F476700

General Info

Members Datasets Scaffolds Average Seq Length
710 280 710 70

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10089003|Ga0099794_100890032
Length 82
Sequence MVSTTITLEANKMNLVPLGNIVAALVFAFVGIFIFVIAFMVMDKLTPYHLWKEIVQEHNMALAILVGAMSLGICIIIAAAIH

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
201 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
245 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 1.41
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10115600 3300003203 Bacteria 792
2 Ga0065715_10525617 3300005293 Unclassified 760
3 Ga0065715_10556172 3300005293 Bacteria 737
4 Ga0070658_10510016 3300005327 Bacteria 1039
5 Ga0070676_10452113 3300005328 Unclassified 903
6 Ga0070683_100000438 3300005329 Bacteria 28908
7 Ga0070683_100103728 3300005329 Unclassified 2680
8 Ga0070683_100707100 3300005329 Bacteria 965
9 Ga0070683_100716157 3300005329 Bacteria 959
10 Ga0070683_100955708 3300005329 Bacteria 822
11 Ga0070690_100152886 3300005330 Unclassified 1576
12 Ga0070690_100461251 3300005330 Bacteria 944
13 Ga0070690_101705739 3300005330 Unclassified 512
14 Ga0070670_100014132 3300005331 Bacteria 6848
15 Ga0070670_100150745 3300005331 Bacteria 2012
16 Ga0068869_100002425 3300005334 Bacteria 11241
17 Ga0068869_101588449 3300005334 Unclassified 582
18 Ga0068869_101604483 3300005334 Unclassified 579
19 Ga0068869_101610022 3300005334 Unclassified 578
20 Ga0070666_10178838 3300005335 Bacteria 1487
21 Ga0070680_100103935 3300005336 Unclassified 2360
22 Ga0070680_100358107 3300005336 Bacteria 1241
23 Ga0070682_100764111 3300005337 Bacteria 781
24 Ga0068868_100329462 3300005338 Bacteria 1303
25 Ga0068868_100521159 3300005338 Bacteria 1043
26 Ga0068868_100861687 3300005338 Bacteria 821
27 Ga0068868_100880733 3300005338 Bacteria 812
28 Ga0070660_101182708 3300005339 Bacteria 648
29 Ga0070660_101688382 3300005339 Bacteria 539
30 Ga0070660_101766881 3300005339 Bacteria 527
31 Ga0070689_100583276 3300005340 Bacteria 967
32 Ga0070689_101007275 3300005340 Unclassified 741
33 Ga0070689_101379943 3300005340 Bacteria 636
34 Ga0070691_10709065 3300005341 Bacteria 605
35 Ga0070687_100926687 3300005343 Unclassified 626
36 Ga0070661_100000289 3300005344 Bacteria 40642
37 Ga0070661_100154423 3300005344 Bacteria 1736
38 Ga0070661_100427738 3300005344 Bacteria 1050
39 Ga0070692_10203432 3300005345 Unclassified 1161
40 Ga0070668_100079427 3300005347 Bacteria 2569
41 Ga0070668_100142760 3300005347 Bacteria 1931
42 Ga0070669_100006617 3300005353 Bacteria 8344
43 Ga0070675_100000911 3300005354 Bacteria 21029
44 Ga0070675_101545372 3300005354 Unclassified 612
45 Ga0070671_100013048 3300005355 Bacteria 6697
46 Ga0070674_101079036 3300005356 Bacteria 708
47 Ga0070667_100002851 3300005367 Bacteria 14921
48 Ga0070703_10001660 3300005406 Bacteria 6604
49 Ga0070703_10456501 3300005406 Unclassified 567
50 Ga0070709_10000507 3300005434 Bacteria 22990
51 Ga0070709_10045904 3300005434 Bacteria 2714
52 Ga0070709_10154070 3300005434 Unclassified 1591
53 Ga0070709_10264690 3300005434 Bacteria 1244
54 Ga0070709_11124098 3300005434 Bacteria 629
55 Ga0070714_100003128 3300005435 Bacteria 12293
56 Ga0070714_100107226 3300005435 Unclassified 2469
57 Ga0070714_100302845 3300005435 Bacteria 1490
58 Ga0070714_100396821 3300005435 Bacteria 1303
59 Ga0070714_101698467 3300005435 Bacteria 617
60 Ga0070713_100001370 3300005436 Bacteria 15591
61 Ga0070713_100010397 3300005436 Bacteria 6720
62 Ga0070713_100030154 3300005436 Bacteria 4304
63 Ga0070713_100084861 3300005436 Bacteria 2711
64 Ga0070713_100095619 3300005436 Unclassified 2563
65 Ga0070713_100161289 3300005436 Unclassified 2002
66 Ga0070713_100323505 3300005436 Bacteria 1425
67 Ga0070713_100360917 3300005436 Unclassified 1350
68 Ga0070713_101734255 3300005436 Unclassified 606
69 Ga0070710_10159850 3300005437 Bacteria 1396
70 Ga0070710_10280676 3300005437 Bacteria 1081
71 Ga0070710_11022945 3300005437 Unclassified 603
72 Ga0070710_11160455 3300005437 Unclassified 569
73 Ga0070710_11192641 3300005437 Unclassified 562
74 Ga0070711_100018228 3300005439 Bacteria 4479
75 Ga0070711_100072732 3300005439 Unclassified 2426
76 Ga0070711_100125948 3300005439 Bacteria 1901
77 Ga0070711_100723820 3300005439 Bacteria 839
78 Ga0070711_100783166 3300005439 Unclassified 808
79 Ga0070705_100003341 3300005440 Bacteria 7874
80 Ga0070705_100130161 3300005440 Bacteria 1640
81 Ga0070700_101218881 3300005441 Unclassified 629
82 Ga0070694_100218210 3300005444 Unclassified 1429
83 Ga0070694_100261432 3300005444 Unclassified 1313
84 Ga0070708_100002244 3300005445 Bacteria 14935
85 Ga0070708_101043203 3300005445 Bacteria 766
86 Ga0070663_100040297 3300005455 Bacteria 3269
87 Ga0070663_101175447 3300005455 Bacteria 673
88 Ga0070663_101908968 3300005455 Bacteria 533
89 Ga0070662_100172467 3300005457 Bacteria 1699
90 Ga0068867_100625791 3300005459 Bacteria 942
91 Ga0068867_100971251 3300005459 Unclassified 768
92 Ga0070685_10398169 3300005466 Bacteria 953
93 Ga0070706_100001656 3300005467 Bacteria 23195
94 Ga0070706_100383998 3300005467 Bacteria 1308
95 Ga0070698_101266250 3300005471 Unclassified 687
96 Ga0070699_100015160 3300005518 Bacteria 6621
97 Ga0070679_100017595 3300005530 Bacteria 6918
98 Ga0070679_100979679 3300005530 Bacteria 789
99 Ga0070684_100000161 3300005535 Bacteria 45787
100 Ga0070684_100054118 3300005535 Unclassified 3496
101 Ga0070684_100424625 3300005535 Bacteria 1227
102 Ga0070684_101859047 3300005535 Bacteria 568
103 Ga0070697_100001122 3300005536 Bacteria 20239
104 Ga0070697_100823441 3300005536 Bacteria 822
105 Ga0068853_100002829 3300005539 Bacteria 13148
106 Ga0068853_100053870 3300005539 Bacteria 3465
107 Ga0068853_100243654 3300005539 Bacteria 1648
108 Ga0068853_100383254 3300005539 Bacteria 1313
109 Ga0070686_100814042 3300005544 Unclassified 754
110 Ga0070695_100016838 3300005545 Bacteria 4430
111 Ga0070695_100023474 3300005545 Bacteria 3791
112 Ga0070695_100731539 3300005545 Unclassified 788
113 Ga0070696_100002232 3300005546 Bacteria 12773
114 Ga0070696_100580174 3300005546 Bacteria 902
115 Ga0070693_100000295 3300005547 Bacteria 23286
116 Ga0070693_100126091 3300005547 Unclassified 1594
117 Ga0070693_100339103 3300005547 Bacteria 1025
118 Ga0070665_100001033 3300005548 Bacteria 34868
119 Ga0070665_100019217 3300005548 Bacteria 6854
120 Ga0070665_100073606 3300005548 Bacteria 3422
121 Ga0070704_100007127 3300005549 Bacteria 6640
122 Ga0070704_101962432 3300005549 Unclassified 543
123 Ga0068855_100003811 3300005563 Bacteria 18432
124 Ga0068855_100360311 3300005563 Bacteria 1600
125 Ga0070664_100238972 3300005564 Unclassified 1630
126 Ga0068857_100003923 3300005577 Bacteria 12520
127 Ga0068857_100004193 3300005577 Bacteria 12134
128 Ga0068854_100109442 3300005578 Unclassified 2082
129 Ga0068854_100351078 3300005578 Bacteria 1207
130 Ga0068854_101390538 3300005578 Unclassified 634
131 Ga0068856_100010164 3300005614 Bacteria 9146
132 Ga0068856_100016286 3300005614 Bacteria 7194
133 Ga0068856_100026736 3300005614 Bacteria 5626
134 Ga0068856_100036270 3300005614 Bacteria 4835
135 Ga0068852_100000168 3300005616 Bacteria 43887
136 Ga0068852_100196217 3300005616 Bacteria 1908
137 Ga0068852_100237394 3300005616 Bacteria 1740
138 Ga0068859_100014850 3300005617 Bacteria 7820
139 Ga0068859_100367443 3300005617 Bacteria 1534
140 Ga0068859_100820700 3300005617 Bacteria 1017
141 Ga0068859_101039209 3300005617 Unclassified 900
142 Ga0068859_101272925 3300005617 Unclassified 810
143 Ga0068864_100000766 3300005618 Bacteria 27024
144 Ga0068864_100092675 3300005618 Bacteria 2667
145 Ga0068864_102024714 3300005618 Unclassified 582
146 Ga0068866_10055421 3300005718 Bacteria 2036
147 Ga0068866_10157226 3300005718 Unclassified 1322
148 Ga0068866_10394531 3300005718 Bacteria 891
149 Ga0068861_100120644 3300005719 Bacteria 2115
150 Ga0068861_100459299 3300005719 Bacteria 1143
151 Ga0068861_101368875 3300005719 Unclassified 690
152 Ga0068861_101412505 3300005719 Unclassified 680
153 Ga0068851_10020291 3300005834 Bacteria 3216
154 Ga0068851_10197177 3300005834 Unclassified 1122
155 Ga0068851_11021028 3300005834 Unclassified 522
156 Ga0068870_10625745 3300005840 Bacteria 734
157 Ga0068863_100056211 3300005841 Unclassified 3726
158 Ga0068863_101368418 3300005841 Bacteria 715
159 Ga0068863_101530890 3300005841 Bacteria 676
160 Ga0068858_100001558 3300005842 Bacteria 23497
161 Ga0068858_100035778 3300005842 Bacteria 4605
162 Ga0068858_100251338 3300005842 Unclassified 1679
163 Ga0068860_100000853 3300005843 Bacteria 34017
164 Ga0068860_100271543 3300005843 Unclassified 1655
165 Ga0068860_100313462 3300005843 Bacteria 1539
166 Ga0068860_101003503 3300005843 Bacteria 853
167 Ga0068862_100073831 3300005844 Unclassified 2948
168 Ga0081455_10729459 3300005937 Bacteria 628
169 Ga0081539_10007242 3300005985 Bacteria 10194
170 Ga0070717_10012117 3300006028 Bacteria 6571
171 Ga0070717_10374526 3300006028 Unclassified 1276
172 Ga0070717_10630547 3300006028 Bacteria 973
173 Ga0070717_10709328 3300006028 Unclassified 914
174 Ga0070717_11457961 3300006028 Bacteria 621
175 Ga0070715_10000253 3300006163 Bacteria 12883
176 Ga0070715_10034982 3300006163 Bacteria 2063
177 Ga0070715_10215973 3300006163 Bacteria 983
178 Ga0070715_10238212 3300006163 Unclassified 945
179 Ga0070715_10557938 3300006163 Bacteria 665
180 Ga0070716_100000178 3300006173 Bacteria 24984
181 Ga0070716_100000490 3300006173 Bacteria 16446
182 Ga0070716_100042800 3300006173 Bacteria 2530
183 Ga0070716_100368242 3300006173 Bacteria 1023
184 Ga0070716_100495241 3300006173 Bacteria 900
185 Ga0070712_100000621 3300006175 Bacteria 20835
186 Ga0070712_100018290 3300006175 Unclassified 4549
187 Ga0070712_100154487 3300006175 Bacteria 1765
188 Ga0070712_100195428 3300006175 Bacteria 1586
189 Ga0070712_100226607 3300006175 Bacteria 1482
190 Ga0070712_100286398 3300006175 Unclassified 1329
191 Ga0070712_100471613 3300006175 Bacteria 1048
192 Ga0070712_100547975 3300006175 Bacteria 974
193 Ga0070712_100818760 3300006175 Bacteria 800
194 Ga0097621_100002181 3300006237 Bacteria 13401
195 Ga0097621_100046304 3300006237 Bacteria 3519
196 Ga0097621_100279714 3300006237 Bacteria 1469
197 Ga0097621_101366303 3300006237 Bacteria 670
198 Ga0068871_100041280 3300006358 Unclassified 3698
199 Ga0068871_100052553 3300006358 Bacteria 3300
200 Ga0068871_100332729 3300006358 Bacteria 1340
201 Ga0068871_101000732 3300006358 Unclassified 778
202 Ga0075428_100001386 3300006844 Bacteria 25810
203 Ga0075428_100077778 3300006844 Bacteria 3621
204 Ga0075428_100166723 3300006844 Bacteria 2389
205 Ga0075430_100016434 3300006846 Bacteria 6301
206 Ga0075431_100001716 3300006847 Bacteria 20598
207 Ga0075431_100944516 3300006847 Bacteria 831
208 Ga0075431_100982536 3300006847 Unclassified 812
209 Ga0075433_10070444 3300006852 Bacteria 3073
210 Ga0075433_10146922 3300006852 Bacteria 2096
211 Ga0075433_10354082 3300006852 Bacteria 1297
212 Ga0075433_11002137 3300006852 Unclassified 728
213 Ga0075434_100010157 3300006871 Bacteria 8819
214 Ga0075434_100032344 3300006871 Bacteria 5159
215 Ga0075434_100200547 3300006871 Bacteria 2015
216 Ga0075434_100304454 3300006871 Bacteria 1614
217 Ga0075434_101379297 3300006871 Unclassified 715
218 Ga0075434_101555358 3300006871 Bacteria 670
219 Ga0075434_101805847 3300006871 Unclassified 618
220 Ga0075429_100035141 3300006880 Bacteria 4357
221 Ga0075429_101549598 3300006880 Bacteria 576
222 Ga0068865_100054311 3300006881 Bacteria 2783
223 Ga0068865_100874566 3300006881 Bacteria 780
224 Ga0068865_101425863 3300006881 Bacteria 619
225 Ga0075436_100000734 3300006914 Bacteria 21719
226 Ga0075436_100023339 3300006914 Bacteria 4249
227 Ga0075436_100258236 3300006914 Bacteria 1242
228 Ga0097620_100014850 3300006931 Bacteria 7820
229 Ga0097620_100367417 3300006931 Bacteria 1534
230 Ga0097620_100820571 3300006931 Bacteria 1017
231 Ga0097620_101038901 3300006931 Unclassified 900
232 Ga0097620_101272729 3300006931 Unclassified 810
233 Ga0075435_100049318 3300007076 Bacteria 3386
234 Ga0075435_100139239 3300007076 Bacteria 2035
235 Ga0075435_100675337 3300007076 Bacteria 897
236 Ga0099794_10014819 3300007265 Bacteria 3426
237 Ga0099794_10089003 3300007265 Bacteria 1530
238 Ga0099794_10145911 3300007265 Bacteria 1200
239 Ga0099794_10184624 3300007265 Bacteria 1065
240 Ga0099794_10253522 3300007265 Unclassified 908
241 Ga0099794_10275485 3300007265 Bacteria 869
242 Ga0099794_10324344 3300007265 Bacteria 799
243 Ga0099794_10471416 3300007265 Bacteria 659
244 Ga0099795_10009030 3300007788 Unclassified 2875
245 Ga0105240_10000594 3300009093 Bacteria 67129
246 Ga0105240_10004531 3300009093 Bacteria 21107
247 Ga0105240_10008135 3300009093 Bacteria 15045
248 Ga0105240_10015824 3300009093 Bacteria 10232
249 Ga0105240_10095144 3300009093 Bacteria 3632
250 Ga0105240_10951919 3300009093 Unclassified 921
251 Ga0105240_11867307 3300009093 Bacteria 625
252 Ga0111539_10646729 3300009094 Unclassified 1231
253 Ga0105245_10002548 3300009098 Bacteria 16410
254 Ga0105245_10007961 3300009098 Bacteria 9267
255 Ga0105245_10038935 3300009098 Bacteria 4231
256 Ga0105245_10179032 3300009098 Bacteria 2024
257 Ga0105247_10000309 3300009101 Bacteria 43841
258 Ga0105247_10030211 3300009101 Bacteria 3284
259 Ga0105247_10350217 3300009101 Bacteria 1038
260 Ga0105247_11074752 3300009101 Bacteria 633
261 Ga0114129_10000075 3300009147 Bacteria 91461
262 Ga0114129_10027832 3300009147 Bacteria 8006
263 Ga0114129_10986889 3300009147 Unclassified 1061
264 Ga0105243_10320718 3300009148 Unclassified 1412
265 Ga0105243_10859482 3300009148 Bacteria 899
266 Ga0105241_10000484 3300009174 Bacteria 30045
267 Ga0105241_10002430 3300009174 Bacteria 13979
268 Ga0105241_10025344 3300009174 Bacteria 4406
269 Ga0105241_10217895 3300009174 Bacteria 1602
270 Ga0105241_10272123 3300009174 Bacteria 1443
271 Ga0105241_10322899 3300009174 Bacteria 1332
272 Ga0105241_10473236 3300009174 Bacteria 1112
273 Ga0105241_10902298 3300009174 Bacteria 821
274 Ga0105241_12438448 3300009174 Unclassified 523
275 Ga0105241_12560763 3300009174 Unclassified 512
276 Ga0105242_10028411 3300009176 Bacteria 4453
277 Ga0105242_10156317 3300009176 Bacteria 1992
278 Ga0105242_11495424 3300009176 Bacteria 706
279 Ga0105248_10002507 3300009177 Bacteria 20434
280 Ga0105248_10021050 3300009177 Bacteria 7226
281 Ga0105248_10440821 3300009177 Bacteria 1467
282 Ga0105237_10006164 3300009545 Bacteria 13401
283 Ga0105237_10013070 3300009545 Bacteria 8717
284 Ga0105237_10070700 3300009545 Bacteria 3486
285 Ga0105237_10099970 3300009545 Bacteria 2891
286 Ga0105237_10207649 3300009545 Bacteria 1959
287 Ga0105237_10740213 3300009545 Bacteria 990
288 Ga0105238_10000158 3300009551 Bacteria 74148
289 Ga0105238_10003457 3300009551 Bacteria 15713
290 Ga0105238_10003686 3300009551 Bacteria 15258
291 Ga0105238_10063836 3300009551 Bacteria 3684
292 Ga0105238_10818623 3300009551 Bacteria 947
293 Ga0105249_10018782 3300009553 Bacteria 6160
294 Ga0105249_10151901 3300009553 Bacteria 2230
295 Ga0105239_10002973 3300010375 Bacteria 21140
296 Ga0105239_10005034 3300010375 Bacteria 15602
297 Ga0105239_10006631 3300010375 Bacteria 13401
298 Ga0105239_10161015 3300010375 Bacteria 2507
299 Ga0105239_10308132 3300010375 Bacteria 1784
300 Ga0105239_10532499 3300010375 Bacteria 1337
301 Ga0105239_11307544 3300010375 Unclassified 836
302 Ga0105239_11858183 3300010375 Unclassified 698
303 Ga0105239_13611574 3300010375 Unclassified 503
304 Ga0105246_10097058 3300011119 Unclassified 2137
305 Ga0105246_10440380 3300011119 Bacteria 1093
306 Ga0157373_10854251 3300013100 Bacteria 673
307 Ga0157371_10958241 3300013102 Unclassified 651
308 Ga0157370_10370282 3300013104 Bacteria 1320
309 Ga0157369_10012629 3300013105 Bacteria 9577
310 Ga0157369_10040898 3300013105 Bacteria 5059
311 Ga0157369_10164003 3300013105 Unclassified 2344
312 Ga0157369_10285123 3300013105 Bacteria 1720
313 Ga0157374_10003280 3300013296 Bacteria 13597
314 Ga0157374_10023342 3300013296 Bacteria 5532
315 Ga0157374_10036252 3300013296 Bacteria 4517
316 Ga0157374_10060655 3300013296 Bacteria 3540
317 Ga0157374_10100913 3300013296 Bacteria 2767
318 Ga0157374_10229993 3300013296 Bacteria 1821
319 Ga0157374_10914933 3300013296 Bacteria 895
320 Ga0157378_10001627 3300013297 Bacteria 20310
321 Ga0157378_10015460 3300013297 Bacteria 6686
322 Ga0157378_10019350 3300013297 Bacteria 5986
323 Ga0157378_10052473 3300013297 Unclassified 3628
324 Ga0157378_10398606 3300013297 Bacteria 1355
325 Ga0157378_10937446 3300013297 Unclassified 898
326 Ga0157378_11578690 3300013297 Bacteria 702
327 Ga0163162_10038434 3300013306 Bacteria 4776
328 Ga0163162_10042583 3300013306 Bacteria 4545
329 Ga0163162_10054169 3300013306 Bacteria 4034
330 Ga0163162_10216306 3300013306 Unclassified 2046
331 Ga0163162_10349710 3300013306 Unclassified 1611
332 Ga0163162_10973049 3300013306 Bacteria 959
333 Ga0163162_12918810 3300013306 Bacteria 550
334 Ga0157372_10008726 3300013307 Bacteria 10767
335 Ga0157372_10031843 3300013307 Bacteria 5779
336 Ga0157372_10112498 3300013307 Bacteria 3119
337 Ga0157372_10113109 3300013307 Bacteria 3111
338 Ga0157372_10242079 3300013307 Bacteria 2093
339 Ga0157372_10362242 3300013307 Bacteria 1690
340 Ga0157375_10001472 3300013308 Bacteria 20241
341 Ga0157375_10006442 3300013308 Bacteria 10225
342 Ga0157375_10265626 3300013308 Bacteria 1878
343 Ga0157375_10667818 3300013308 Unclassified 1194
344 Ga0163163_10406866 3300014325 Bacteria 1419
345 Ga0163163_10794279 3300014325 Bacteria 1010
346 Ga0163163_12209526 3300014325 Unclassified 609
347 Ga0157380_10147330 3300014326 Bacteria 2030
348 Ga0157377_10048888 3300014745 Bacteria 2375
349 Ga0157377_10197526 3300014745 Bacteria 1275
350 Ga0157379_10009173 3300014968 Bacteria 8618
351 Ga0157379_10145884 3300014968 Bacteria 2134
352 Ga0157379_11237236 3300014968 Unclassified 719
353 Ga0157379_11695134 3300014968 Bacteria 619
354 Ga0157379_11723075 3300014968 Bacteria 614
355 Ga0157376_10000792 3300014969 Bacteria 20695
356 Ga0157376_10001580 3300014969 Bacteria 15053
357 Ga0157376_10047148 3300014969 Bacteria 3556
358 Ga0157376_10458529 3300014969 Bacteria 1245
359 Ga0157376_10541961 3300014969 Bacteria 1150
360 Ga0163161_10325414 3300017792 Bacteria 1216
361 Ga0213872_10416486 3300021361 Unclassified 543
362 Ga0228598_1006840 3300024227 Bacteria 2344
363 Ga0207697_10052748 3300025315 Bacteria 1683
364 Ga0207656_10026621 3300025321 Bacteria 2360
365 Ga0207656_10057595 3300025321 Bacteria 1696
366 Ga0207656_10086396 3300025321 Bacteria 1417
367 Ga0207653_10001051 3300025885 Bacteria 9083
368 Ga0207692_10199554 3300025898 Bacteria 1175
369 Ga0207692_10455578 3300025898 Bacteria 806
370 Ga0207692_10787837 3300025898 Bacteria 621
371 Ga0207642_10317225 3300025899 Bacteria 909
372 Ga0207642_10561542 3300025899 Bacteria 706
373 Ga0207710_10000259 3300025900 Bacteria 43990
374 Ga0207710_10238097 3300025900 Bacteria 907
375 Ga0207710_10554229 3300025900 Unclassified 599
376 Ga0207680_10251332 3300025903 Bacteria 1221
377 Ga0207680_10754606 3300025903 Bacteria 697
378 Ga0207647_10203928 3300025904 Bacteria 1143
379 Ga0207685_10004549 3300025905 Unclassified 3544
380 Ga0207685_10034299 3300025905 Bacteria 1842
381 Ga0207685_10414292 3300025905 Unclassified 693
382 Ga0207685_10578928 3300025905 Bacteria 600
383 Ga0207699_10001122 3300025906 Bacteria 12669
384 Ga0207699_10051030 3300025906 Bacteria 2443
385 Ga0207699_11186629 3300025906 Bacteria 565
386 Ga0207643_10732606 3300025908 Bacteria 640
387 Ga0207705_10167405 3300025909 Bacteria 1654
388 Ga0207705_10551370 3300025909 Bacteria 896
389 Ga0207705_11108553 3300025909 Bacteria 609
390 Ga0207684_10054909 3300025910 Bacteria 3380
391 Ga0207654_10000151 3300025911 Bacteria 43832
392 Ga0207654_10000976 3300025911 Bacteria 15728
393 Ga0207654_10004755 3300025911 Bacteria 6877
394 Ga0207654_10626877 3300025911 Bacteria 769
395 Ga0207654_10720851 3300025911 Bacteria 717
396 Ga0207654_10976403 3300025911 Bacteria 616
397 Ga0207695_10000188 3300025913 Bacteria 178721
398 Ga0207695_10001158 3300025913 Bacteria 45742
399 Ga0207695_10001234 3300025913 Bacteria 43772
400 Ga0207695_10089462 3300025913 Bacteria 3096
401 Ga0207695_10171220 3300025913 Unclassified 2097
402 Ga0207695_10412675 3300025913 Bacteria 1235
403 Ga0207671_10000942 3300025914 Bacteria 36249
404 Ga0207671_10003174 3300025914 Bacteria 16603
405 Ga0207671_10060323 3300025914 Bacteria 2814
406 Ga0207671_10398154 3300025914 Bacteria 1095
407 Ga0207671_11356380 3300025914 Unclassified 552
408 Ga0207693_10000087 3300025915 Bacteria 82834
409 Ga0207693_10012010 3300025915 Bacteria 7001
410 Ga0207693_10058732 3300025915 Bacteria 3013
411 Ga0207693_10277123 3300025915 Bacteria 1314
412 Ga0207693_10331581 3300025915 Bacteria 1191
413 Ga0207693_10900236 3300025915 Unclassified 679
414 Ga0207663_10007120 3300025916 Bacteria 5779
415 Ga0207663_10023743 3300025916 Bacteria 3524
416 Ga0207663_10081288 3300025916 Bacteria 2121
417 Ga0207663_10257266 3300025916 Bacteria 1288
418 Ga0207663_10435253 3300025916 Bacteria 1009
419 Ga0207663_10594328 3300025916 Unclassified 869
420 Ga0207660_10098100 3300025917 Unclassified 2185
421 Ga0207660_10272638 3300025917 Bacteria 1341
422 Ga0207662_10315445 3300025918 Bacteria 1043
423 Ga0207662_11001301 3300025918 Bacteria 593
424 Ga0207657_11452719 3300025919 Bacteria 514
425 Ga0207649_10026172 3300025920 Unclassified 3411
426 Ga0207649_10139682 3300025920 Bacteria 1656
427 Ga0207652_10013414 3300025921 Bacteria 6632
428 Ga0207646_11643632 3300025922 Bacteria 553
429 Ga0207681_10419035 3300025923 Bacteria 1084
430 Ga0207694_10000083 3300025924 Bacteria 109611
431 Ga0207694_10000290 3300025924 Bacteria 47323
432 Ga0207694_10001818 3300025924 Bacteria 17771
433 Ga0207694_10160000 3300025924 Bacteria 1818
434 Ga0207694_10552723 3300025924 Bacteria 966
435 Ga0207650_10036753 3300025925 Unclassified 3564
436 Ga0207650_10295455 3300025925 Bacteria 1322
437 Ga0207659_10000077 3300025926 Bacteria 62077
438 Ga0207687_10004527 3300025927 Bacteria 9251
439 Ga0207687_10005315 3300025927 Bacteria 8526
440 Ga0207687_10025686 3300025927 Unclassified 3942
441 Ga0207687_10404208 3300025927 Bacteria 1124
442 Ga0207700_10004413 3300025928 Bacteria 8293
443 Ga0207700_10007789 3300025928 Bacteria 6582
444 Ga0207700_10176955 3300025928 Unclassified 1783
445 Ga0207700_10189481 3300025928 Bacteria 1728
446 Ga0207700_10263921 3300025928 Bacteria 1475
447 Ga0207700_10621205 3300025928 Bacteria 962
448 Ga0207700_10642004 3300025928 Bacteria 946
449 Ga0207700_11078737 3300025928 Bacteria 718
450 Ga0207664_10016879 3300025929 Bacteria 5338
451 Ga0207664_11330818 3300025929 Bacteria 638
452 Ga0207644_10015999 3300025931 Bacteria 5043
453 Ga0207644_11105805 3300025931 Bacteria 666
454 Ga0207706_10058516 3300025933 Bacteria 3394
455 Ga0207686_10036251 3300025934 Bacteria 2968
456 Ga0207686_10236802 3300025934 Bacteria 1326
457 Ga0207686_10614149 3300025934 Bacteria 857
458 Ga0207686_10700869 3300025934 Bacteria 805
459 Ga0207709_10113776 3300025935 Bacteria 1814
460 Ga0207670_10505697 3300025936 Bacteria 982
461 Ga0207669_10819732 3300025937 Bacteria 773
462 Ga0207669_11347430 3300025937 Unclassified 607
463 Ga0207704_10573485 3300025938 Bacteria 920
464 Ga0207665_10000015 3300025939 Bacteria 133147
465 Ga0207665_10001233 3300025939 Bacteria 17248
466 Ga0207665_10161663 3300025939 Bacteria 1611
467 Ga0207665_10360962 3300025939 Bacteria 1098
468 Ga0207665_10392906 3300025939 Bacteria 1055
469 Ga0207691_10037114 3300025940 Bacteria 4513
470 Ga0207711_10006467 3300025941 Bacteria 9862
471 Ga0207711_10025346 3300025941 Bacteria 4975
472 Ga0207711_10945457 3300025941 Unclassified 801
473 Ga0207711_11074533 3300025941 Bacteria 745
474 Ga0207689_10002236 3300025942 Bacteria 18132
475 Ga0207689_10914683 3300025942 Bacteria 740
476 Ga0207661_10026192 3300025944 Bacteria 4440
477 Ga0207661_10272687 3300025944 Unclassified 1510
478 Ga0207661_10595130 3300025944 Bacteria 1015
479 Ga0207661_10845623 3300025944 Bacteria 842
480 Ga0207661_10854579 3300025944 Unclassified 838
481 Ga0207679_10216289 3300025945 Bacteria 1610
482 Ga0207667_10004502 3300025949 Bacteria 17076
483 Ga0207712_10062469 3300025961 Unclassified 2648
484 Ga0207712_10099148 3300025961 Bacteria 2162
485 Ga0207668_10189174 3300025972 Bacteria 1630
486 Ga0207668_10499826 3300025972 Bacteria 1046
487 Ga0207640_10100448 3300025981 Bacteria 2027
488 Ga0207640_10340635 3300025981 Bacteria 1201
489 Ga0207640_10905231 3300025981 Unclassified 771
490 Ga0207658_10002295 3300025986 Bacteria 14127
491 Ga0207677_10001520 3300026023 Bacteria 12266
492 Ga0207677_10236897 3300026023 Bacteria 1474
493 Ga0207677_10316522 3300026023 Bacteria 1295
494 Ga0207703_10010887 3300026035 Bacteria 7091
495 Ga0207703_10025580 3300026035 Bacteria 4643
496 Ga0207703_12224117 3300026035 Unclassified 524
497 Ga0207639_10000027 3300026041 Bacteria 197829
498 Ga0207639_10029598 3300026041 Unclassified 4011
499 Ga0207639_10068385 3300026041 Bacteria 2768
500 Ga0207639_10083705 3300026041 Bacteria 2532
501 Ga0207639_10353263 3300026041 Bacteria 1313
502 Ga0207678_10024846 3300026067 Bacteria 5231
503 Ga0207678_10302149 3300026067 Bacteria 1375
504 Ga0207702_10000823 3300026078 Bacteria 32729
505 Ga0207702_10015372 3300026078 Bacteria 6343
506 Ga0207702_10038960 3300026078 Unclassified 3981
507 Ga0207702_11064639 3300026078 Bacteria 803
508 Ga0207641_10001089 3300026088 Bacteria 27318
509 Ga0207641_10651047 3300026088 Bacteria 1035
510 Ga0207648_10168510 3300026089 Bacteria 1935
511 Ga0207676_10013135 3300026095 Bacteria 5945
512 Ga0207676_10078992 3300026095 Bacteria 2667
513 Ga0207674_10000385 3300026116 Bacteria 57430
514 Ga0207674_10001011 3300026116 Bacteria 36730
515 Ga0207675_100114002 3300026118 Bacteria 2553
516 Ga0207675_100170215 3300026118 Bacteria 2082
517 Ga0207675_100365389 3300026118 Bacteria 1417
518 Ga0207675_101561887 3300026118 Unclassified 680
519 Ga0207698_10000065 3300026142 Bacteria 71171
520 Ga0207698_10255863 3300026142 Bacteria 1605
521 Ga0207698_10985380 3300026142 Bacteria 853
522 Ga0207698_11578763 3300026142 Bacteria 672
523 Ga0209588_1012680 3300027671 Unclassified 2561
524 Ga0209588_1016448 3300027671 Bacteria 2284
525 Ga0209588_1016784 3300027671 Bacteria 2264
526 Ga0209588_1036120 3300027671 Unclassified 1589
527 Ga0207428_10037777 3300027907 Bacteria 3928
528 Ga0207428_10443939 3300027907 Bacteria 946
529 Ga0207428_10456466 3300027907 Unclassified 931
530 Ga0207428_10506024 3300027907 Unclassified 877
531 Ga0268266_10003695 3300028379 Bacteria 15088
532 Ga0268266_10020551 3300028379 Bacteria 5626
533 Ga0268265_10008987 3300028380 Bacteria 6758
534 Ga0268265_12355789 3300028380 Bacteria 539
535 Ga0268265_12713174 3300028380 Bacteria 501
536 Ga0268264_10002414 3300028381 Bacteria 16444
537 Ga0268264_10082201 3300028381 Bacteria 2755
538 Ga0265338_10668045 3300028800 Unclassified 719
539 Ga0265760_10263989 3300031090 Unclassified 600
540 Ga0265320_10237009 3300031240 Unclassified 811
541 Ga0265320_10392853 3300031240 Bacteria 613
542 Ga0265325_10347502 3300031241 Bacteria 656
543 Ga0265313_10420753 3300031595 Bacteria 522
544 Ga0307516_10864004 3300031730 Unclassified 569
545 Ga0373926_0000611 3300035083 Bacteria 9693
546 Ga0373926_0046579 3300035083 Bacteria 1556
547 Ga0373926_0068355 3300035083 Bacteria 1302
548 Ga0373926_0166039 3300035083 Bacteria 844
549 Ga0373929_0181358 3300035085 Bacteria 581
550 Ga0373923_0376838 3300035111 Bacteria 680
551 Ga0373936_0294991 3300035113 Unclassified 731
552 Ga0373941_0511369 3300035115 Bacteria 512
553 Ga0373945_0022267 3300035116 Bacteria 2181
554 Ga0373945_0423205 3300035116 Bacteria 586
555 Ga0373945_0547727 3300035116 Unclassified 519
556 Ga0373953_0369477 3300035117 Unclassified 630
557 Ga0373954_0045616 3300035118 Bacteria 2048
558 Ga0373954_0533031 3300035118 Unclassified 582
559 Ga0373954_0550258 3300035118 Bacteria 572
560 Ga0373943_0006771 3300035170 Bacteria 5144
561 Ga0373943_0985064 3300035170 Bacteria 505
562 Ga0373946_0006398 3300035171 Bacteria 4267
563 Ga0373946_0031565 3300035171 Bacteria 2123
564 Ga0373946_0227742 3300035171 Bacteria 902
565 Ga0373955_0180858 3300035172 Bacteria 1251
566 Ga0373955_0245035 3300035172 Bacteria 1074
567 Ga0373955_0453851 3300035172 Bacteria 781
568 Ga0373942_0269095 3300035207 Unclassified 584
569 Ga0373962_0270757 3300035242 Unclassified 595
570 Ga0373924_0186659 3300035410 Bacteria 913
571 Ga0373931_0187341 3300035691 Bacteria 1229
572 Ga0373931_0475588 3300035691 Bacteria 802
573 Ga0373931_0586114 3300035691 Bacteria 728
574 Ga0373935_0092720 3300035692 Bacteria 1980
575 Ga0373935_0310347 3300035692 Bacteria 1117
576 Ga0373935_0317448 3300035692 Bacteria 1105
577 Ga0373935_1086485 3300035692 Bacteria 595
578 Ga0373927_0000461 3300035695 Bacteria 31104
579 Ga0373927_0000786 3300035695 Bacteria 24231
580 Ga0373927_0003818 3300035695 Bacteria 10694
581 Ga0373927_0027279 3300035695 Bacteria 3730
582 Ga0373927_0111232 3300035695 Bacteria 1785
583 Ga0373927_0189597 3300035695 Bacteria 1349
584 Ga0373933_0966231 3300035724 Bacteria 561
585 Ga0373933_1135182 3300035724 Unclassified 515
586 Ga0373947_0003616 3300035725 Bacteria 9123
587 Ga0373947_0016152 3300035725 Bacteria 4290
588 Ga0373947_0518013 3300035725 Unclassified 811
589 Ga0373937_0066395 3300036401 Bacteria 3322
590 Ga0373937_0124616 3300036401 Bacteria 2403
591 Ga0373937_0342388 3300036401 Bacteria 1416
592 Ga0373937_1132494 3300036401 Unclassified 731
593 Ga0373925_0000106 3300037068 Bacteria 89944
594 Ga0373925_0001038 3300037068 Bacteria 25179
595 Ga0373925_0227229 3300037068 Bacteria 1491
596 Ga0373925_0270106 3300037068 Unclassified 1368
597 Ga0373925_0325824 3300037068 Unclassified 1244
598 Ga0373925_0556247 3300037068 Bacteria 944
599 Ga0373925_0930419 3300037068 Unclassified 716
600 Ga0373925_1682289 3300037068 Bacteria 518
601 Ga0395899_0058403 3300037312 Bacteria 2845
602 Ga0395900_0011181 3300037418 Bacteria 9178
603 Ga0395900_0043417 3300037418 Bacteria 4634
604 Ga0395905_0000567 3300037471 Bacteria 50054
605 Ga0395901_0001390 3300038443 Bacteria 25294
606 Ga0436365_0353434 3300039437 Bacteria 2272
607 Ga0436365_1276255 3300039437 Bacteria 902
608 Ga0436361_0451209 3300039447 Unclassified 928
609 Ga0436363_1192250 3300039450 Bacteria 588
610 Ga0439448_0069274 3300042005 Bacteria 1174
611 Ga0466963_0663537 3300044694 Bacteria 736
612 Ga0466971_0285547 3300044719 Unclassified 790
613 Ga0451576_0235331 3300045051 Bacteria 1913
614 Ga0451576_1095313 3300045051 Unclassified 834
615 Ga0466958_1012198 3300045836 Bacteria 542
616 Ga0495592_0752526 3300046454 Unclassified 582
617 Ga0495603_0063126 3300046455 Bacteria 2186
618 Ga0495603_0625100 3300046455 Bacteria 616
619 Ga0495629_0135599 3300046459 Bacteria 1714
620 Ga0495651_0172470 3300046462 Bacteria 1539
621 Ga0495651_0357786 3300046462 Bacteria 963
622 Ga0495580_0002472 3300046472 Bacteria 16135
623 Ga0495580_0203860 3300046472 Unclassified 1362
624 Ga0495580_0524060 3300046472 Bacteria 789
625 Ga0495580_0854505 3300046472 Bacteria 587
626 Ga0495582_0162211 3300046473 Bacteria 1271
627 Ga0495639_0130590 3300046475 Bacteria 1202
628 Ga0495639_0229007 3300046475 Bacteria 915
629 Ga0495662_0191230 3300046476 Unclassified 1009
630 Ga0495662_0222842 3300046476 Unclassified 930
631 Ga0495664_0144379 3300046477 Bacteria 1443
632 Ga0495584_0250670 3300046491 Bacteria 900
633 Ga0495594_0034320 3300046499 Bacteria 2760
634 Ga0495594_0194197 3300046499 Bacteria 1157
635 Ga0495594_0442760 3300046499 Unclassified 739
636 Ga0495632_0410033 3300046519 Unclassified 591
637 Ga0495644_0153771 3300046523 Bacteria 881
638 Ga0495666_0007843 3300046526 Bacteria 5346
639 Ga0495642_0074780 3300046528 Bacteria 1421
640 Ga0495586_0034954 3300046535 Unclassified 2700
641 Ga0495586_0733472 3300046535 Unclassified 570
642 Ga0495587_0004260 3300046536 Bacteria 9457
643 Ga0495598_0289768 3300046537 Bacteria 617
644 Ga0495645_0087801 3300046543 Bacteria 2224
645 Ga0495622_0464980 3300046557 Bacteria 542
646 Ga0495633_0114860 3300046558 Bacteria 1248
647 Ga0495633_0240529 3300046558 Bacteria 827
648 Ga0495635_0054410 3300046663 Bacteria 2757
649 Ga0495635_0684443 3300046663 Unclassified 666
650 Ga0495659_0176401 3300046664 Bacteria 869
651 Ga0495659_0533518 3300046664 Bacteria 517
652 Ga0495658_0581485 3300046683 Bacteria 717
653 Ga0495669_0063069 3300046684 Bacteria 1681
654 Ga0495669_0241039 3300046684 Unclassified 868
655 Ga0495624_0119783 3300046690 Unclassified 1617
656 Ga0495624_0130295 3300046690 Bacteria 1542
657 Ga0495670_0225464 3300046691 Unclassified 996
658 Ga0495604_0539393 3300047317 Bacteria 753
659 Ga0495604_1013738 3300047317 Unclassified 513
660 Ga0495636_0073682 3300047318 Bacteria 1461
661 Ga0495674_0384478 3300047319 Bacteria 1135
662 Ga0495680_0617198 3300047322 Unclassified 724
663 Ga0495687_067960 3300047443 Bacteria 1440
664 Ga0495675_0686360 3300047444 Bacteria 574
665 Ga0496100_0846925 3300048903 Bacteria 717
666 Ga0496104_0358626 3300048907 Bacteria 1370
667 Ga0496105_0265294 3300048908 Bacteria 1388
668 Ga0496105_1252902 3300048908 Bacteria 544
669 Ga0496108_1486085 3300048911 Unclassified 564
670 Ga0496109_0447002 3300048912 Bacteria 1221
671 Ga0496112_1079266 3300048915 Bacteria 721
672 Ga0496114_0022641 3300048917 Bacteria 5122
673 Ga0496115_0016399 3300048918 Bacteria 5642
674 Ga0496115_0568471 3300048918 Bacteria 904
675 Ga0496118_0106844 3300048921 Unclassified 1871
676 Ga0496121_0124859 3300048924 Bacteria 1937
677 Ga0496125_0000271 3300048928 Bacteria 105521
678 Ga0496126_0063201 3300048929 Bacteria 3319
679 Ga0501067_0242904 3300049583 Bacteria 1002
680 nmdc:mga03n38_575062_c1 3300050490 Bacteria 639
681 nmdc:mga05p37_1122_c2 3300050507 Bacteria 25399
682 nmdc:mga05p37_212744_c1 3300050507 Bacteria 2336
683 nmdc:mga05p37_338924_c1 3300050507 Bacteria 1774
684 nmdc:mga05p37_5195_c1 3300050507 Bacteria 15276
685 nmdc:mga05p37_871111_c1 3300050507 Unclassified 975
686 nmdc:mga09592_254919_c1 3300050508 Bacteria 1521
687 nmdc:mga0qj67_8892_c1 3300050509 Bacteria 7451
688 nmdc:mga06r32_476_c1 3300050510 Bacteria 34429
689 nmdc:mga06r32_849411_c1 3300050510 Bacteria 871
690 nmdc:mga08y16_171126_c2 3300050511 Unclassified 1387
691 nmdc:mga08y16_2146_c1 3300050511 Bacteria 20235
692 nmdc:mga0n895_1022573_c1 3300050512 Unclassified 807
693 nmdc:mga0n895_1244404_c1 3300050512 Unclassified 717
694 nmdc:mga0n895_13067_c1 3300050512 Bacteria 7469
695 nmdc:mga0n895_16651_c1 3300050512 Bacteria 6751
696 nmdc:mga0n895_299467_c1 3300050512 Bacteria 1630
697 nmdc:mga0rr50_124348_c1 3300050513 Bacteria 2057
698 nmdc:mga0rr50_1276644_c1 3300050513 Unclassified 623
699 nmdc:mga0rr50_128009_c1 3300050513 Unclassified 2029
700 nmdc:mga0rr50_1851477_c1 3300050513 Bacteria 507
701 nmdc:mga08x19_125874_c1 3300050514 Unclassified 1721
702 nmdc:mga08x19_2595_c1 3300050514 Bacteria 10966
703 nmdc:mga08x19_411614_c1 3300050514 Bacteria 949
704 nmdc:mga08x19_462374_c1 3300050514 Bacteria 894
705 nmdc:mga0a205_1020705_c1 3300050515 Unclassified 674
706 nmdc:mga0a205_20947_c1 3300050515 Bacteria 6179
707 nmdc:mga0a205_5985_c1 3300050515 Bacteria 10962
708 Ga0495601_0097366 3300053077 Bacteria 1898
709 Ga0495601_0261451 3300053077 Unclassified 1130
710 Ga0495619_0021095 3300053085 Bacteria 4157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0027279 Ga0373927_0027279_2156_2401 63
2 3300005327 Ga0070658_10510016 Ga0070658_105100161 67
3 3300005339 Ga0070660_101688382 Ga0070660_1016883822 67
4 3300006871 Ga0075434_101379297 Ga0075434_1013792972 67
5 3300009147 Ga0114129_10986889 Ga0114129_109868892 67
6 3300025909 Ga0207705_10551370 Ga0207705_105513703 67
7 3300025919 Ga0207657_11452719 Ga0207657_114527193 67
8 3300050512 nmdc:mga0n895_1244404_c1 nmdc:mga0n895_1244404_c1_347_559 67
9 3300005328 Ga0070676_10452113 Ga0070676_104521132 68
10 3300005330 Ga0070690_100152886 Ga0070690_1001528862 68
11 3300005330 Ga0070690_100461251 Ga0070690_1004612512 68
12 3300005338 Ga0068868_100329462 Ga0068868_1003294622 68
13 3300005339 Ga0070660_101766881 Ga0070660_1017668812 68
14 3300005340 Ga0070689_101007275 Ga0070689_1010072752 68
15 3300005343 Ga0070687_100926687 Ga0070687_1009266872 68
16 3300005354 Ga0070675_100000911 Ga0070675_10000091116 68
17 3300005354 Ga0070675_101545372 Ga0070675_1015453721 68
18 3300005435 Ga0070714_100396821 Ga0070714_1003968213 68
19 3300005439 Ga0070711_100783166 Ga0070711_1007831663 68
20 3300005466 Ga0070685_10398169 Ga0070685_103981692 68
21 3300005544 Ga0070686_100814042 Ga0070686_1008140422 68
22 3300005548 Ga0070665_100001033 Ga0070665_10000103329 68
23 3300005617 Ga0068859_100367443 Ga0068859_1003674431 68
24 3300005617 Ga0068859_101039209 Ga0068859_1010392092 68
25 3300005618 Ga0068864_100092675 Ga0068864_1000926753 68
26 3300005719 Ga0068861_101412505 Ga0068861_1014125052 68
27 3300005841 Ga0068863_101530890 Ga0068863_1015308902 68
28 3300005842 Ga0068858_100035778 Ga0068858_1000357786 68
29 3300005842 Ga0068858_100251338 Ga0068858_1002513383 68
30 3300005843 Ga0068860_101003503 Ga0068860_1010035032 68
31 3300006163 Ga0070715_10557938 Ga0070715_105579382 68
32 3300006237 Ga0097621_100279714 Ga0097621_1002797142 68
33 3300006237 Ga0097621_101366303 Ga0097621_1013663033 68
34 3300006358 Ga0068871_100332729 Ga0068871_1003327292 68
35 3300006881 Ga0068865_100054311 Ga0068865_1000543112 68
36 3300006881 Ga0068865_101425863 Ga0068865_1014258633 68
37 3300006931 Ga0097620_100367417 Ga0097620_1003674171 68
38 3300006931 Ga0097620_101038901 Ga0097620_1010389012 68
39 3300009098 Ga0105245_10038935 Ga0105245_100389356 68
40 3300009101 Ga0105247_10350217 Ga0105247_103502172 68
41 3300009174 Ga0105241_10473236 Ga0105241_104732362 68
42 3300009176 Ga0105242_10028411 Ga0105242_100284113 68
43 3300009177 Ga0105248_10440821 Ga0105248_104408212 68
44 3300010375 Ga0105239_10532499 Ga0105239_105324993 68
45 3300013296 Ga0157374_10060655 Ga0157374_100606551 68
46 3300013296 Ga0157374_10100913 Ga0157374_101009134 68
47 3300013297 Ga0157378_11578690 Ga0157378_115786902 68
48 3300013306 Ga0163162_10054169 Ga0163162_100541691 68
49 3300013306 Ga0163162_10216306 Ga0163162_102163062 68
50 3300013308 Ga0157375_10265626 Ga0157375_102656263 68
51 3300014325 Ga0163163_10406866 Ga0163163_104068662 68
52 3300014745 Ga0157377_10048888 Ga0157377_100488883 68
53 3300014968 Ga0157379_10145884 Ga0157379_101458842 68
54 3300014968 Ga0157379_11695134 Ga0157379_116951342 68
55 3300014969 Ga0157376_10001580 Ga0157376_100015802 68
56 3300014969 Ga0157376_10458529 Ga0157376_104585292 68
57 3300025315 Ga0207697_10052748 Ga0207697_100527483 68
58 3300025899 Ga0207642_10561542 Ga0207642_105615422 68
59 3300025900 Ga0207710_10238097 Ga0207710_102380971 68
60 3300025903 Ga0207680_10251332 Ga0207680_102513321 68
61 3300025905 Ga0207685_10578928 Ga0207685_105789282 68
62 3300025913 Ga0207695_10412675 Ga0207695_104126752 68
63 3300025916 Ga0207663_10594328 Ga0207663_105943283 68
64 3300025918 Ga0207662_10315445 Ga0207662_103154452 68
65 3300025926 Ga0207659_10000077 Ga0207659_1000007724 68
66 3300025927 Ga0207687_10005315 Ga0207687_100053156 68
67 3300025931 Ga0207644_11105805 Ga0207644_111058053 68
68 3300025934 Ga0207686_10036251 Ga0207686_100362514 68
69 3300025934 Ga0207686_10700869 Ga0207686_107008692 68
70 3300025937 Ga0207669_11347430 Ga0207669_113474302 68
71 3300025939 Ga0207665_10392906 Ga0207665_103929063 68
72 3300025941 Ga0207711_11074533 Ga0207711_110745332 68
73 3300025942 Ga0207689_10914683 Ga0207689_109146832 68
74 3300026035 Ga0207703_10025580 Ga0207703_100255802 68
75 3300026088 Ga0207641_10651047 Ga0207641_106510473 68
76 3300026095 Ga0207676_10078992 Ga0207676_100789923 68
77 3300026118 Ga0207675_101561887 Ga0207675_1015618872 68
78 3300028379 Ga0268266_10003695 Ga0268266_100036953 68
79 3300028380 Ga0268265_12713174 Ga0268265_127131742 68
80 3300035083 Ga0373926_0046579 Ga0373926_0046579_1140_1352 68
81 3300035113 Ga0373936_0294991 Ga0373936_0294991_154_366 68
82 3300035116 Ga0373945_0022267 Ga0373945_0022267_1795_2007 68
83 3300035117 Ga0373953_0369477 Ga0373953_0369477_233_439 68
84 3300035170 Ga0373943_0006771 Ga0373943_0006771_1032_1244 68
85 3300035171 Ga0373946_0031565 Ga0373946_0031565_1333_1545 68
86 3300035171 Ga0373946_0227742 Ga0373946_0227742_166_372 68
87 3300035172 Ga0373955_0245035 Ga0373955_0245035_574_780 68
88 3300035410 Ga0373924_0186659 Ga0373924_0186659_332_538 68
89 3300035691 Ga0373931_0475588 Ga0373931_0475588_81_290 68
90 3300035692 Ga0373935_0092720 Ga0373935_0092720_1057_1269 68
91 3300035695 Ga0373927_0000461 Ga0373927_0000461_9608_9820 68
92 3300035724 Ga0373933_0966231 Ga0373933_0966231_327_533 68
93 3300035725 Ga0373947_0003616 Ga0373947_0003616_814_1026 68
94 3300036401 Ga0373937_0124616 Ga0373937_0124616_514_720 68
95 3300037068 Ga0373925_0000106 Ga0373925_0000106_86587_86799 68
96 3300037068 Ga0373925_0930419 Ga0373925_0930419_144_350 68
97 3300046459 Ga0495629_0135599 Ga0495629_0135599_812_1018 68
98 3300046472 Ga0495580_0524060 Ga0495580_0524060_546_752 68
99 3300046475 Ga0495639_0130590 Ga0495639_0130590_351_557 68
100 3300046476 Ga0495662_0191230 Ga0495662_0191230_622_834 68
101 3300046476 Ga0495662_0222842 Ga0495662_0222842_22_228 68
102 3300046535 Ga0495586_0034954 Ga0495586_0034954_1876_2088 68
103 3300046535 Ga0495586_0733472 Ga0495586_0733472_200_406 68
104 3300046537 Ga0495598_0289768 Ga0495598_0289768_165_371 68
105 3300046558 Ga0495633_0114860 Ga0495633_0114860_964_1170 68
106 3300046663 Ga0495635_0054410 Ga0495635_0054410_572_778 68
107 3300046683 Ga0495658_0581485 Ga0495658_0581485_384_590 68
108 3300046690 Ga0495624_0119783 Ga0495624_0119783_337_549 68
109 3300046691 Ga0495670_0225464 Ga0495670_0225464_514_720 68
110 3300047317 Ga0495604_0539393 Ga0495604_0539393_19_225 68
111 3300047322 Ga0495680_0617198 Ga0495680_0617198_183_389 68
112 3300047444 Ga0495675_0686360 Ga0495675_0686360_344_550 68
113 3300048907 Ga0496104_0358626 Ga0496104_0358626_728_937 68
114 3300048908 Ga0496105_0265294 Ga0496105_0265294_686_895 68
115 3300048912 Ga0496109_0447002 Ga0496109_0447002_560_769 68
116 3300048915 Ga0496112_1079266 Ga0496112_1079266_363_572 68
117 3300048917 Ga0496114_0022641 Ga0496114_0022641_3137_3346 68
118 3300048918 Ga0496115_0016399 Ga0496115_0016399_2224_2433 68
119 3300050490 nmdc:mga03n38_575062_c1 nmdc:mga03n38_575062_c1_211_417 68
120 3300050513 nmdc:mga0rr50_128009_c1 nmdc:mga0rr50_128009_c1_838_1047 68
121 3300053077 Ga0495601_0261451 Ga0495601_0261451_340_546 68
122 3300053085 Ga0495619_0021095 Ga0495619_0021095_3657_3863 68
123 3300005329 Ga0070683_100000438 Ga0070683_1000004383 69
124 3300005329 Ga0070683_100103728 Ga0070683_1001037283 69
125 3300005329 Ga0070683_100707100 Ga0070683_1007071002 69
126 3300005329 Ga0070683_100716157 Ga0070683_1007161572 69
127 3300005329 Ga0070683_100955708 Ga0070683_1009557082 69
128 3300005331 Ga0070670_100014132 Ga0070670_1000141323 69
129 3300005331 Ga0070670_100150745 Ga0070670_1001507454 69
130 3300005334 Ga0068869_100002425 Ga0068869_1000024253 69
131 3300005334 Ga0068869_101610022 Ga0068869_1016100222 69
132 3300005335 Ga0070666_10178838 Ga0070666_101788383 69
133 3300005337 Ga0070682_100764111 Ga0070682_1007641112 69
134 3300005338 Ga0068868_100521159 Ga0068868_1005211592 69
135 3300005338 Ga0068868_100880733 Ga0068868_1008807332 69
136 3300005339 Ga0070660_101182708 Ga0070660_1011827082 69
137 3300005344 Ga0070661_100000289 Ga0070661_1000002891 69
138 3300005344 Ga0070661_100154423 Ga0070661_1001544232 69
139 3300005344 Ga0070661_100427738 Ga0070661_1004277383 69
140 3300005355 Ga0070671_100013048 Ga0070671_1000130487 69
141 3300005367 Ga0070667_100002851 Ga0070667_10000285110 69
142 3300005434 Ga0070709_10000507 Ga0070709_100005073 69
143 3300005434 Ga0070709_11124098 Ga0070709_111240981 69
144 3300005435 Ga0070714_100107226 Ga0070714_1001072263 69
145 3300005436 Ga0070713_100001370 Ga0070713_1000013702 69
146 3300005436 Ga0070713_100084861 Ga0070713_1000848613 69
147 3300005436 Ga0070713_100161289 Ga0070713_1001612893 69
148 3300005436 Ga0070713_101734255 Ga0070713_1017342552 69
149 3300005437 Ga0070710_10280676 Ga0070710_102806762 69
150 3300005439 Ga0070711_100125948 Ga0070711_1001259483 69
151 3300005455 Ga0070663_100040297 Ga0070663_1000402975 69
152 3300005455 Ga0070663_101908968 Ga0070663_1019089682 69
153 3300005535 Ga0070684_100000161 Ga0070684_10000016110 69
154 3300005535 Ga0070684_100054118 Ga0070684_1000541182 69
155 3300005535 Ga0070684_100424625 Ga0070684_1004246253 69
156 3300005535 Ga0070684_101859047 Ga0070684_1018590472 69
157 3300005539 Ga0068853_100002829 Ga0068853_1000028295 69
158 3300005539 Ga0068853_100053870 Ga0068853_1000538703 69
159 3300005539 Ga0068853_100243654 Ga0068853_1002436543 69
160 3300005539 Ga0068853_100383254 Ga0068853_1003832542 69
161 3300005548 Ga0070665_100019217 Ga0070665_1000192174 69
162 3300005548 Ga0070665_100073606 Ga0070665_1000736066 69
163 3300005563 Ga0068855_100003811 Ga0068855_1000038113 69
164 3300005563 Ga0068855_100360311 Ga0068855_1003603112 69
165 3300005564 Ga0070664_100238972 Ga0070664_1002389722 69
166 3300005577 Ga0068857_100003923 Ga0068857_1000039237 69
167 3300005577 Ga0068857_100004193 Ga0068857_1000041938 69
168 3300005578 Ga0068854_100109442 Ga0068854_1001094422 69
169 3300005578 Ga0068854_100351078 Ga0068854_1003510782 69
170 3300005578 Ga0068854_101390538 Ga0068854_1013905382 69
171 3300005614 Ga0068856_100010164 Ga0068856_1000101647 69
172 3300005614 Ga0068856_100016286 Ga0068856_1000162863 69
173 3300005614 Ga0068856_100026736 Ga0068856_1000267363 69
174 3300005614 Ga0068856_100036270 Ga0068856_1000362705 69
175 3300005616 Ga0068852_100000168 Ga0068852_1000001683 69
176 3300005616 Ga0068852_100196217 Ga0068852_1001962173 69
177 3300005616 Ga0068852_100237394 Ga0068852_1002373942 69
178 3300005617 Ga0068859_100014850 Ga0068859_1000148502 69
179 3300005618 Ga0068864_100000766 Ga0068864_10000076610 69
180 3300005834 Ga0068851_10020291 Ga0068851_100202914 69
181 3300005834 Ga0068851_10197177 Ga0068851_101971772 69
182 3300005834 Ga0068851_11021028 Ga0068851_110210282 69
183 3300005841 Ga0068863_100056211 Ga0068863_1000562113 69
184 3300005842 Ga0068858_100001558 Ga0068858_10000155815 69
185 3300005843 Ga0068860_100000853 Ga0068860_1000008537 69
186 3300005844 Ga0068862_100073831 Ga0068862_1000738313 69
187 3300006028 Ga0070717_10709328 Ga0070717_107093282 69
188 3300006028 Ga0070717_11457961 Ga0070717_114579611 69
189 3300006163 Ga0070715_10034982 Ga0070715_100349822 69
190 3300006173 Ga0070716_100042800 Ga0070716_1000428002 69
191 3300006175 Ga0070712_100000621 Ga0070712_10000062114 69
192 3300006175 Ga0070712_100471613 Ga0070712_1004716132 69
193 3300006175 Ga0070712_100547975 Ga0070712_1005479752 69
194 3300006237 Ga0097621_100002181 Ga0097621_10000218110 69
195 3300006237 Ga0097621_100046304 Ga0097621_1000463043 69
196 3300006358 Ga0068871_100041280 Ga0068871_1000412802 69
197 3300006358 Ga0068871_100052553 Ga0068871_1000525534 69
198 3300006931 Ga0097620_100014850 Ga0097620_1000148502 69
199 3300009093 Ga0105240_10000594 Ga0105240_100005945 69
200 3300009093 Ga0105240_10004531 Ga0105240_100045313 69
201 3300009093 Ga0105240_10008135 Ga0105240_1000813510 69
202 3300009093 Ga0105240_10015824 Ga0105240_100158243 69
203 3300009093 Ga0105240_10951919 Ga0105240_109519192 69
204 3300009093 Ga0105240_11867307 Ga0105240_118673072 69
205 3300009098 Ga0105245_10002548 Ga0105245_1000254810 69
206 3300009098 Ga0105245_10007961 Ga0105245_100079612 69
207 3300009098 Ga0105245_10179032 Ga0105245_101790323 69
208 3300009101 Ga0105247_10000309 Ga0105247_1000030911 69
209 3300009174 Ga0105241_10000484 Ga0105241_100004844 69
210 3300009174 Ga0105241_10002430 Ga0105241_1000243010 69
211 3300009174 Ga0105241_10025344 Ga0105241_100253442 69
212 3300009174 Ga0105241_10217895 Ga0105241_102178952 69
213 3300009174 Ga0105241_10272123 Ga0105241_102721233 69
214 3300009174 Ga0105241_10902298 Ga0105241_109022982 69
215 3300009174 Ga0105241_12560763 Ga0105241_125607632 69
216 3300009176 Ga0105242_10156317 Ga0105242_101563172 69
217 3300009177 Ga0105248_10002507 Ga0105248_100025073 69
218 3300009177 Ga0105248_10021050 Ga0105248_100210504 69
219 3300009545 Ga0105237_10006164 Ga0105237_1000616410 69
220 3300009545 Ga0105237_10013070 Ga0105237_100130704 69
221 3300009545 Ga0105237_10099970 Ga0105237_100999703 69
222 3300009545 Ga0105237_10207649 Ga0105237_102076493 69
223 3300009545 Ga0105237_10740213 Ga0105237_107402132 69
224 3300009551 Ga0105238_10000158 Ga0105238_100001583 69
225 3300009551 Ga0105238_10003457 Ga0105238_100034576 69
226 3300009551 Ga0105238_10003686 Ga0105238_100036863 69
227 3300009551 Ga0105238_10063836 Ga0105238_100638363 69
228 3300009551 Ga0105238_10818623 Ga0105238_108186232 69
229 3300009553 Ga0105249_10018782 Ga0105249_100187823 69
230 3300010375 Ga0105239_10002973 Ga0105239_100029735 69
231 3300010375 Ga0105239_10005034 Ga0105239_100050344 69
232 3300010375 Ga0105239_10006631 Ga0105239_1000663110 69
233 3300010375 Ga0105239_10161015 Ga0105239_101610152 69
234 3300010375 Ga0105239_10308132 Ga0105239_103081323 69
235 3300010375 Ga0105239_11307544 Ga0105239_113075442 69
236 3300010375 Ga0105239_11858183 Ga0105239_118581831 69
237 3300010375 Ga0105239_13611574 Ga0105239_136115741 69
238 3300011119 Ga0105246_10097058 Ga0105246_100970583 69
239 3300011119 Ga0105246_10440380 Ga0105246_104403801 69
240 3300013102 Ga0157371_10958241 Ga0157371_109582412 69
241 3300013104 Ga0157370_10370282 Ga0157370_103702822 69
242 3300013105 Ga0157369_10012629 Ga0157369_100126293 69
243 3300013105 Ga0157369_10040898 Ga0157369_100408983 69
244 3300013105 Ga0157369_10164003 Ga0157369_101640032 69
245 3300013105 Ga0157369_10285123 Ga0157369_102851233 69
246 3300013296 Ga0157374_10003280 Ga0157374_100032802 69
247 3300013296 Ga0157374_10023342 Ga0157374_100233423 69
248 3300013296 Ga0157374_10036252 Ga0157374_100362523 69
249 3300013296 Ga0157374_10229993 Ga0157374_102299932 69
250 3300013296 Ga0157374_10914933 Ga0157374_109149332 69
251 3300013297 Ga0157378_10001627 Ga0157378_1000162715 69
252 3300013297 Ga0157378_10015460 Ga0157378_100154606 69
253 3300013297 Ga0157378_10052473 Ga0157378_100524733 69
254 3300013297 Ga0157378_10398606 Ga0157378_103986062 69
255 3300013306 Ga0163162_10042583 Ga0163162_100425833 69
256 3300013306 Ga0163162_10973049 Ga0163162_109730492 69
257 3300013307 Ga0157372_10008726 Ga0157372_100087263 69
258 3300013307 Ga0157372_10031843 Ga0157372_100318434 69
259 3300013307 Ga0157372_10112498 Ga0157372_101124983 69
260 3300013307 Ga0157372_10113109 Ga0157372_101131094 69
261 3300013307 Ga0157372_10242079 Ga0157372_102420793 69
262 3300013307 Ga0157372_10362242 Ga0157372_103622423 69
263 3300013308 Ga0157375_10001472 Ga0157375_1000147215 69
264 3300013308 Ga0157375_10006442 Ga0157375_100064425 69
265 3300014325 Ga0163163_10794279 Ga0163163_107942793 69
266 3300014745 Ga0157377_10197526 Ga0157377_101975263 69
267 3300014968 Ga0157379_10009173 Ga0157379_100091739 69
268 3300014969 Ga0157376_10000792 Ga0157376_100007923 69
269 3300014969 Ga0157376_10047148 Ga0157376_100471483 69
270 3300014969 Ga0157376_10541961 Ga0157376_105419612 69
271 3300025321 Ga0207656_10026621 Ga0207656_100266213 69
272 3300025321 Ga0207656_10057595 Ga0207656_100575953 69
273 3300025321 Ga0207656_10086396 Ga0207656_100863963 69
274 3300025898 Ga0207692_10455578 Ga0207692_104555783 69
275 3300025900 Ga0207710_10000259 Ga0207710_1000025910 69
276 3300025900 Ga0207710_10554229 Ga0207710_105542292 69
277 3300025903 Ga0207680_10754606 Ga0207680_107546061 69
278 3300025904 Ga0207647_10203928 Ga0207647_102039282 69
279 3300025905 Ga0207685_10034299 Ga0207685_100342991 69
280 3300025906 Ga0207699_10001122 Ga0207699_100011224 69
281 3300025909 Ga0207705_10167405 Ga0207705_101674053 69
282 3300025909 Ga0207705_11108553 Ga0207705_111085531 69
283 3300025911 Ga0207654_10000151 Ga0207654_100001514 69
284 3300025911 Ga0207654_10000976 Ga0207654_1000097610 69
285 3300025911 Ga0207654_10004755 Ga0207654_100047554 69
286 3300025911 Ga0207654_10626877 Ga0207654_106268773 69
287 3300025911 Ga0207654_10720851 Ga0207654_107208512 69
288 3300025913 Ga0207695_10000188 Ga0207695_1000018899 69
289 3300025913 Ga0207695_10001158 Ga0207695_1000115821 69
290 3300025913 Ga0207695_10001234 Ga0207695_1000123419 69
291 3300025913 Ga0207695_10089462 Ga0207695_100894623 69
292 3300025913 Ga0207695_10171220 Ga0207695_101712203 69
293 3300025914 Ga0207671_10000942 Ga0207671_1000094222 69
294 3300025914 Ga0207671_10003174 Ga0207671_1000317411 69
295 3300025914 Ga0207671_10060323 Ga0207671_100603233 69
296 3300025914 Ga0207671_11356380 Ga0207671_113563802 69
297 3300025915 Ga0207693_10000087 Ga0207693_1000008750 69
298 3300025915 Ga0207693_10277123 Ga0207693_102771233 69
299 3300025916 Ga0207663_10081288 Ga0207663_100812883 69
300 3300025916 Ga0207663_10257266 Ga0207663_102572662 69
301 3300025920 Ga0207649_10026172 Ga0207649_100261723 69
302 3300025920 Ga0207649_10139682 Ga0207649_101396823 69
303 3300025924 Ga0207694_10000083 Ga0207694_1000008378 69
304 3300025924 Ga0207694_10000290 Ga0207694_100002903 69
305 3300025924 Ga0207694_10001818 Ga0207694_100018187 69
306 3300025924 Ga0207694_10160000 Ga0207694_101600003 69
307 3300025924 Ga0207694_10552723 Ga0207694_105527232 69
308 3300025925 Ga0207650_10036753 Ga0207650_100367533 69
309 3300025925 Ga0207650_10295455 Ga0207650_102954553 69
310 3300025927 Ga0207687_10004527 Ga0207687_100045274 69
311 3300025927 Ga0207687_10025686 Ga0207687_100256862 69
312 3300025927 Ga0207687_10404208 Ga0207687_104042082 69
313 3300025928 Ga0207700_10004413 Ga0207700_100044139 69
314 3300025928 Ga0207700_10621205 Ga0207700_106212052 69
315 3300025928 Ga0207700_11078737 Ga0207700_110787373 69
316 3300025931 Ga0207644_10015999 Ga0207644_100159997 69
317 3300025934 Ga0207686_10614149 Ga0207686_106141492 69
318 3300025939 Ga0207665_10161663 Ga0207665_101616632 69
319 3300025941 Ga0207711_10006467 Ga0207711_100064673 69
320 3300025941 Ga0207711_10025346 Ga0207711_100253463 69
321 3300025942 Ga0207689_10002236 Ga0207689_1000223610 69
322 3300025944 Ga0207661_10026192 Ga0207661_100261926 69
323 3300025944 Ga0207661_10272687 Ga0207661_102726873 69
324 3300025944 Ga0207661_10595130 Ga0207661_105951303 69
325 3300025944 Ga0207661_10845623 Ga0207661_108456232 69
326 3300025944 Ga0207661_10854579 Ga0207661_108545792 69
327 3300025945 Ga0207679_10216289 Ga0207679_102162892 69
328 3300025949 Ga0207667_10004502 Ga0207667_1000450210 69
329 3300025961 Ga0207712_10062469 Ga0207712_100624691 69
330 3300025981 Ga0207640_10100448 Ga0207640_101004482 69
331 3300025981 Ga0207640_10340635 Ga0207640_103406352 69
332 3300025981 Ga0207640_10905231 Ga0207640_109052312 69
333 3300025986 Ga0207658_10002295 Ga0207658_1000229510 69
334 3300026023 Ga0207677_10001520 Ga0207677_1000152010 69
335 3300026023 Ga0207677_10316522 Ga0207677_103165222 69
336 3300026035 Ga0207703_10010887 Ga0207703_100108873 69
337 3300026041 Ga0207639_10000027 Ga0207639_1000002784 69
338 3300026041 Ga0207639_10029598 Ga0207639_100295982 69
339 3300026041 Ga0207639_10068385 Ga0207639_100683853 69
340 3300026041 Ga0207639_10083705 Ga0207639_100837054 69
341 3300026041 Ga0207639_10353263 Ga0207639_103532632 69
342 3300026067 Ga0207678_10024846 Ga0207678_100248462 69
343 3300026078 Ga0207702_10000823 Ga0207702_100008233 69
344 3300026078 Ga0207702_10015372 Ga0207702_100153724 69
345 3300026078 Ga0207702_10038960 Ga0207702_100389603 69
346 3300026078 Ga0207702_11064639 Ga0207702_110646392 69
347 3300026088 Ga0207641_10001089 Ga0207641_100010893 69
348 3300026095 Ga0207676_10013135 Ga0207676_100131357 69
349 3300026116 Ga0207674_10000385 Ga0207674_1000038530 69
350 3300026116 Ga0207674_10001011 Ga0207674_100010116 69
351 3300026142 Ga0207698_10000065 Ga0207698_1000006548 69
352 3300026142 Ga0207698_10255863 Ga0207698_102558633 69
353 3300026142 Ga0207698_10985380 Ga0207698_109853802 69
354 3300026142 Ga0207698_11578763 Ga0207698_115787631 69
355 3300028379 Ga0268266_10020551 Ga0268266_100205514 69
356 3300028380 Ga0268265_10008987 Ga0268265_100089877 69
357 3300028381 Ga0268264_10002414 Ga0268264_100024143 69
358 3300031240 Ga0265320_10392853 Ga0265320_103928532 69
359 3300042005 Ga0439448_0069274 Ga0439448_0069274_285_494 69
360 3300044719 Ga0466971_0285547 Ga0466971_0285547_46_255 69
361 3300048903 Ga0496100_0846925 Ga0496100_0846925_392_601 69
362 3300048908 Ga0496105_1252902 Ga0496105_1252902_112_321 69
363 3300050513 nmdc:mga0rