000083 | 3300025924 | Bacteria | 109611 |
| 431 | Ga0207694_10000290 | 3300025924 | Bacteria | 47323 |
| 432 | Ga0207694_10001818 | 3300025924 | Bacteria | 17771 |
| 433 | Ga0207694_10160000 | 3300025924 | Bacteria | 1818 |
| 434 | Ga0207694_10552723 | 3300025924 | Bacteria | 966 |
| 435 | Ga0207650_10036753 | 3300025925 | Unclassified | 3564 |
| 436 | Ga0207650_10295455 | 3300025925 | Bacteria | 1322 |
| 437 | Ga0207659_10000077 | 3300025926 | Bacteria | 62077 |
| 438 | Ga0207687_10004527 | 3300025927 | Bacteria | 9251 |
| 439 | Ga0207687_10005315 | 3300025927 | Bacteria | 8526 |
| 440 | Ga0207687_10025686 | 3300025927 | Unclassified | 3942 |
| 441 | Ga0207687_10404208 | 3300025927 | Bacteria | 1124 |
| 442 | Ga0207700_10004413 | 3300025928 | Bacteria | 8293 |
| 443 | Ga0207700_10007789 | 3300025928 | Bacteria | 6582 |
| 444 | Ga0207700_10176955 | 3300025928 | Unclassified | 1783 |
| 445 | Ga0207700_10189481 | 3300025928 | Bacteria | 1728 |
| 446 | Ga0207700_10263921 | 3300025928 | Bacteria | 1475 |
| 447 | Ga0207700_10621205 | 3300025928 | Bacteria | 962 |
| 448 | Ga0207700_10642004 | 3300025928 | Bacteria | 946 |
| 449 | Ga0207700_11078737 | 3300025928 | Bacteria | 718 |
| 450 | Ga0207664_10016879 | 3300025929 | Bacteria | 5338 |
| 451 | Ga0207664_11330818 | 3300025929 | Bacteria | 638 |
| 452 | Ga0207644_10015999 | 3300025931 | Bacteria | 5043 |
| 453 | Ga0207644_11105805 | 3300025931 | Bacteria | 666 |
| 454 | Ga0207706_10058516 | 3300025933 | Bacteria | 3394 |
| 455 | Ga0207686_10036251 | 3300025934 | Bacteria | 2968 |
| 456 | Ga0207686_10236802 | 3300025934 | Bacteria | 1326 |
| 457 | Ga0207686_10614149 | 3300025934 | Bacteria | 857 |
| 458 | Ga0207686_10700869 | 3300025934 | Bacteria | 805 |
| 459 | Ga0207709_10113776 | 3300025935 | Bacteria | 1814 |
| 460 | Ga0207670_10505697 | 3300025936 | Bacteria | 982 |
| 461 | Ga0207669_10819732 | 3300025937 | Bacteria | 773 |
| 462 | Ga0207669_11347430 | 3300025937 | Unclassified | 607 |
| 463 | Ga0207704_10573485 | 3300025938 | Bacteria | 920 |
| 464 | Ga0207665_10000015 | 3300025939 | Bacteria | 133147 |
| 465 | Ga0207665_10001233 | 3300025939 | Bacteria | 17248 |
| 466 | Ga0207665_10161663 | 3300025939 | Bacteria | 1611 |
| 467 | Ga0207665_10360962 | 3300025939 | Bacteria | 1098 |
| 468 | Ga0207665_10392906 | 3300025939 | Bacteria | 1055 |
| 469 | Ga0207691_10037114 | 3300025940 | Bacteria | 4513 |
| 470 | Ga0207711_10006467 | 3300025941 | Bacteria | 9862 |
| 471 | Ga0207711_10025346 | 3300025941 | Bacteria | 4975 |
| 472 | Ga0207711_10945457 | 3300025941 | Unclassified | 801 |
| 473 | Ga0207711_11074533 | 3300025941 | Bacteria | 745 |
| 474 | Ga0207689_10002236 | 3300025942 | Bacteria | 18132 |
| 475 | Ga0207689_10914683 | 3300025942 | Bacteria | 740 |
| 476 | Ga0207661_10026192 | 3300025944 | Bacteria | 4440 |
| 477 | Ga0207661_10272687 | 3300025944 | Unclassified | 1510 |
| 478 | Ga0207661_10595130 | 3300025944 | Bacteria | 1015 |
| 479 | Ga0207661_10845623 | 3300025944 | Bacteria | 842 |
| 480 | Ga0207661_10854579 | 3300025944 | Unclassified | 838 |
| 481 | Ga0207679_10216289 | 3300025945 | Bacteria | 1610 |
| 482 | Ga0207667_10004502 | 3300025949 | Bacteria | 17076 |
| 483 | Ga0207712_10062469 | 3300025961 | Unclassified | 2648 |
| 484 | Ga0207712_10099148 | 3300025961 | Bacteria | 2162 |
| 485 | Ga0207668_10189174 | 3300025972 | Bacteria | 1630 |
| 486 | Ga0207668_10499826 | 3300025972 | Bacteria | 1046 |
| 487 | Ga0207640_10100448 | 3300025981 | Bacteria | 2027 |
| 488 | Ga0207640_10340635 | 3300025981 | Bacteria | 1201 |
| 489 | Ga0207640_10905231 | 3300025981 | Unclassified | 771 |
| 490 | Ga0207658_10002295 | 3300025986 | Bacteria | 14127 |
| 491 | Ga0207677_10001520 | 3300026023 | Bacteria | 12266 |
| 492 | Ga0207677_10236897 | 3300026023 | Bacteria | 1474 |
| 493 | Ga0207677_10316522 | 3300026023 | Bacteria | 1295 |
| 494 | Ga0207703_10010887 | 3300026035 | Bacteria | 7091 |
| 495 | Ga0207703_10025580 | 3300026035 | Bacteria | 4643 |
| 496 | Ga0207703_12224117 | 3300026035 | Unclassified | 524 |
| 497 | Ga0207639_10000027 | 3300026041 | Bacteria | 197829 |
| 498 | Ga0207639_10029598 | 3300026041 | Unclassified | 4011 |
| 499 | Ga0207639_10068385 | 3300026041 | Bacteria | 2768 |
| 500 | Ga0207639_10083705 | 3300026041 | Bacteria | 2532 |
| 501 | Ga0207639_10353263 | 3300026041 | Bacteria | 1313 |
| 502 | Ga0207678_10024846 | 3300026067 | Bacteria | 5231 |
| 503 | Ga0207678_10302149 | 3300026067 | Bacteria | 1375 |
| 504 | Ga0207702_10000823 | 3300026078 | Bacteria | 32729 |
| 505 | Ga0207702_10015372 | 3300026078 | Bacteria | 6343 |
| 506 | Ga0207702_10038960 | 3300026078 | Unclassified | 3981 |
| 507 | Ga0207702_11064639 | 3300026078 | Bacteria | 803 |
| 508 | Ga0207641_10001089 | 3300026088 | Bacteria | 27318 |
| 509 | Ga0207641_10651047 | 3300026088 | Bacteria | 1035 |
| 510 | Ga0207648_10168510 | 3300026089 | Bacteria | 1935 |
| 511 | Ga0207676_10013135 | 3300026095 | Bacteria | 5945 |
| 512 | Ga0207676_10078992 | 3300026095 | Bacteria | 2667 |
| 513 | Ga0207674_10000385 | 3300026116 | Bacteria | 57430 |
| 514 | Ga0207674_10001011 | 3300026116 | Bacteria | 36730 |
| 515 | Ga0207675_100114002 | 3300026118 | Bacteria | 2553 |
| 516 | Ga0207675_100170215 | 3300026118 | Bacteria | 2082 |
| 517 | Ga0207675_100365389 | 3300026118 | Bacteria | 1417 |
| 518 | Ga0207675_101561887 | 3300026118 | Unclassified | 680 |
| 519 | Ga0207698_10000065 | 3300026142 | Bacteria | 71171 |
| 520 | Ga0207698_10255863 | 3300026142 | Bacteria | 1605 |
| 521 | Ga0207698_10985380 | 3300026142 | Bacteria | 853 |
| 522 | Ga0207698_11578763 | 3300026142 | Bacteria | 672 |
| 523 | Ga0209588_1012680 | 3300027671 | Unclassified | 2561 |
| 524 | Ga0209588_1016448 | 3300027671 | Bacteria | 2284 |
| 525 | Ga0209588_1016784 | 3300027671 | Bacteria | 2264 |
| 526 | Ga0209588_1036120 | 3300027671 | Unclassified | 1589 |
| 527 | Ga0207428_10037777 | 3300027907 | Bacteria | 3928 |
| 528 | Ga0207428_10443939 | 3300027907 | Bacteria | 946 |
| 529 | Ga0207428_10456466 | 3300027907 | Unclassified | 931 |
| 530 | Ga0207428_10506024 | 3300027907 | Unclassified | 877 |
| 531 | Ga0268266_10003695 | 3300028379 | Bacteria | 15088 |
| 532 | Ga0268266_10020551 | 3300028379 | Bacteria | 5626 |
| 533 | Ga0268265_10008987 | 3300028380 | Bacteria | 6758 |
| 534 | Ga0268265_12355789 | 3300028380 | Bacteria | 539 |
| 535 | Ga0268265_12713174 | 3300028380 | Bacteria | 501 |
| 536 | Ga0268264_10002414 | 3300028381 | Bacteria | 16444 |
| 537 | Ga0268264_10082201 | 3300028381 | Bacteria | 2755 |
| 538 | Ga0265338_10668045 | 3300028800 | Unclassified | 719 |
| 539 | Ga0265760_10263989 | 3300031090 | Unclassified | 600 |
| 540 | Ga0265320_10237009 | 3300031240 | Unclassified | 811 |
| 541 | Ga0265320_10392853 | 3300031240 | Bacteria | 613 |
| 542 | Ga0265325_10347502 | 3300031241 | Bacteria | 656 |
| 543 | Ga0265313_10420753 | 3300031595 | Bacteria | 522 |
| 544 | Ga0307516_10864004 | 3300031730 | Unclassified | 569 |
| 545 | Ga0373926_0000611 | 3300035083 | Bacteria | 9693 |
| 546 | Ga0373926_0046579 | 3300035083 | Bacteria | 1556 |
| 547 | Ga0373926_0068355 | 3300035083 | Bacteria | 1302 |
| 548 | Ga0373926_0166039 | 3300035083 | Bacteria | 844 |
| 549 | Ga0373929_0181358 | 3300035085 | Bacteria | 581 |
| 550 | Ga0373923_0376838 | 3300035111 | Bacteria | 680 |
| 551 | Ga0373936_0294991 | 3300035113 | Unclassified | 731 |
| 552 | Ga0373941_0511369 | 3300035115 | Bacteria | 512 |
| 553 | Ga0373945_0022267 | 3300035116 | Bacteria | 2181 |
| 554 | Ga0373945_0423205 | 3300035116 | Bacteria | 586 |
| 555 | Ga0373945_0547727 | 3300035116 | Unclassified | 519 |
| 556 | Ga0373953_0369477 | 3300035117 | Unclassified | 630 |
| 557 | Ga0373954_0045616 | 3300035118 | Bacteria | 2048 |
| 558 | Ga0373954_0533031 | 3300035118 | Unclassified | 582 |
| 559 | Ga0373954_0550258 | 3300035118 | Bacteria | 572 |
| 560 | Ga0373943_0006771 | 3300035170 | Bacteria | 5144 |
| 561 | Ga0373943_0985064 | 3300035170 | Bacteria | 505 |
| 562 | Ga0373946_0006398 | 3300035171 | Bacteria | 4267 |
| 563 | Ga0373946_0031565 | 3300035171 | Bacteria | 2123 |
| 564 | Ga0373946_0227742 | 3300035171 | Bacteria | 902 |
| 565 | Ga0373955_0180858 | 3300035172 | Bacteria | 1251 |
| 566 | Ga0373955_0245035 | 3300035172 | Bacteria | 1074 |
| 567 | Ga0373955_0453851 | 3300035172 | Bacteria | 781 |
| 568 | Ga0373942_0269095 | 3300035207 | Unclassified | 584 |
| 569 | Ga0373962_0270757 | 3300035242 | Unclassified | 595 |
| 570 | Ga0373924_0186659 | 3300035410 | Bacteria | 913 |
| 571 | Ga0373931_0187341 | 3300035691 | Bacteria | 1229 |
| 572 | Ga0373931_0475588 | 3300035691 | Bacteria | 802 |
| 573 | Ga0373931_0586114 | 3300035691 | Bacteria | 728 |
| 574 | Ga0373935_0092720 | 3300035692 | Bacteria | 1980 |
| 575 | Ga0373935_0310347 | 3300035692 | Bacteria | 1117 |
| 576 | Ga0373935_0317448 | 3300035692 | Bacteria | 1105 |
| 577 | Ga0373935_1086485 | 3300035692 | Bacteria | 595 |
| 578 | Ga0373927_0000461 | 3300035695 | Bacteria | 31104 |
| 579 | Ga0373927_0000786 | 3300035695 | Bacteria | 24231 |
| 580 | Ga0373927_0003818 | 3300035695 | Bacteria | 10694 |
| 581 | Ga0373927_0027279 | 3300035695 | Bacteria | 3730 |
| 582 | Ga0373927_0111232 | 3300035695 | Bacteria | 1785 |
| 583 | Ga0373927_0189597 | 3300035695 | Bacteria | 1349 |
| 584 | Ga0373933_0966231 | 3300035724 | Bacteria | 561 |
| 585 | Ga0373933_1135182 | 3300035724 | Unclassified | 515 |
| 586 | Ga0373947_0003616 | 3300035725 | Bacteria | 9123 |
| 587 | Ga0373947_0016152 | 3300035725 | Bacteria | 4290 |
| 588 | Ga0373947_0518013 | 3300035725 | Unclassified | 811 |
| 589 | Ga0373937_0066395 | 3300036401 | Bacteria | 3322 |
| 590 | Ga0373937_0124616 | 3300036401 | Bacteria | 2403 |
| 591 | Ga0373937_0342388 | 3300036401 | Bacteria | 1416 |
| 592 | Ga0373937_1132494 | 3300036401 | Unclassified | 731 |
| 593 | Ga0373925_0000106 | 3300037068 | Bacteria | 89944 |
| 594 | Ga0373925_0001038 | 3300037068 | Bacteria | 25179 |
| 595 | Ga0373925_0227229 | 3300037068 | Bacteria | 1491 |
| 596 | Ga0373925_0270106 | 3300037068 | Unclassified | 1368 |
| 597 | Ga0373925_0325824 | 3300037068 | Unclassified | 1244 |
| 598 | Ga0373925_0556247 | 3300037068 | Bacteria | 944 |
| 599 | Ga0373925_0930419 | 3300037068 | Unclassified | 716 |
| 600 | Ga0373925_1682289 | 3300037068 | Bacteria | 518 |
| 601 | Ga0395899_0058403 | 3300037312 | Bacteria | 2845 |
| 602 | Ga0395900_0011181 | 3300037418 | Bacteria | 9178 |
| 603 | Ga0395900_0043417 | 3300037418 | Bacteria | 4634 |
| 604 | Ga0395905_0000567 | 3300037471 | Bacteria | 50054 |
| 605 | Ga0395901_0001390 | 3300038443 | Bacteria | 25294 |
| 606 | Ga0436365_0353434 | 3300039437 | Bacteria | 2272 |
| 607 | Ga0436365_1276255 | 3300039437 | Bacteria | 902 |
| 608 | Ga0436361_0451209 | 3300039447 | Unclassified | 928 |
| 609 | Ga0436363_1192250 | 3300039450 | Bacteria | 588 |
| 610 | Ga0439448_0069274 | 3300042005 | Bacteria | 1174 |
| 611 | Ga0466963_0663537 | 3300044694 | Bacteria | 736 |
| 612 | Ga0466971_0285547 | 3300044719 | Unclassified | 790 |
| 613 | Ga0451576_0235331 | 3300045051 | Bacteria | 1913 |
| 614 | Ga0451576_1095313 | 3300045051 | Unclassified | 834 |
| 615 | Ga0466958_1012198 | 3300045836 | Bacteria | 542 |
| 616 | Ga0495592_0752526 | 3300046454 | Unclassified | 582 |
| 617 | Ga0495603_0063126 | 3300046455 | Bacteria | 2186 |
| 618 | Ga0495603_0625100 | 3300046455 | Bacteria | 616 |
| 619 | Ga0495629_0135599 | 3300046459 | Bacteria | 1714 |
| 620 | Ga0495651_0172470 | 3300046462 | Bacteria | 1539 |
| 621 | Ga0495651_0357786 | 3300046462 | Bacteria | 963 |
| 622 | Ga0495580_0002472 | 3300046472 | Bacteria | 16135 |
| 623 | Ga0495580_0203860 | 3300046472 | Unclassified | 1362 |
| 624 | Ga0495580_0524060 | 3300046472 | Bacteria | 789 |
| 625 | Ga0495580_0854505 | 3300046472 | Bacteria | 587 |
| 626 | Ga0495582_0162211 | 3300046473 | Bacteria | 1271 |
| 627 | Ga0495639_0130590 | 3300046475 | Bacteria | 1202 |
| 628 | Ga0495639_0229007 | 3300046475 | Bacteria | 915 |
| 629 | Ga0495662_0191230 | 3300046476 | Unclassified | 1009 |
| 630 | Ga0495662_0222842 | 3300046476 | Unclassified | 930 |
| 631 | Ga0495664_0144379 | 3300046477 | Bacteria | 1443 |
| 632 | Ga0495584_0250670 | 3300046491 | Bacteria | 900 |
| 633 | Ga0495594_0034320 | 3300046499 | Bacteria | 2760 |
| 634 | Ga0495594_0194197 | 3300046499 | Bacteria | 1157 |
| 635 | Ga0495594_0442760 | 3300046499 | Unclassified | 739 |
| 636 | Ga0495632_0410033 | 3300046519 | Unclassified | 591 |
| 637 | Ga0495644_0153771 | 3300046523 | Bacteria | 881 |
| 638 | Ga0495666_0007843 | 3300046526 | Bacteria | 5346 |
| 639 | Ga0495642_0074780 | 3300046528 | Bacteria | 1421 |
| 640 | Ga0495586_0034954 | 3300046535 | Unclassified | 2700 |
| 641 | Ga0495586_0733472 | 3300046535 | Unclassified | 570 |
| 642 | Ga0495587_0004260 | 3300046536 | Bacteria | 9457 |
| 643 | Ga0495598_0289768 | 3300046537 | Bacteria | 617 |
| 644 | Ga0495645_0087801 | 3300046543 | Bacteria | 2224 |
| 645 | Ga0495622_0464980 | 3300046557 | Bacteria | 542 |
| 646 | Ga0495633_0114860 | 3300046558 | Bacteria | 1248 |
| 647 | Ga0495633_0240529 | 3300046558 | Bacteria | 827 |
| 648 | Ga0495635_0054410 | 3300046663 | Bacteria | 2757 |
| 649 | Ga0495635_0684443 | 3300046663 | Unclassified | 666 |
| 650 | Ga0495659_0176401 | 3300046664 | Bacteria | 869 |
| 651 | Ga0495659_0533518 | 3300046664 | Bacteria | 517 |
| 652 | Ga0495658_0581485 | 3300046683 | Bacteria | 717 |
| 653 | Ga0495669_0063069 | 3300046684 | Bacteria | 1681 |
| 654 | Ga0495669_0241039 | 3300046684 | Unclassified | 868 |
| 655 | Ga0495624_0119783 | 3300046690 | Unclassified | 1617 |
| 656 | Ga0495624_0130295 | 3300046690 | Bacteria | 1542 |
| 657 | Ga0495670_0225464 | 3300046691 | Unclassified | 996 |
| 658 | Ga0495604_0539393 | 3300047317 | Bacteria | 753 |
| 659 | Ga0495604_1013738 | 3300047317 | Unclassified | 513 |
| 660 | Ga0495636_0073682 | 3300047318 | Bacteria | 1461 |
| 661 | Ga0495674_0384478 | 3300047319 | Bacteria | 1135 |
| 662 | Ga0495680_0617198 | 3300047322 | Unclassified | 724 |
| 663 | Ga0495687_067960 | 3300047443 | Bacteria | 1440 |
| 664 | Ga0495675_0686360 | 3300047444 | Bacteria | 574 |
| 665 | Ga0496100_0846925 | 3300048903 | Bacteria | 717 |
| 666 | Ga0496104_0358626 | 3300048907 | Bacteria | 1370 |
| 667 | Ga0496105_0265294 | 3300048908 | Bacteria | 1388 |
| 668 | Ga0496105_1252902 | 3300048908 | Bacteria | 544 |
| 669 | Ga0496108_1486085 | 3300048911 | Unclassified | 564 |
| 670 | Ga0496109_0447002 | 3300048912 | Bacteria | 1221 |
| 671 | Ga0496112_1079266 | 3300048915 | Bacteria | 721 |
| 672 | Ga0496114_0022641 | 3300048917 | Bacteria | 5122 |
| 673 | Ga0496115_0016399 | 3300048918 | Bacteria | 5642 |
| 674 | Ga0496115_0568471 | 3300048918 | Bacteria | 904 |
| 675 | Ga0496118_0106844 | 3300048921 | Unclassified | 1871 |
| 676 | Ga0496121_0124859 | 3300048924 | Bacteria | 1937 |
| 677 | Ga0496125_0000271 | 3300048928 | Bacteria | 105521 |
| 678 | Ga0496126_0063201 | 3300048929 | Bacteria | 3319 |
| 679 | Ga0501067_0242904 | 3300049583 | Bacteria | 1002 |
| 680 | nmdc:mga03n38_575062_c1 | 3300050490 | Bacteria | 639 |
| 681 | nmdc:mga05p37_1122_c2 | 3300050507 | Bacteria | 25399 |
| 682 | nmdc:mga05p37_212744_c1 | 3300050507 | Bacteria | 2336 |
| 683 | nmdc:mga05p37_338924_c1 | 3300050507 | Bacteria | 1774 |
| 684 | nmdc:mga05p37_5195_c1 | 3300050507 | Bacteria | 15276 |
| 685 | nmdc:mga05p37_871111_c1 | 3300050507 | Unclassified | 975 |
| 686 | nmdc:mga09592_254919_c1 | 3300050508 | Bacteria | 1521 |
| 687 | nmdc:mga0qj67_8892_c1 | 3300050509 | Bacteria | 7451 |
| 688 | nmdc:mga06r32_476_c1 | 3300050510 | Bacteria | 34429 |
| 689 | nmdc:mga06r32_849411_c1 | 3300050510 | Bacteria | 871 |
| 690 | nmdc:mga08y16_171126_c2 | 3300050511 | Unclassified | 1387 |
| 691 | nmdc:mga08y16_2146_c1 | 3300050511 | Bacteria | 20235 |
| 692 | nmdc:mga0n895_1022573_c1 | 3300050512 | Unclassified | 807 |
| 693 | nmdc:mga0n895_1244404_c1 | 3300050512 | Unclassified | 717 |
| 694 | nmdc:mga0n895_13067_c1 | 3300050512 | Bacteria | 7469 |
| 695 | nmdc:mga0n895_16651_c1 | 3300050512 | Bacteria | 6751 |
| 696 | nmdc:mga0n895_299467_c1 | 3300050512 | Bacteria | 1630 |
| 697 | nmdc:mga0rr50_124348_c1 | 3300050513 | Bacteria | 2057 |
| 698 | nmdc:mga0rr50_1276644_c1 | 3300050513 | Unclassified | 623 |
| 699 | nmdc:mga0rr50_128009_c1 | 3300050513 | Unclassified | 2029 |
| 700 | nmdc:mga0rr50_1851477_c1 | 3300050513 | Bacteria | 507 |
| 701 | nmdc:mga08x19_125874_c1 | 3300050514 | Unclassified | 1721 |
| 702 | nmdc:mga08x19_2595_c1 | 3300050514 | Bacteria | 10966 |
| 703 | nmdc:mga08x19_411614_c1 | 3300050514 | Bacteria | 949 |
| 704 | nmdc:mga08x19_462374_c1 | 3300050514 | Bacteria | 894 |
| 705 | nmdc:mga0a205_1020705_c1 | 3300050515 | Unclassified | 674 |
| 706 | nmdc:mga0a205_20947_c1 | 3300050515 | Bacteria | 6179 |
| 707 | nmdc:mga0a205_5985_c1 | 3300050515 | Bacteria | 10962 |
| 708 | Ga0495601_0097366 | 3300053077 | Bacteria | 1898 |
| 709 | Ga0495601_0261451 | 3300053077 | Unclassified | 1130 |
| 710 | Ga0495619_0021095 | 3300053085 | Bacteria | 4157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035695 | Ga0373927_0027279 | Ga0373927_0027279_2156_2401 | 63 |
| 2 | 3300005327 | Ga0070658_10510016 | Ga0070658_105100161 | 67 |
| 3 | 3300005339 | Ga0070660_101688382 | Ga0070660_1016883822 | 67 |
| 4 | 3300006871 | Ga0075434_101379297 | Ga0075434_1013792972 | 67 |
| 5 | 3300009147 | Ga0114129_10986889 | Ga0114129_109868892 | 67 |
| 6 | 3300025909 | Ga0207705_10551370 | Ga0207705_105513703 | 67 |
| 7 | 3300025919 | Ga0207657_11452719 | Ga0207657_114527193 | 67 |
| 8 | 3300050512 | nmdc:mga0n895_1244404_c1 | nmdc:mga0n895_1244404_c1_347_559 | 67 |
| 9 | 3300005328 | Ga0070676_10452113 | Ga0070676_104521132 | 68 |
| 10 | 3300005330 | Ga0070690_100152886 | Ga0070690_1001528862 | 68 |
| 11 | 3300005330 | Ga0070690_100461251 | Ga0070690_1004612512 | 68 |
| 12 | 3300005338 | Ga0068868_100329462 | Ga0068868_1003294622 | 68 |
| 13 | 3300005339 | Ga0070660_101766881 | Ga0070660_1017668812 | 68 |
| 14 | 3300005340 | Ga0070689_101007275 | Ga0070689_1010072752 | 68 |
| 15 | 3300005343 | Ga0070687_100926687 | Ga0070687_1009266872 | 68 |
| 16 | 3300005354 | Ga0070675_100000911 | Ga0070675_10000091116 | 68 |
| 17 | 3300005354 | Ga0070675_101545372 | Ga0070675_1015453721 | 68 |
| 18 | 3300005435 | Ga0070714_100396821 | Ga0070714_1003968213 | 68 |
| 19 | 3300005439 | Ga0070711_100783166 | Ga0070711_1007831663 | 68 |
| 20 | 3300005466 | Ga0070685_10398169 | Ga0070685_103981692 | 68 |
| 21 | 3300005544 | Ga0070686_100814042 | Ga0070686_1008140422 | 68 |
| 22 | 3300005548 | Ga0070665_100001033 | Ga0070665_10000103329 | 68 |
| 23 | 3300005617 | Ga0068859_100367443 | Ga0068859_1003674431 | 68 |
| 24 | 3300005617 | Ga0068859_101039209 | Ga0068859_1010392092 | 68 |
| 25 | 3300005618 | Ga0068864_100092675 | Ga0068864_1000926753 | 68 |
| 26 | 3300005719 | Ga0068861_101412505 | Ga0068861_1014125052 | 68 |
| 27 | 3300005841 | Ga0068863_101530890 | Ga0068863_1015308902 | 68 |
| 28 | 3300005842 | Ga0068858_100035778 | Ga0068858_1000357786 | 68 |
| 29 | 3300005842 | Ga0068858_100251338 | Ga0068858_1002513383 | 68 |
| 30 | 3300005843 | Ga0068860_101003503 | Ga0068860_1010035032 | 68 |
| 31 | 3300006163 | Ga0070715_10557938 | Ga0070715_105579382 | 68 |
| 32 | 3300006237 | Ga0097621_100279714 | Ga0097621_1002797142 | 68 |
| 33 | 3300006237 | Ga0097621_101366303 | Ga0097621_1013663033 | 68 |
| 34 | 3300006358 | Ga0068871_100332729 | Ga0068871_1003327292 | 68 |
| 35 | 3300006881 | Ga0068865_100054311 | Ga0068865_1000543112 | 68 |
| 36 | 3300006881 | Ga0068865_101425863 | Ga0068865_1014258633 | 68 |
| 37 | 3300006931 | Ga0097620_100367417 | Ga0097620_1003674171 | 68 |
| 38 | 3300006931 | Ga0097620_101038901 | Ga0097620_1010389012 | 68 |
| 39 | 3300009098 | Ga0105245_10038935 | Ga0105245_100389356 | 68 |
| 40 | 3300009101 | Ga0105247_10350217 | Ga0105247_103502172 | 68 |
| 41 | 3300009174 | Ga0105241_10473236 | Ga0105241_104732362 | 68 |
| 42 | 3300009176 | Ga0105242_10028411 | Ga0105242_100284113 | 68 |
| 43 | 3300009177 | Ga0105248_10440821 | Ga0105248_104408212 | 68 |
| 44 | 3300010375 | Ga0105239_10532499 | Ga0105239_105324993 | 68 |
| 45 | 3300013296 | Ga0157374_10060655 | Ga0157374_100606551 | 68 |
| 46 | 3300013296 | Ga0157374_10100913 | Ga0157374_101009134 | 68 |
| 47 | 3300013297 | Ga0157378_11578690 | Ga0157378_115786902 | 68 |
| 48 | 3300013306 | Ga0163162_10054169 | Ga0163162_100541691 | 68 |
| 49 | 3300013306 | Ga0163162_10216306 | Ga0163162_102163062 | 68 |
| 50 | 3300013308 | Ga0157375_10265626 | Ga0157375_102656263 | 68 |
| 51 | 3300014325 | Ga0163163_10406866 | Ga0163163_104068662 | 68 |
| 52 | 3300014745 | Ga0157377_10048888 | Ga0157377_100488883 | 68 |
| 53 | 3300014968 | Ga0157379_10145884 | Ga0157379_101458842 | 68 |
| 54 | 3300014968 | Ga0157379_11695134 | Ga0157379_116951342 | 68 |
| 55 | 3300014969 | Ga0157376_10001580 | Ga0157376_100015802 | 68 |
| 56 | 3300014969 | Ga0157376_10458529 | Ga0157376_104585292 | 68 |
| 57 | 3300025315 | Ga0207697_10052748 | Ga0207697_100527483 | 68 |
| 58 | 3300025899 | Ga0207642_10561542 | Ga0207642_105615422 | 68 |
| 59 | 3300025900 | Ga0207710_10238097 | Ga0207710_102380971 | 68 |
| 60 | 3300025903 | Ga0207680_10251332 | Ga0207680_102513321 | 68 |
| 61 | 3300025905 | Ga0207685_10578928 | Ga0207685_105789282 | 68 |
| 62 | 3300025913 | Ga0207695_10412675 | Ga0207695_104126752 | 68 |
| 63 | 3300025916 | Ga0207663_10594328 | Ga0207663_105943283 | 68 |
| 64 | 3300025918 | Ga0207662_10315445 | Ga0207662_103154452 | 68 |
| 65 | 3300025926 | Ga0207659_10000077 | Ga0207659_1000007724 | 68 |
| 66 | 3300025927 | Ga0207687_10005315 | Ga0207687_100053156 | 68 |
| 67 | 3300025931 | Ga0207644_11105805 | Ga0207644_111058053 | 68 |
| 68 | 3300025934 | Ga0207686_10036251 | Ga0207686_100362514 | 68 |
| 69 | 3300025934 | Ga0207686_10700869 | Ga0207686_107008692 | 68 |
| 70 | 3300025937 | Ga0207669_11347430 | Ga0207669_113474302 | 68 |
| 71 | 3300025939 | Ga0207665_10392906 | Ga0207665_103929063 | 68 |
| 72 | 3300025941 | Ga0207711_11074533 | Ga0207711_110745332 | 68 |
| 73 | 3300025942 | Ga0207689_10914683 | Ga0207689_109146832 | 68 |
| 74 | 3300026035 | Ga0207703_10025580 | Ga0207703_100255802 | 68 |
| 75 | 3300026088 | Ga0207641_10651047 | Ga0207641_106510473 | 68 |
| 76 | 3300026095 | Ga0207676_10078992 | Ga0207676_100789923 | 68 |
| 77 | 3300026118 | Ga0207675_101561887 | Ga0207675_1015618872 | 68 |
| 78 | 3300028379 | Ga0268266_10003695 | Ga0268266_100036953 | 68 |
| 79 | 3300028380 | Ga0268265_12713174 | Ga0268265_127131742 | 68 |
| 80 | 3300035083 | Ga0373926_0046579 | Ga0373926_0046579_1140_1352 | 68 |
| 81 | 3300035113 | Ga0373936_0294991 | Ga0373936_0294991_154_366 | 68 |
| 82 | 3300035116 | Ga0373945_0022267 | Ga0373945_0022267_1795_2007 | 68 |
| 83 | 3300035117 | Ga0373953_0369477 | Ga0373953_0369477_233_439 | 68 |
| 84 | 3300035170 | Ga0373943_0006771 | Ga0373943_0006771_1032_1244 | 68 |
| 85 | 3300035171 | Ga0373946_0031565 | Ga0373946_0031565_1333_1545 | 68 |
| 86 | 3300035171 | Ga0373946_0227742 | Ga0373946_0227742_166_372 | 68 |
| 87 | 3300035172 | Ga0373955_0245035 | Ga0373955_0245035_574_780 | 68 |
| 88 | 3300035410 | Ga0373924_0186659 | Ga0373924_0186659_332_538 | 68 |
| 89 | 3300035691 | Ga0373931_0475588 | Ga0373931_0475588_81_290 | 68 |
| 90 | 3300035692 | Ga0373935_0092720 | Ga0373935_0092720_1057_1269 | 68 |
| 91 | 3300035695 | Ga0373927_0000461 | Ga0373927_0000461_9608_9820 | 68 |
| 92 | 3300035724 | Ga0373933_0966231 | Ga0373933_0966231_327_533 | 68 |
| 93 | 3300035725 | Ga0373947_0003616 | Ga0373947_0003616_814_1026 | 68 |
| 94 | 3300036401 | Ga0373937_0124616 | Ga0373937_0124616_514_720 | 68 |
| 95 | 3300037068 | Ga0373925_0000106 | Ga0373925_0000106_86587_86799 | 68 |
| 96 | 3300037068 | Ga0373925_0930419 | Ga0373925_0930419_144_350 | 68 |
| 97 | 3300046459 | Ga0495629_0135599 | Ga0495629_0135599_812_1018 | 68 |
| 98 | 3300046472 | Ga0495580_0524060 | Ga0495580_0524060_546_752 | 68 |
| 99 | 3300046475 | Ga0495639_0130590 | Ga0495639_0130590_351_557 | 68 |
| 100 | 3300046476 | Ga0495662_0191230 | Ga0495662_0191230_622_834 | 68 |
| 101 | 3300046476 | Ga0495662_0222842 | Ga0495662_0222842_22_228 | 68 |
| 102 | 3300046535 | Ga0495586_0034954 | Ga0495586_0034954_1876_2088 | 68 |
| 103 | 3300046535 | Ga0495586_0733472 | Ga0495586_0733472_200_406 | 68 |
| 104 | 3300046537 | Ga0495598_0289768 | Ga0495598_0289768_165_371 | 68 |
| 105 | 3300046558 | Ga0495633_0114860 | Ga0495633_0114860_964_1170 | 68 |
| 106 | 3300046663 | Ga0495635_0054410 | Ga0495635_0054410_572_778 | 68 |
| 107 | 3300046683 | Ga0495658_0581485 | Ga0495658_0581485_384_590 | 68 |
| 108 | 3300046690 | Ga0495624_0119783 | Ga0495624_0119783_337_549 | 68 |
| 109 | 3300046691 | Ga0495670_0225464 | Ga0495670_0225464_514_720 | 68 |
| 110 | 3300047317 | Ga0495604_0539393 | Ga0495604_0539393_19_225 | 68 |
| 111 | 3300047322 | Ga0495680_0617198 | Ga0495680_0617198_183_389 | 68 |
| 112 | 3300047444 | Ga0495675_0686360 | Ga0495675_0686360_344_550 | 68 |
| 113 | 3300048907 | Ga0496104_0358626 | Ga0496104_0358626_728_937 | 68 |
| 114 | 3300048908 | Ga0496105_0265294 | Ga0496105_0265294_686_895 | 68 |
| 115 | 3300048912 | Ga0496109_0447002 | Ga0496109_0447002_560_769 | 68 |
| 116 | 3300048915 | Ga0496112_1079266 | Ga0496112_1079266_363_572 | 68 |
| 117 | 3300048917 | Ga0496114_0022641 | Ga0496114_0022641_3137_3346 | 68 |
| 118 | 3300048918 | Ga0496115_0016399 | Ga0496115_0016399_2224_2433 | 68 |
| 119 | 3300050490 | nmdc:mga03n38_575062_c1 | nmdc:mga03n38_575062_c1_211_417 | 68 |
| 120 | 3300050513 | nmdc:mga0rr50_128009_c1 | nmdc:mga0rr50_128009_c1_838_1047 | 68 |
| 121 | 3300053077 | Ga0495601_0261451 | Ga0495601_0261451_340_546 | 68 |
| 122 | 3300053085 | Ga0495619_0021095 | Ga0495619_0021095_3657_3863 | 68 |
| 123 | 3300005329 | Ga0070683_100000438 | Ga0070683_1000004383 | 69 |
| 124 | 3300005329 | Ga0070683_100103728 | Ga0070683_1001037283 | 69 |
| 125 | 3300005329 | Ga0070683_100707100 | Ga0070683_1007071002 | 69 |
| 126 | 3300005329 | Ga0070683_100716157 | Ga0070683_1007161572 | 69 |
| 127 | 3300005329 | Ga0070683_100955708 | Ga0070683_1009557082 | 69 |
| 128 | 3300005331 | Ga0070670_100014132 | Ga0070670_1000141323 | 69 |
| 129 | 3300005331 | Ga0070670_100150745 | Ga0070670_1001507454 | 69 |
| 130 | 3300005334 | Ga0068869_100002425 | Ga0068869_1000024253 | 69 |
| 131 | 3300005334 | Ga0068869_101610022 | Ga0068869_1016100222 | 69 |
| 132 | 3300005335 | Ga0070666_10178838 | Ga0070666_101788383 | 69 |
| 133 | 3300005337 | Ga0070682_100764111 | Ga0070682_1007641112 | 69 |
| 134 | 3300005338 | Ga0068868_100521159 | Ga0068868_1005211592 | 69 |
| 135 | 3300005338 | Ga0068868_100880733 | Ga0068868_1008807332 | 69 |
| 136 | 3300005339 | Ga0070660_101182708 | Ga0070660_1011827082 | 69 |
| 137 | 3300005344 | Ga0070661_100000289 | Ga0070661_1000002891 | 69 |
| 138 | 3300005344 | Ga0070661_100154423 | Ga0070661_1001544232 | 69 |
| 139 | 3300005344 | Ga0070661_100427738 | Ga0070661_1004277383 | 69 |
| 140 | 3300005355 | Ga0070671_100013048 | Ga0070671_1000130487 | 69 |
| 141 | 3300005367 | Ga0070667_100002851 | Ga0070667_10000285110 | 69 |
| 142 | 3300005434 | Ga0070709_10000507 | Ga0070709_100005073 | 69 |
| 143 | 3300005434 | Ga0070709_11124098 | Ga0070709_111240981 | 69 |
| 144 | 3300005435 | Ga0070714_100107226 | Ga0070714_1001072263 | 69 |
| 145 | 3300005436 | Ga0070713_100001370 | Ga0070713_1000013702 | 69 |
| 146 | 3300005436 | Ga0070713_100084861 | Ga0070713_1000848613 | 69 |
| 147 | 3300005436 | Ga0070713_100161289 | Ga0070713_1001612893 | 69 |
| 148 | 3300005436 | Ga0070713_101734255 | Ga0070713_1017342552 | 69 |
| 149 | 3300005437 | Ga0070710_10280676 | Ga0070710_102806762 | 69 |
| 150 | 3300005439 | Ga0070711_100125948 | Ga0070711_1001259483 | 69 |
| 151 | 3300005455 | Ga0070663_100040297 | Ga0070663_1000402975 | 69 |
| 152 | 3300005455 | Ga0070663_101908968 | Ga0070663_1019089682 | 69 |
| 153 | 3300005535 | Ga0070684_100000161 | Ga0070684_10000016110 | 69 |
| 154 | 3300005535 | Ga0070684_100054118 | Ga0070684_1000541182 | 69 |
| 155 | 3300005535 | Ga0070684_100424625 | Ga0070684_1004246253 | 69 |
| 156 | 3300005535 | Ga0070684_101859047 | Ga0070684_1018590472 | 69 |
| 157 | 3300005539 | Ga0068853_100002829 | Ga0068853_1000028295 | 69 |
| 158 | 3300005539 | Ga0068853_100053870 | Ga0068853_1000538703 | 69 |
| 159 | 3300005539 | Ga0068853_100243654 | Ga0068853_1002436543 | 69 |
| 160 | 3300005539 | Ga0068853_100383254 | Ga0068853_1003832542 | 69 |
| 161 | 3300005548 | Ga0070665_100019217 | Ga0070665_1000192174 | 69 |
| 162 | 3300005548 | Ga0070665_100073606 | Ga0070665_1000736066 | 69 |
| 163 | 3300005563 | Ga0068855_100003811 | Ga0068855_1000038113 | 69 |
| 164 | 3300005563 | Ga0068855_100360311 | Ga0068855_1003603112 | 69 |
| 165 | 3300005564 | Ga0070664_100238972 | Ga0070664_1002389722 | 69 |
| 166 | 3300005577 | Ga0068857_100003923 | Ga0068857_1000039237 | 69 |
| 167 | 3300005577 | Ga0068857_100004193 | Ga0068857_1000041938 | 69 |
| 168 | 3300005578 | Ga0068854_100109442 | Ga0068854_1001094422 | 69 |
| 169 | 3300005578 | Ga0068854_100351078 | Ga0068854_1003510782 | 69 |
| 170 | 3300005578 | Ga0068854_101390538 | Ga0068854_1013905382 | 69 |
| 171 | 3300005614 | Ga0068856_100010164 | Ga0068856_1000101647 | 69 |
| 172 | 3300005614 | Ga0068856_100016286 | Ga0068856_1000162863 | 69 |
| 173 | 3300005614 | Ga0068856_100026736 | Ga0068856_1000267363 | 69 |
| 174 | 3300005614 | Ga0068856_100036270 | Ga0068856_1000362705 | 69 |
| 175 | 3300005616 | Ga0068852_100000168 | Ga0068852_1000001683 | 69 |
| 176 | 3300005616 | Ga0068852_100196217 | Ga0068852_1001962173 | 69 |
| 177 | 3300005616 | Ga0068852_100237394 | Ga0068852_1002373942 | 69 |
| 178 | 3300005617 | Ga0068859_100014850 | Ga0068859_1000148502 | 69 |
| 179 | 3300005618 | Ga0068864_100000766 | Ga0068864_10000076610 | 69 |
| 180 | 3300005834 | Ga0068851_10020291 | Ga0068851_100202914 | 69 |
| 181 | 3300005834 | Ga0068851_10197177 | Ga0068851_101971772 | 69 |
| 182 | 3300005834 | Ga0068851_11021028 | Ga0068851_110210282 | 69 |
| 183 | 3300005841 | Ga0068863_100056211 | Ga0068863_1000562113 | 69 |
| 184 | 3300005842 | Ga0068858_100001558 | Ga0068858_10000155815 | 69 |
| 185 | 3300005843 | Ga0068860_100000853 | Ga0068860_1000008537 | 69 |
| 186 | 3300005844 | Ga0068862_100073831 | Ga0068862_1000738313 | 69 |
| 187 | 3300006028 | Ga0070717_10709328 | Ga0070717_107093282 | 69 |
| 188 | 3300006028 | Ga0070717_11457961 | Ga0070717_114579611 | 69 |
| 189 | 3300006163 | Ga0070715_10034982 | Ga0070715_100349822 | 69 |
| 190 | 3300006173 | Ga0070716_100042800 | Ga0070716_1000428002 | 69 |
| 191 | 3300006175 | Ga0070712_100000621 | Ga0070712_10000062114 | 69 |
| 192 | 3300006175 | Ga0070712_100471613 | Ga0070712_1004716132 | 69 |
| 193 | 3300006175 | Ga0070712_100547975 | Ga0070712_1005479752 | 69 |
| 194 | 3300006237 | Ga0097621_100002181 | Ga0097621_10000218110 | 69 |
| 195 | 3300006237 | Ga0097621_100046304 | Ga0097621_1000463043 | 69 |
| 196 | 3300006358 | Ga0068871_100041280 | Ga0068871_1000412802 | 69 |
| 197 | 3300006358 | Ga0068871_100052553 | Ga0068871_1000525534 | 69 |
| 198 | 3300006931 | Ga0097620_100014850 | Ga0097620_1000148502 | 69 |
| 199 | 3300009093 | Ga0105240_10000594 | Ga0105240_100005945 | 69 |
| 200 | 3300009093 | Ga0105240_10004531 | Ga0105240_100045313 | 69 |
| 201 | 3300009093 | Ga0105240_10008135 | Ga0105240_1000813510 | 69 |
| 202 | 3300009093 | Ga0105240_10015824 | Ga0105240_100158243 | 69 |
| 203 | 3300009093 | Ga0105240_10951919 | Ga0105240_109519192 | 69 |
| 204 | 3300009093 | Ga0105240_11867307 | Ga0105240_118673072 | 69 |
| 205 | 3300009098 | Ga0105245_10002548 | Ga0105245_1000254810 | 69 |
| 206 | 3300009098 | Ga0105245_10007961 | Ga0105245_100079612 | 69 |
| 207 | 3300009098 | Ga0105245_10179032 | Ga0105245_101790323 | 69 |
| 208 | 3300009101 | Ga0105247_10000309 | Ga0105247_1000030911 | 69 |
| 209 | 3300009174 | Ga0105241_10000484 | Ga0105241_100004844 | 69 |
| 210 | 3300009174 | Ga0105241_10002430 | Ga0105241_1000243010 | 69 |
| 211 | 3300009174 | Ga0105241_10025344 | Ga0105241_100253442 | 69 |
| 212 | 3300009174 | Ga0105241_10217895 | Ga0105241_102178952 | 69 |
| 213 | 3300009174 | Ga0105241_10272123 | Ga0105241_102721233 | 69 |
| 214 | 3300009174 | Ga0105241_10902298 | Ga0105241_109022982 | 69 |
| 215 | 3300009174 | Ga0105241_12560763 | Ga0105241_125607632 | 69 |
| 216 | 3300009176 | Ga0105242_10156317 | Ga0105242_101563172 | 69 |
| 217 | 3300009177 | Ga0105248_10002507 | Ga0105248_100025073 | 69 |
| 218 | 3300009177 | Ga0105248_10021050 | Ga0105248_100210504 | 69 |
| 219 | 3300009545 | Ga0105237_10006164 | Ga0105237_1000616410 | 69 |
| 220 | 3300009545 | Ga0105237_10013070 | Ga0105237_100130704 | 69 |
| 221 | 3300009545 | Ga0105237_10099970 | Ga0105237_100999703 | 69 |
| 222 | 3300009545 | Ga0105237_10207649 | Ga0105237_102076493 | 69 |
| 223 | 3300009545 | Ga0105237_10740213 | Ga0105237_107402132 | 69 |
| 224 | 3300009551 | Ga0105238_10000158 | Ga0105238_100001583 | 69 |
| 225 | 3300009551 | Ga0105238_10003457 | Ga0105238_100034576 | 69 |
| 226 | 3300009551 | Ga0105238_10003686 | Ga0105238_100036863 | 69 |
| 227 | 3300009551 | Ga0105238_10063836 | Ga0105238_100638363 | 69 |
| 228 | 3300009551 | Ga0105238_10818623 | Ga0105238_108186232 | 69 |
| 229 | 3300009553 | Ga0105249_10018782 | Ga0105249_100187823 | 69 |
| 230 | 3300010375 | Ga0105239_10002973 | Ga0105239_100029735 | 69 |
| 231 | 3300010375 | Ga0105239_10005034 | Ga0105239_100050344 | 69 |
| 232 | 3300010375 | Ga0105239_10006631 | Ga0105239_1000663110 | 69 |
| 233 | 3300010375 | Ga0105239_10161015 | Ga0105239_101610152 | 69 |
| 234 | 3300010375 | Ga0105239_10308132 | Ga0105239_103081323 | 69 |
| 235 | 3300010375 | Ga0105239_11307544 | Ga0105239_113075442 | 69 |
| 236 | 3300010375 | Ga0105239_11858183 | Ga0105239_118581831 | 69 |
| 237 | 3300010375 | Ga0105239_13611574 | Ga0105239_136115741 | 69 |
| 238 | 3300011119 | Ga0105246_10097058 | Ga0105246_100970583 | 69 |
| 239 | 3300011119 | Ga0105246_10440380 | Ga0105246_104403801 | 69 |
| 240 | 3300013102 | Ga0157371_10958241 | Ga0157371_109582412 | 69 |
| 241 | 3300013104 | Ga0157370_10370282 | Ga0157370_103702822 | 69 |
| 242 | 3300013105 | Ga0157369_10012629 | Ga0157369_100126293 | 69 |
| 243 | 3300013105 | Ga0157369_10040898 | Ga0157369_100408983 | 69 |
| 244 | 3300013105 | Ga0157369_10164003 | Ga0157369_101640032 | 69 |
| 245 | 3300013105 | Ga0157369_10285123 | Ga0157369_102851233 | 69 |
| 246 | 3300013296 | Ga0157374_10003280 | Ga0157374_100032802 | 69 |
| 247 | 3300013296 | Ga0157374_10023342 | Ga0157374_100233423 | 69 |
| 248 | 3300013296 | Ga0157374_10036252 | Ga0157374_100362523 | 69 |
| 249 | 3300013296 | Ga0157374_10229993 | Ga0157374_102299932 | 69 |
| 250 | 3300013296 | Ga0157374_10914933 | Ga0157374_109149332 | 69 |
| 251 | 3300013297 | Ga0157378_10001627 | Ga0157378_1000162715 | 69 |
| 252 | 3300013297 | Ga0157378_10015460 | Ga0157378_100154606 | 69 |
| 253 | 3300013297 | Ga0157378_10052473 | Ga0157378_100524733 | 69 |
| 254 | 3300013297 | Ga0157378_10398606 | Ga0157378_103986062 | 69 |
| 255 | 3300013306 | Ga0163162_10042583 | Ga0163162_100425833 | 69 |
| 256 | 3300013306 | Ga0163162_10973049 | Ga0163162_109730492 | 69 |
| 257 | 3300013307 | Ga0157372_10008726 | Ga0157372_100087263 | 69 |
| 258 | 3300013307 | Ga0157372_10031843 | Ga0157372_100318434 | 69 |
| 259 | 3300013307 | Ga0157372_10112498 | Ga0157372_101124983 | 69 |
| 260 | 3300013307 | Ga0157372_10113109 | Ga0157372_101131094 | 69 |
| 261 | 3300013307 | Ga0157372_10242079 | Ga0157372_102420793 | 69 |
| 262 | 3300013307 | Ga0157372_10362242 | Ga0157372_103622423 | 69 |
| 263 | 3300013308 | Ga0157375_10001472 | Ga0157375_1000147215 | 69 |
| 264 | 3300013308 | Ga0157375_10006442 | Ga0157375_100064425 | 69 |
| 265 | 3300014325 | Ga0163163_10794279 | Ga0163163_107942793 | 69 |
| 266 | 3300014745 | Ga0157377_10197526 | Ga0157377_101975263 | 69 |
| 267 | 3300014968 | Ga0157379_10009173 | Ga0157379_100091739 | 69 |
| 268 | 3300014969 | Ga0157376_10000792 | Ga0157376_100007923 | 69 |
| 269 | 3300014969 | Ga0157376_10047148 | Ga0157376_100471483 | 69 |
| 270 | 3300014969 | Ga0157376_10541961 | Ga0157376_105419612 | 69 |
| 271 | 3300025321 | Ga0207656_10026621 | Ga0207656_100266213 | 69 |
| 272 | 3300025321 | Ga0207656_10057595 | Ga0207656_100575953 | 69 |
| 273 | 3300025321 | Ga0207656_10086396 | Ga0207656_100863963 | 69 |
| 274 | 3300025898 | Ga0207692_10455578 | Ga0207692_104555783 | 69 |
| 275 | 3300025900 | Ga0207710_10000259 | Ga0207710_1000025910 | 69 |
| 276 | 3300025900 | Ga0207710_10554229 | Ga0207710_105542292 | 69 |
| 277 | 3300025903 | Ga0207680_10754606 | Ga0207680_107546061 | 69 |
| 278 | 3300025904 | Ga0207647_10203928 | Ga0207647_102039282 | 69 |
| 279 | 3300025905 | Ga0207685_10034299 | Ga0207685_100342991 | 69 |
| 280 | 3300025906 | Ga0207699_10001122 | Ga0207699_100011224 | 69 |
| 281 | 3300025909 | Ga0207705_10167405 | Ga0207705_101674053 | 69 |
| 282 | 3300025909 | Ga0207705_11108553 | Ga0207705_111085531 | 69 |
| 283 | 3300025911 | Ga0207654_10000151 | Ga0207654_100001514 | 69 |
| 284 | 3300025911 | Ga0207654_10000976 | Ga0207654_1000097610 | 69 |
| 285 | 3300025911 | Ga0207654_10004755 | Ga0207654_100047554 | 69 |
| 286 | 3300025911 | Ga0207654_10626877 | Ga0207654_106268773 | 69 |
| 287 | 3300025911 | Ga0207654_10720851 | Ga0207654_107208512 | 69 |
| 288 | 3300025913 | Ga0207695_10000188 | Ga0207695_1000018899 | 69 |
| 289 | 3300025913 | Ga0207695_10001158 | Ga0207695_1000115821 | 69 |
| 290 | 3300025913 | Ga0207695_10001234 | Ga0207695_1000123419 | 69 |
| 291 | 3300025913 | Ga0207695_10089462 | Ga0207695_100894623 | 69 |
| 292 | 3300025913 | Ga0207695_10171220 | Ga0207695_101712203 | 69 |
| 293 | 3300025914 | Ga0207671_10000942 | Ga0207671_1000094222 | 69 |
| 294 | 3300025914 | Ga0207671_10003174 | Ga0207671_1000317411 | 69 |
| 295 | 3300025914 | Ga0207671_10060323 | Ga0207671_100603233 | 69 |
| 296 | 3300025914 | Ga0207671_11356380 | Ga0207671_113563802 | 69 |
| 297 | 3300025915 | Ga0207693_10000087 | Ga0207693_1000008750 | 69 |
| 298 | 3300025915 | Ga0207693_10277123 | Ga0207693_102771233 | 69 |
| 299 | 3300025916 | Ga0207663_10081288 | Ga0207663_100812883 | 69 |
| 300 | 3300025916 | Ga0207663_10257266 | Ga0207663_102572662 | 69 |
| 301 | 3300025920 | Ga0207649_10026172 | Ga0207649_100261723 | 69 |
| 302 | 3300025920 | Ga0207649_10139682 | Ga0207649_101396823 | 69 |
| 303 | 3300025924 | Ga0207694_10000083 | Ga0207694_1000008378 | 69 |
| 304 | 3300025924 | Ga0207694_10000290 | Ga0207694_100002903 | 69 |
| 305 | 3300025924 | Ga0207694_10001818 | Ga0207694_100018187 | 69 |
| 306 | 3300025924 | Ga0207694_10160000 | Ga0207694_101600003 | 69 |
| 307 | 3300025924 | Ga0207694_10552723 | Ga0207694_105527232 | 69 |
| 308 | 3300025925 | Ga0207650_10036753 | Ga0207650_100367533 | 69 |
| 309 | 3300025925 | Ga0207650_10295455 | Ga0207650_102954553 | 69 |
| 310 | 3300025927 | Ga0207687_10004527 | Ga0207687_100045274 | 69 |
| 311 | 3300025927 | Ga0207687_10025686 | Ga0207687_100256862 | 69 |
| 312 | 3300025927 | Ga0207687_10404208 | Ga0207687_104042082 | 69 |
| 313 | 3300025928 | Ga0207700_10004413 | Ga0207700_100044139 | 69 |
| 314 | 3300025928 | Ga0207700_10621205 | Ga0207700_106212052 | 69 |
| 315 | 3300025928 | Ga0207700_11078737 | Ga0207700_110787373 | 69 |
| 316 | 3300025931 | Ga0207644_10015999 | Ga0207644_100159997 | 69 |
| 317 | 3300025934 | Ga0207686_10614149 | Ga0207686_106141492 | 69 |
| 318 | 3300025939 | Ga0207665_10161663 | Ga0207665_101616632 | 69 |
| 319 | 3300025941 | Ga0207711_10006467 | Ga0207711_100064673 | 69 |
| 320 | 3300025941 | Ga0207711_10025346 | Ga0207711_100253463 | 69 |
| 321 | 3300025942 | Ga0207689_10002236 | Ga0207689_1000223610 | 69 |
| 322 | 3300025944 | Ga0207661_10026192 | Ga0207661_100261926 | 69 |
| 323 | 3300025944 | Ga0207661_10272687 | Ga0207661_102726873 | 69 |
| 324 | 3300025944 | Ga0207661_10595130 | Ga0207661_105951303 | 69 |
| 325 | 3300025944 | Ga0207661_10845623 | Ga0207661_108456232 | 69 |
| 326 | 3300025944 | Ga0207661_10854579 | Ga0207661_108545792 | 69 |
| 327 | 3300025945 | Ga0207679_10216289 | Ga0207679_102162892 | 69 |
| 328 | 3300025949 | Ga0207667_10004502 | Ga0207667_1000450210 | 69 |
| 329 | 3300025961 | Ga0207712_10062469 | Ga0207712_100624691 | 69 |
| 330 | 3300025981 | Ga0207640_10100448 | Ga0207640_101004482 | 69 |
| 331 | 3300025981 | Ga0207640_10340635 | Ga0207640_103406352 | 69 |
| 332 | 3300025981 | Ga0207640_10905231 | Ga0207640_109052312 | 69 |
| 333 | 3300025986 | Ga0207658_10002295 | Ga0207658_1000229510 | 69 |
| 334 | 3300026023 | Ga0207677_10001520 | Ga0207677_1000152010 | 69 |
| 335 | 3300026023 | Ga0207677_10316522 | Ga0207677_103165222 | 69 |
| 336 | 3300026035 | Ga0207703_10010887 | Ga0207703_100108873 | 69 |
| 337 | 3300026041 | Ga0207639_10000027 | Ga0207639_1000002784 | 69 |
| 338 | 3300026041 | Ga0207639_10029598 | Ga0207639_100295982 | 69 |
| 339 | 3300026041 | Ga0207639_10068385 | Ga0207639_100683853 | 69 |
| 340 | 3300026041 | Ga0207639_10083705 | Ga0207639_100837054 | 69 |
| 341 | 3300026041 | Ga0207639_10353263 | Ga0207639_103532632 | 69 |
| 342 | 3300026067 | Ga0207678_10024846 | Ga0207678_100248462 | 69 |
| 343 | 3300026078 | Ga0207702_10000823 | Ga0207702_100008233 | 69 |
| 344 | 3300026078 | Ga0207702_10015372 | Ga0207702_100153724 | 69 |
| 345 | 3300026078 | Ga0207702_10038960 | Ga0207702_100389603 | 69 |
| 346 | 3300026078 | Ga0207702_11064639 | Ga0207702_110646392 | 69 |
| 347 | 3300026088 | Ga0207641_10001089 | Ga0207641_100010893 | 69 |
| 348 | 3300026095 | Ga0207676_10013135 | Ga0207676_100131357 | 69 |
| 349 | 3300026116 | Ga0207674_10000385 | Ga0207674_1000038530 | 69 |
| 350 | 3300026116 | Ga0207674_10001011 | Ga0207674_100010116 | 69 |
| 351 | 3300026142 | Ga0207698_10000065 | Ga0207698_1000006548 | 69 |
| 352 | 3300026142 | Ga0207698_10255863 | Ga0207698_102558633 | 69 |
| 353 | 3300026142 | Ga0207698_10985380 | Ga0207698_109853802 | 69 |
| 354 | 3300026142 | Ga0207698_11578763 | Ga0207698_115787631 | 69 |
| 355 | 3300028379 | Ga0268266_10020551 | Ga0268266_100205514 | 69 |
| 356 | 3300028380 | Ga0268265_10008987 | Ga0268265_100089877 | 69 |
| 357 | 3300028381 | Ga0268264_10002414 | Ga0268264_100024143 | 69 |
| 358 | 3300031240 | Ga0265320_10392853 | Ga0265320_103928532 | 69 |
| 359 | 3300042005 | Ga0439448_0069274 | Ga0439448_0069274_285_494 | 69 |
| 360 | 3300044719 | Ga0466971_0285547 | Ga0466971_0285547_46_255 | 69 |
| 361 | 3300048903 | Ga0496100_0846925 | Ga0496100_0846925_392_601 | 69 |
| 362 | 3300048908 | Ga0496105_1252902 | Ga0496105_1252902_112_321 | 69 |
| 363 | 3300050513 | nmdc:mga0rr50_1276644_c1 | nmdc:mga0rr50_1276644_c1_144_353 | 69 |
| 364 | 3300003203 | JGI25406J46586_10115600 | JGI25406J46586_101156003 | 70 |
| 365 | 3300005293 | Ga0065715_10525617 | Ga0065715_105256171 | 70 |
| 366 | 3300005293 | Ga0065715_10556172 | Ga0065715_105561723 | 70 |
| 367 | 3300005330 | Ga0070690_101705739 | Ga0070690_1017057391 | 70 |
| 368 | 3300005334 | Ga0068869_101588449 | Ga0068869_1015884493 | 70 |
| 369 | 3300005334 | Ga0068869_101604483 | Ga0068869_1016044831 | 70 |
| 370 | 3300005336 | Ga0070680_100103935 | Ga0070680_1001039352 | 70 |
| 371 | 3300005336 | Ga0070680_100358107 | Ga0070680_1003581073 | 70 |
| 372 | 3300005338 | Ga0068868_100861687 | Ga0068868_1008616872 | 70 |
| 373 | 3300005340 | Ga0070689_100583276 | Ga0070689_1005832762 | 70 |
| 374 | 3300005340 | Ga0070689_101379943 | Ga0070689_1013799432 | 70 |
| 375 | 3300005341 | Ga0070691_10709065 | Ga0070691_107090653 | 70 |
| 376 | 3300005345 | Ga0070692_10203432 | Ga0070692_102034323 | 70 |
| 377 | 3300005347 | Ga0070668_100079427 | Ga0070668_1000794272 | 70 |
| 378 | 3300005347 | Ga0070668_100142760 | Ga0070668_1001427603 | 70 |
| 379 | 3300005353 | Ga0070669_100006617 | Ga0070669_1000066173 | 70 |
| 380 | 3300005356 | Ga0070674_101079036 | Ga0070674_1010790362 | 70 |
| 381 | 3300005406 | Ga0070703_10001660 | Ga0070703_100016606 | 70 |
| 382 | 3300005406 | Ga0070703_10456501 | Ga0070703_104565012 | 70 |
| 383 | 3300005434 | Ga0070709_10045904 | Ga0070709_100459042 | 70 |
| 384 | 3300005434 | Ga0070709_10154070 | Ga0070709_101540703 | 70 |
| 385 | 3300005434 | Ga0070709_10264690 | Ga0070709_102646903 | 70 |
| 386 | 3300005435 | Ga0070714_100003128 | Ga0070714_10000312810 | 70 |
| 387 | 3300005435 | Ga0070714_100302845 | Ga0070714_1003028452 | 70 |
| 388 | 3300005435 | Ga0070714_101698467 | Ga0070714_1016984672 | 70 |
| 389 | 3300005436 | Ga0070713_100010397 | Ga0070713_1000103975 | 70 |
| 390 | 3300005436 | Ga0070713_100030154 | Ga0070713_1000301544 | 70 |
| 391 | 3300005436 | Ga0070713_100095619 | Ga0070713_1000956194 | 70 |
| 392 | 3300005436 | Ga0070713_100323505 | Ga0070713_1003235053 | 70 |
| 393 | 3300005436 | Ga0070713_100360917 | Ga0070713_1003609172 | 70 |
| 394 | 3300005437 | Ga0070710_10159850 | Ga0070710_101598502 | 70 |
| 395 | 3300005437 | Ga0070710_11022945 | Ga0070710_110229452 | 70 |
| 396 | 3300005437 | Ga0070710_11160455 | Ga0070710_111604551 | 70 |
| 397 | 3300005437 | Ga0070710_11192641 | Ga0070710_111926412 | 70 |
| 398 | 3300005439 | Ga0070711_100018228 | Ga0070711_1000182286 | 70 |
| 399 | 3300005439 | Ga0070711_100072732 | Ga0070711_1000727323 | 70 |
| 400 | 3300005439 | Ga0070711_100723820 | Ga0070711_1007238202 | 70 |
| 401 | 3300005440 | Ga0070705_100003341 | Ga0070705_1000033413 | 70 |
| 402 | 3300005440 | Ga0070705_100130161 | Ga0070705_1001301613 | 70 |
| 403 | 3300005441 | Ga0070700_101218881 | Ga0070700_1012188811 | 70 |
| 404 | 3300005444 | Ga0070694_100218210 | Ga0070694_1002182102 | 70 |
| 405 | 3300005444 | Ga0070694_100261432 | Ga0070694_1002614323 | 70 |
| 406 | 3300005445 | Ga0070708_100002244 | Ga0070708_1000022447 | 70 |
| 407 | 3300005445 | Ga0070708_101043203 | Ga0070708_1010432031 | 70 |
| 408 | 3300005455 | Ga0070663_101175447 | Ga0070663_1011754472 | 70 |
| 409 | 3300005457 | Ga0070662_100172467 | Ga0070662_1001724673 | 70 |
| 410 | 3300005459 | Ga0068867_100625791 | Ga0068867_1006257913 | 70 |
| 411 | 3300005459 | Ga0068867_100971251 | Ga0068867_1009712513 | 70 |
| 412 | 3300005467 | Ga0070706_100001656 | Ga0070706_1000016567 | 70 |
| 413 | 3300005467 | Ga0070706_100383998 | Ga0070706_1003839983 | 70 |
| 414 | 3300005471 | Ga0070698_101266250 | Ga0070698_1012662502 | 70 |
| 415 | 3300005518 | Ga0070699_100015160 | Ga0070699_1000151602 | 70 |
| 416 | 3300005530 | Ga0070679_100017595 | Ga0070679_1000175958 | 70 |
| 417 | 3300005530 | Ga0070679_100979679 | Ga0070679_1009796792 | 70 |
| 418 | 3300005536 | Ga0070697_100001122 | Ga0070697_1000011226 | 70 |
| 419 | 3300005536 | Ga0070697_100823441 | Ga0070697_1008234412 | 70 |
| 420 | 3300005545 | Ga0070695_100016838 | Ga0070695_1000168382 | 70 |
| 421 | 3300005545 | Ga0070695_100023474 | Ga0070695_1000234744 | 70 |
| 422 | 3300005545 | Ga0070695_100731539 | Ga0070695_1007315391 | 70 |
| 423 | 3300005546 | Ga0070696_100002232 | Ga0070696_10000223213 | 70 |
| 424 | 3300005546 | Ga0070696_100580174 | Ga0070696_1005801742 | 70 |
| 425 | 3300005547 | Ga0070693_100000295 | Ga0070693_10000029522 | 70 |
| 426 | 3300005547 | Ga0070693_100126091 | Ga0070693_1001260913 | 70 |
| 427 | 3300005547 | Ga0070693_100339103 | Ga0070693_1003391033 | 70 |
| 428 | 3300005549 | Ga0070704_100007127 | Ga0070704_1000071276 | 70 |
| 429 | 3300005549 | Ga0070704_101962432 | Ga0070704_1019624322 | 70 |
| 430 | 3300005617 | Ga0068859_100820700 | Ga0068859_1008207002 | 70 |
| 431 | 3300005617 | Ga0068859_101272925 | Ga0068859_1012729252 | 70 |
| 432 | 3300005618 | Ga0068864_102024714 | Ga0068864_1020247141 | 70 |
| 433 | 3300005718 | Ga0068866_10055421 | Ga0068866_100554213 | 70 |
| 434 | 3300005718 | Ga0068866_10157226 | Ga0068866_101572263 | 70 |
| 435 | 3300005718 | Ga0068866_10394531 | Ga0068866_103945313 | 70 |
| 436 | 3300005719 | Ga0068861_100120644 | Ga0068861_1001206444 | 70 |
| 437 | 3300005719 | Ga0068861_100459299 | Ga0068861_1004592991 | 70 |
| 438 | 3300005719 | Ga0068861_101368875 | Ga0068861_1013688752 | 70 |
| 439 | 3300005840 | Ga0068870_10625745 | Ga0068870_106257451 | 70 |
| 440 | 3300005841 | Ga0068863_101368418 | Ga0068863_1013684182 | 70 |
| 441 | 3300005843 | Ga0068860_100271543 | Ga0068860_1002715433 | 70 |
| 442 | 3300005843 | Ga0068860_100313462 | Ga0068860_1003134623 | 70 |
| 443 | 3300005937 | Ga0081455_10729459 | Ga0081455_107294593 | 70 |
| 444 | 3300005985 | Ga0081539_10007242 | Ga0081539_100072426 | 70 |
| 445 | 3300006028 | Ga0070717_10012117 | Ga0070717_100121174 | 70 |
| 446 | 3300006028 | Ga0070717_10374526 | Ga0070717_103745261 | 70 |
| 447 | 3300006028 | Ga0070717_10630547 | Ga0070717_106305472 | 70 |
| 448 | 3300006163 | Ga0070715_10000253 | Ga0070715_100002537 | 70 |
| 449 | 3300006163 | Ga0070715_10215973 | Ga0070715_102159732 | 70 |
| 450 | 3300006163 | Ga0070715_10238212 | Ga0070715_102382122 | 70 |
| 451 | 3300006173 | Ga0070716_100000178 | Ga0070716_1000001783 | 70 |
| 452 | 3300006173 | Ga0070716_100000490 | Ga0070716_1000004909 | 70 |
| 453 | 3300006173 | Ga0070716_100368242 | Ga0070716_1003682422 | 70 |
| 454 | 3300006173 | Ga0070716_100495241 | Ga0070716_1004952412 | 70 |
| 455 | 3300006175 | Ga0070712_100018290 | Ga0070712_1000182902 | 70 |
| 456 | 3300006175 | Ga0070712_100154487 | Ga0070712_1001544871 | 70 |
| 457 | 3300006175 | Ga0070712_100195428 | Ga0070712_1001954283 | 70 |
| 458 | 3300006175 | Ga0070712_100226607 | Ga0070712_1002266072 | 70 |
| 459 | 3300006175 | Ga0070712_100286398 | Ga0070712_1002863982 | 70 |
| 460 | 3300006175 | Ga0070712_100818760 | Ga0070712_1008187603 | 70 |
| 461 | 3300006358 | Ga0068871_101000732 | Ga0068871_1010007322 | 70 |
| 462 | 3300006844 | Ga0075428_100001386 | Ga0075428_10000138610 | 70 |
| 463 | 3300006844 | Ga0075428_100077778 | Ga0075428_1000777783 | 70 |
| 464 | 3300006844 | Ga0075428_100166723 | Ga0075428_1001667232 | 70 |
| 465 | 3300006846 | Ga0075430_100016434 | Ga0075430_1000164344 | 70 |
| 466 | 3300006847 | Ga0075431_100001716 | Ga0075431_10000171619 | 70 |
| 467 | 3300006847 | Ga0075431_100944516 | Ga0075431_1009445162 | 70 |
| 468 | 3300006847 | Ga0075431_100982536 | Ga0075431_1009825362 | 70 |
| 469 | 3300006852 | Ga0075433_10070444 | Ga0075433_100704442 | 70 |
| 470 | 3300006852 | Ga0075433_10146922 | Ga0075433_101469222 | 70 |
| 471 | 3300006852 | Ga0075433_10354082 | Ga0075433_103540822 | 70 |
| 472 | 3300006852 | Ga0075433_11002137 | Ga0075433_110021372 | 70 |
| 473 | 3300006871 | Ga0075434_100010157 | Ga0075434_1000101577 | 70 |
| 474 | 3300006871 | Ga0075434_100032344 | Ga0075434_1000323442 | 70 |
| 475 | 3300006871 | Ga0075434_100200547 | Ga0075434_1002005472 | 70 |
| 476 | 3300006871 | Ga0075434_100304454 | Ga0075434_1003044542 | 70 |
| 477 | 3300006871 | Ga0075434_101555358 | Ga0075434_1015553582 | 70 |
| 478 | 3300006871 | Ga0075434_101805847 | Ga0075434_1018058471 | 70 |
| 479 | 3300006880 | Ga0075429_100035141 | Ga0075429_1000351414 | 70 |
| 480 | 3300006880 | Ga0075429_101549598 | Ga0075429_1015495982 | 70 |
| 481 | 3300006881 | Ga0068865_100874566 | Ga0068865_1008745662 | 70 |
| 482 | 3300006914 | Ga0075436_100000734 | Ga0075436_1000007342 | 70 |
| 483 | 3300006914 | Ga0075436_100023339 | Ga0075436_1000233395 | 70 |
| 484 | 3300006914 | Ga0075436_100258236 | Ga0075436_1002582361 | 70 |
| 485 | 3300006931 | Ga0097620_100820571 | Ga0097620_1008205712 | 70 |
| 486 | 3300006931 | Ga0097620_101272729 | Ga0097620_1012727292 | 70 |
| 487 | 3300007076 | Ga0075435_100049318 | Ga0075435_1000493183 | 70 |
| 488 | 3300007076 | Ga0075435_100139239 | Ga0075435_1001392394 | 70 |
| 489 | 3300007076 | Ga0075435_100675337 | Ga0075435_1006753372 | 70 |
| 490 | 3300007265 | Ga0099794_10014819 | Ga0099794_100148196 | 70 |
| 491 | 3300007265 | Ga0099794_10089003 | Ga0099794_100890032 | 70 |
| 492 | 3300007265 | Ga0099794_10145911 | Ga0099794_101459112 | 70 |
| 493 | 3300007265 | Ga0099794_10184624 | Ga0099794_101846242 | 70 |
| 494 | 3300007265 | Ga0099794_10253522 | Ga0099794_102535221 | 70 |
| 495 | 3300007265 | Ga0099794_10275485 | Ga0099794_102754852 | 70 |
| 496 | 3300007265 | Ga0099794_10324344 | Ga0099794_103243442 | 70 |
| 497 | 3300007265 | Ga0099794_10471416 | Ga0099794_104714161 | 70 |
| 498 | 3300007788 | Ga0099795_10009030 | Ga0099795_100090302 | 70 |
| 499 | 3300009093 | Ga0105240_10095144 | Ga0105240_100951442 | 70 |
| 500 | 3300009094 | Ga0111539_10646729 | Ga0111539_106467292 | 70 |
| 501 | 3300009101 | Ga0105247_10030211 | Ga0105247_100302112 | 70 |
| 502 | 3300009101 | Ga0105247_11074752 | Ga0105247_110747522 | 70 |
| 503 | 3300009147 | Ga0114129_10000075 | Ga0114129_1000007532 | 70 |
| 504 | 3300009147 | Ga0114129_10027832 | Ga0114129_100278328 | 70 |
| 505 | 3300009148 | Ga0105243_10320718 | Ga0105243_103207182 | 70 |
| 506 | 3300009148 | Ga0105243_10859482 | Ga0105243_108594822 | 70 |
| 507 | 3300009174 | Ga0105241_10322899 | Ga0105241_103228992 | 70 |
| 508 | 3300009174 | Ga0105241_12438448 | Ga0105241_124384481 | 70 |
| 509 | 3300009176 | Ga0105242_11495424 | Ga0105242_114954242 | 70 |
| 510 | 3300009545 | Ga0105237_10070700 | Ga0105237_100707003 | 70 |
| 511 | 3300009553 | Ga0105249_10151901 | Ga0105249_101519012 | 70 |
| 512 | 3300013100 | Ga0157373_10854251 | Ga0157373_108542512 | 70 |
| 513 | 3300013297 | Ga0157378_10019350 | Ga0157378_100193502 | 70 |
| 514 | 3300013297 | Ga0157378_10937446 | Ga0157378_109374462 | 70 |
| 515 | 3300013306 | Ga0163162_10038434 | Ga0163162_100384346 | 70 |
| 516 | 3300013306 | Ga0163162_10349710 | Ga0163162_103497103 | 70 |
| 517 | 3300013306 | Ga0163162_12918810 | Ga0163162_129188102 | 70 |
| 518 | 3300013308 | Ga0157375_10667818 | Ga0157375_106678182 | 70 |
| 519 | 3300014325 | Ga0163163_12209526 | Ga0163163_122095263 | 70 |
| 520 | 3300014326 | Ga0157380_10147330 | Ga0157380_101473302 | 70 |
| 521 | 3300014968 | Ga0157379_11237236 | Ga0157379_112372362 | 70 |
| 522 | 3300014968 | Ga0157379_11723075 | Ga0157379_117230751 | 70 |
| 523 | 3300017792 | Ga0163161_10325414 | Ga0163161_103254143 | 70 |
| 524 | 3300021361 | Ga0213872_10416486 | Ga0213872_104164861 | 70 |
| 525 | 3300024227 | Ga0228598_1006840 | Ga0228598_10068403 | 70 |
| 526 | 3300025885 | Ga0207653_10001051 | Ga0207653_100010516 | 70 |
| 527 | 3300025898 | Ga0207692_10199554 | Ga0207692_101995542 | 70 |
| 528 | 3300025898 | Ga0207692_10787837 | Ga0207692_107878372 | 70 |
| 529 | 3300025899 | Ga0207642_10317225 | Ga0207642_103172252 | 70 |
| 530 | 3300025905 | Ga0207685_10004549 | Ga0207685_100045496 | 70 |
| 531 | 3300025905 | Ga0207685_10414292 | Ga0207685_104142923 | 70 |
| 532 | 3300025906 | Ga0207699_10051030 | Ga0207699_100510302 | 70 |
| 533 | 3300025906 | Ga0207699_11186629 | Ga0207699_111866292 | 70 |
| 534 | 3300025908 | Ga0207643_10732606 | Ga0207643_107326063 | 70 |
| 535 | 3300025910 | Ga0207684_10054909 | Ga0207684_100549096 | 70 |
| 536 | 3300025911 | Ga0207654_10976403 | Ga0207654_109764032 | 70 |
| 537 | 3300025914 | Ga0207671_10398154 | Ga0207671_103981543 | 70 |
| 538 | 3300025915 | Ga0207693_10012010 | Ga0207693_100120107 | 70 |
| 539 | 3300025915 | Ga0207693_10058732 | Ga0207693_100587324 | 70 |
| 540 | 3300025915 | Ga0207693_10331581 | Ga0207693_103315813 | 70 |
| 541 | 3300025915 | Ga0207693_10900236 | Ga0207693_109002362 | 70 |
| 542 | 3300025916 | Ga0207663_10007120 | Ga0207663_100071205 | 70 |
| 543 | 3300025916 | Ga0207663_10023743 | Ga0207663_100237436 | 70 |
| 544 | 3300025916 | Ga0207663_10435253 | Ga0207663_104352532 | 70 |
| 545 | 3300025917 | Ga0207660_10098100 | Ga0207660_100981002 | 70 |
| 546 | 3300025917 | Ga0207660_10272638 | Ga0207660_102726382 | 70 |
| 547 | 3300025918 | Ga0207662_11001301 | Ga0207662_110013011 | 70 |
| 548 | 3300025921 | Ga0207652_10013414 | Ga0207652_100134149 | 70 |
| 549 | 3300025922 | Ga0207646_11643632 | Ga0207646_116436321 | 70 |
| 550 | 3300025923 | Ga0207681_10419035 | Ga0207681_104190352 | 70 |
| 551 | 3300025928 | Ga0207700_10007789 | Ga0207700_100077896 | 70 |
| 552 | 3300025928 | Ga0207700_10176955 | Ga0207700_101769553 | 70 |
| 553 | 3300025928 | Ga0207700_10189481 | Ga0207700_101894811 | 70 |
| 554 | 3300025928 | Ga0207700_10263921 | Ga0207700_102639212 | 70 |
| 555 | 3300025928 | Ga0207700_10642004 | Ga0207700_106420042 | 70 |
| 556 | 3300025929 | Ga0207664_10016879 | Ga0207664_100168797 | 70 |
| 557 | 3300025929 | Ga0207664_11330818 | Ga0207664_113308182 | 70 |
| 558 | 3300025933 | Ga0207706_10058516 | Ga0207706_100585163 | 70 |
| 559 | 3300025934 | Ga0207686_10236802 | Ga0207686_102368023 | 70 |
| 560 | 3300025935 | Ga0207709_10113776 | Ga0207709_101137762 | 70 |
| 561 | 3300025936 | Ga0207670_10505697 | Ga0207670_105056972 | 70 |
| 562 | 3300025937 | Ga0207669_10819732 | Ga0207669_108197322 | 70 |
| 563 | 3300025938 | Ga0207704_10573485 | Ga0207704_105734853 | 70 |
| 564 | 3300025939 | Ga0207665_10000015 | Ga0207665_1000001585 | 70 |
| 565 | 3300025939 | Ga0207665_10001233 | Ga0207665_1000123316 | 70 |
| 566 | 3300025939 | Ga0207665_10360962 | Ga0207665_103609622 | 70 |
| 567 | 3300025940 | Ga0207691_10037114 | Ga0207691_100371145 | 70 |
| 568 | 3300025941 | Ga0207711_10945457 | Ga0207711_109454572 | 70 |
| 569 | 3300025961 | Ga0207712_10099148 | Ga0207712_100991482 | 70 |
| 570 | 3300025972 | Ga0207668_10189174 | Ga0207668_101891743 | 70 |
| 571 | 3300025972 | Ga0207668_10499826 | Ga0207668_104998262 | 70 |
| 572 | 3300026023 | Ga0207677_10236897 | Ga0207677_102368972 | 70 |
| 573 | 3300026035 | Ga0207703_12224117 | Ga0207703_122241172 | 70 |
| 574 | 3300026067 | Ga0207678_10302149 | Ga0207678_103021492 | 70 |
| 575 | 3300026089 | Ga0207648_10168510 | Ga0207648_101685102 | 70 |
| 576 | 3300026118 | Ga0207675_100114002 | Ga0207675_1001140023 | 70 |
| 577 | 3300026118 | Ga0207675_100170215 | Ga0207675_1001702154 | 70 |
| 578 | 3300026118 | Ga0207675_100365389 | Ga0207675_1003653892 | 70 |
| 579 | 3300027671 | Ga0209588_1012680 | Ga0209588_10126803 | 70 |
| 580 | 3300027671 | Ga0209588_1016448 | Ga0209588_10164482 | 70 |
| 581 | 3300027671 | Ga0209588_1016784 | Ga0209588_10167844 | 70 |
| 582 | 3300027671 | Ga0209588_1036120 | Ga0209588_10361203 | 70 |
| 583 | 3300027907 | Ga0207428_10037777 | Ga0207428_100377773 | 70 |
| 584 | 3300027907 | Ga0207428_10443939 | Ga0207428_104439392 | 70 |
| 585 | 3300027907 | Ga0207428_10456466 | Ga0207428_104564662 | 70 |
| 586 | 3300027907 | Ga0207428_10506024 | Ga0207428_105060243 | 70 |
| 587 | 3300028380 | Ga0268265_12355789 | Ga0268265_123557893 | 70 |
| 588 | 3300028381 | Ga0268264_10082201 | Ga0268264_100822014 | 70 |
| 589 | 3300028800 | Ga0265338_10668045 | Ga0265338_106680453 | 70 |
| 590 | 3300031090 | Ga0265760_10263989 | Ga0265760_102639892 | 70 |
| 591 | 3300031240 | Ga0265320_10237009 | Ga0265320_102370093 | 70 |
| 592 | 3300031241 | Ga0265325_10347502 | Ga0265325_103475021 | 70 |
| 593 | 3300031595 | Ga0265313_10420753 | Ga0265313_104207532 | 70 |
| 594 | 3300031730 | Ga0307516_10864004 | Ga0307516_108640042 | 70 |
| 595 | 3300035083 | Ga0373926_0000611 | Ga0373926_0000611_3579_3791 | 70 |
| 596 | 3300035083 | Ga0373926_0068355 | Ga0373926_0068355_662_874 | 70 |
| 597 | 3300035083 | Ga0373926_0166039 | Ga0373926_0166039_165_377 | 70 |
| 598 | 3300035085 | Ga0373929_0181358 | Ga0373929_0181358_83_304 | 70 |
| 599 | 3300035111 | Ga0373923_0376838 | Ga0373923_0376838_392_604 | 70 |
| 600 | 3300035115 | Ga0373941_0511369 | Ga0373941_0511369_145_357 | 70 |
| 601 | 3300035116 | Ga0373945_0423205 | Ga0373945_0423205_186_398 | 70 |
| 602 | 3300035116 | Ga0373945_0547727 | Ga0373945_0547727_178_390 | 70 |
| 603 | 3300035118 | Ga0373954_0045616 | Ga0373954_0045616_1646_1858 | 70 |
| 604 | 3300035118 | Ga0373954_0533031 | Ga0373954_0533031_109_321 | 70 |
| 605 | 3300035118 | Ga0373954_0550258 | Ga0373954_0550258_240_452 | 70 |
| 606 | 3300035170 | Ga0373943_0985064 | Ga0373943_0985064_273_485 | 70 |
| 607 | 3300035171 | Ga0373946_0006398 | Ga0373946_0006398_1358_1570 | 70 |
| 608 | 3300035172 | Ga0373955_0180858 | Ga0373955_0180858_539_751 | 70 |
| 609 | 3300035172 | Ga0373955_0453851 | Ga0373955_0453851_42_254 | 70 |
| 610 | 3300035207 | Ga0373942_0269095 | Ga0373942_0269095_278_496 | 70 |
| 611 | 3300035242 | Ga0373962_0270757 | Ga0373962_0270757_140_358 | 70 |
| 612 | 3300035691 | Ga0373931_0187341 | Ga0373931_0187341_336_548 | 70 |
| 613 | 3300035691 | Ga0373931_0586114 | Ga0373931_0586114_254_475 | 70 |
| 614 | 3300035692 | Ga0373935_0310347 | Ga0373935_0310347_124_336 | 70 |
| 615 | 3300035692 | Ga0373935_0317448 | Ga0373935_0317448_330_542 | 70 |
| 616 | 3300035692 | Ga0373935_1086485 | Ga0373935_1086485_55_267 | 70 |
| 617 | 3300035695 | Ga0373927_0000786 | Ga0373927_0000786_12083_12295 | 70 |
| 618 | 3300035695 | Ga0373927_0003818 | Ga0373927_0003818_5389_5601 | 70 |
| 619 | 3300035695 | Ga0373927_0111232 | Ga0373927_0111232_924_1136 | 70 |
| 620 | 3300035695 | Ga0373927_0189597 | Ga0373927_0189597_412_624 | 70 |
| 621 | 3300035724 | Ga0373933_1135182 | Ga0373933_1135182_65_277 | 70 |
| 622 | 3300035725 | Ga0373947_0016152 | Ga0373947_0016152_3370_3582 | 70 |
| 623 | 3300035725 | Ga0373947_0518013 | Ga0373947_0518013_105_317 | 70 |
| 624 | 3300036401 | Ga0373937_0066395 | Ga0373937_0066395_326_538 | 70 |
| 625 | 3300036401 | Ga0373937_0342388 | Ga0373937_0342388_317_529 | 70 |
| 626 | 3300036401 | Ga0373937_1132494 | Ga0373937_1132494_19_231 | 70 |
| 627 | 3300037068 | Ga0373925_0001038 | Ga0373925_0001038_12123_12335 | 70 |
| 628 | 3300037068 | Ga0373925_0227229 | Ga0373925_0227229_69_281 | 70 |
| 629 | 3300037068 | Ga0373925_0270106 | Ga0373925_0270106_416_628 | 70 |
| 630 | 3300037068 | Ga0373925_0325824 | Ga0373925_0325824_387_599 | 70 |
| 631 | 3300037068 | Ga0373925_0556247 | Ga0373925_0556247_446_658 | 70 |
| 632 | 3300037068 | Ga0373925_1682289 | Ga0373925_1682289_152_364 | 70 |
| 633 | 3300037312 | Ga0395899_0058403 | Ga0395899_0058403_676_897 | 70 |
| 634 | 3300037418 | Ga0395900_0011181 | Ga0395900_0011181_711_929 | 70 |
| 635 | 3300037418 | Ga0395900_0043417 | Ga0395900_0043417_4102_4323 | 70 |
| 636 | 3300037471 | Ga0395905_0000567 | Ga0395905_0000567_7615_7833 | 70 |
| 637 | 3300038443 | Ga0395901_0001390 | Ga0395901_0001390_12103_12324 | 70 |
| 638 | 3300039437 | Ga0436365_0353434 | Ga0436365_0353434_2005_2217 | 70 |
| 639 | 3300039437 | Ga0436365_1276255 | Ga0436365_1276255_476_688 | 70 |
| 640 | 3300039447 | Ga0436361_0451209 | Ga0436361_0451209_292_510 | 70 |
| 641 | 3300039450 | Ga0436363_1192250 | Ga0436363_1192250_239_451 | 70 |
| 642 | 3300044694 | Ga0466963_0663537 | Ga0466963_0663537_221_436 | 70 |
| 643 | 3300045051 | Ga0451576_0235331 | Ga0451576_0235331_847_1059 | 70 |
| 644 | 3300045051 | Ga0451576_1095313 | Ga0451576_1095313_41_259 | 70 |
| 645 | 3300045836 | Ga0466958_1012198 | Ga0466958_1012198_187_402 | 70 |
| 646 | 3300046454 | Ga0495592_0752526 | Ga0495592_0752526_302_514 | 70 |
| 647 | 3300046455 | Ga0495603_0063126 | Ga0495603_0063126_325_546 | 70 |
| 648 | 3300046455 | Ga0495603_0625100 | Ga0495603_0625100_38_250 | 70 |
| 649 | 3300046462 | Ga0495651_0172470 | Ga0495651_0172470_1076_1288 | 70 |
| 650 | 3300046462 | Ga0495651_0357786 | Ga0495651_0357786_226_438 | 70 |
| 651 | 3300046472 | Ga0495580_0002472 | Ga0495580_0002472_4632_4844 | 70 |
| 652 | 3300046472 | Ga0495580_0203860 | Ga0495580_0203860_656_868 | 70 |
| 653 | 3300046472 | Ga0495580_0854505 | Ga0495580_0854505_358_570 | 70 |
| 654 | 3300046473 | Ga0495582_0162211 | Ga0495582_0162211_969_1181 | 70 |
| 655 | 3300046475 | Ga0495639_0229007 | Ga0495639_0229007_254_466 | 70 |
| 656 | 3300046477 | Ga0495664_0144379 | Ga0495664_0144379_740_952 | 70 |
| 657 | 3300046491 | Ga0495584_0250670 | Ga0495584_0250670_486_707 | 70 |
| 658 | 3300046499 | Ga0495594_0034320 | Ga0495594_0034320_600_821 | 70 |
| 659 | 3300046499 | Ga0495594_0194197 | Ga0495594_0194197_173_385 | 70 |
| 660 | 3300046499 | Ga0495594_0442760 | Ga0495594_0442760_240_452 | 70 |
| 661 | 3300046519 | Ga0495632_0410033 | Ga0495632_0410033_242_520 | 70 |
| 662 | 3300046523 | Ga0495644_0153771 | Ga0495644_0153771_213_434 | 70 |
| 663 | 3300046526 | Ga0495666_0007843 | Ga0495666_0007843_1419_1631 | 70 |
| 664 | 3300046528 | Ga0495642_0074780 | Ga0495642_0074780_584_796 | 70 |
| 665 | 3300046536 | Ga0495587_0004260 | Ga0495587_0004260_5059_5271 | 70 |
| 666 | 3300046543 | Ga0495645_0087801 | Ga0495645_0087801_1480_1692 | 70 |
| 667 | 3300046557 | Ga0495622_0464980 | Ga0495622_0464980_241_462 | 70 |
| 668 | 3300046558 | Ga0495633_0240529 | Ga0495633_0240529_244_465 | 70 |
| 669 | 3300046663 | Ga0495635_0684443 | Ga0495635_0684443_140_352 | 70 |
| 670 | 3300046664 | Ga0495659_0176401 | Ga0495659_0176401_101_322 | 70 |
| 671 | 3300046664 | Ga0495659_0533518 | Ga0495659_0533518_29_241 | 70 |
| 672 | 3300046684 | Ga0495669_0063069 | Ga0495669_0063069_170_391 | 70 |
| 673 | 3300046684 | Ga0495669_0241039 | Ga0495669_0241039_561_779 | 70 |
| 674 | 3300046690 | Ga0495624_0130295 | Ga0495624_0130295_769_981 | 70 |
| 675 | 3300047317 | Ga0495604_1013738 | Ga0495604_1013738_262_474 | 70 |
| 676 | 3300047318 | Ga0495636_0073682 | Ga0495636_0073682_964_1176 | 70 |
| 677 | 3300047319 | Ga0495674_0384478 | Ga0495674_0384478_429_641 | 70 |
| 678 | 3300047443 | Ga0495687_067960 | Ga0495687_067960_448_726 | 70 |
| 679 | 3300048911 | Ga0496108_1486085 | Ga0496108_1486085_84_302 | 70 |
| 680 | 3300048918 | Ga0496115_0568471 | Ga0496115_0568471_331_543 | 70 |
| 681 | 3300048921 | Ga0496118_0106844 | Ga0496118_0106844_1109_1396 | 70 |
| 682 | 3300048924 | Ga0496121_0124859 | Ga0496121_0124859_1485_1772 | 70 |
| 683 | 3300048928 | Ga0496125_0000271 | Ga0496125_0000271_67246_67533 | 70 |
| 684 | 3300048929 | Ga0496126_0063201 | Ga0496126_0063201_880_1167 | 70 |
| 685 | 3300049583 | Ga0501067_0242904 | Ga0501067_0242904_26_244 | 70 |
| 686 | 3300050507 | nmdc:mga05p37_1122_c2 | nmdc:mga05p37_1122_c2_21691_21912 | 70 |
| 687 | 3300050507 | nmdc:mga05p37_212744_c1 | nmdc:mga05p37_212744_c1_1880_2098 | 70 |
| 688 | 3300050507 | nmdc:mga05p37_338924_c1 | nmdc:mga05p37_338924_c1_279_500 | 70 |
| 689 | 3300050507 | nmdc:mga05p37_5195_c1 | nmdc:mga05p37_5195_c1_8151_8369 | 70 |
| 690 | 3300050507 | nmdc:mga05p37_871111_c1 | nmdc:mga05p37_871111_c1_705_926 | 70 |
| 691 | 3300050508 | nmdc:mga09592_254919_c1 | nmdc:mga09592_254919_c1_807_1028 | 70 |
| 692 | 3300050509 | nmdc:mga0qj67_8892_c1 | nmdc:mga0qj67_8892_c1_4918_5139 | 70 |
| 693 | 3300050510 | nmdc:mga06r32_476_c1 | nmdc:mga06r32_476_c1_5593_5814 | 70 |
| 694 | 3300050510 | nmdc:mga06r32_849411_c1 | nmdc:mga06r32_849411_c1_224_445 | 70 |
| 695 | 3300050511 | nmdc:mga08y16_171126_c2 | nmdc:mga08y16_171126_c2_787_1005 | 70 |
| 696 | 3300050511 | nmdc:mga08y16_2146_c1 | nmdc:mga08y16_2146_c1_10145_10366 | 70 |
| 697 | 3300050512 | nmdc:mga0n895_1022573_c1 | nmdc:mga0n895_1022573_c1_469_687 | 70 |
| 698 | 3300050512 | nmdc:mga0n895_13067_c1 | nmdc:mga0n895_13067_c1_1588_1806 | 70 |
| 699 | 3300050512 | nmdc:mga0n895_16651_c1 | nmdc:mga0n895_16651_c1_4137_4355 | 70 |
| 700 | 3300050512 | nmdc:mga0n895_299467_c1 | nmdc:mga0n895_299467_c1_365_577 | 70 |
| 701 | 3300050513 | nmdc:mga0rr50_124348_c1 | nmdc:mga0rr50_124348_c1_408_626 | 70 |
| 702 | 3300050513 | nmdc:mga0rr50_1851477_c1 | nmdc:mga0rr50_1851477_c1_110_328 | 70 |
| 703 | 3300050514 | nmdc:mga08x19_125874_c1 | nmdc:mga08x19_125874_c1_605_823 | 70 |
| 704 | 3300050514 | nmdc:mga08x19_2595_c1 | nmdc:mga08x19_2595_c1_749_961 | 70 |
| 705 | 3300050514 | nmdc:mga08x19_411614_c1 | nmdc:mga08x19_411614_c1_80_292 | 70 |
| 706 | 3300050514 | nmdc:mga08x19_462374_c1 | nmdc:mga08x19_462374_c1_588_809 | 70 |
| 707 | 3300050515 | nmdc:mga0a205_1020705_c1 | nmdc:mga0a205_1020705_c1_397_615 | 70 |
| 708 | 3300050515 | nmdc:mga0a205_20947_c1 | nmdc:mga0a205_20947_c1_1475_1693 | 70 |
| 709 | 3300050515 | nmdc:mga0a205_5985_c1 | nmdc:mga0a205_5985_c1_964_1182 | 70 |
| 710 | 3300053077 | Ga0495601_0097366 | Ga0495601_0097366_1586_1798 | 70 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B1D870-F1-model_v4 | DUF350 domain-containing protein | 0.8996 | 8 | 70 |
GO:0005886
|
| AF-A0A1B6Z3S6-F1-model_v4 | deleted | 0.8994 | 7 | 69 |
|
| AF-I0KG56-F1-model_v4 | DUF350 domain-containing protein | 0.8951 | 7 | 70 |
GO:0005886
|
| AF-A0A2V7VIR0-F1-model_v4 | DUF350 domain-containing protein | 0.891 | 6 | 68 |
GO:0005886
|
| AF-A0A251X6H9-F1-model_v4 | DUF350 domain-containing protein | 0.8829 | 7 | 67 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar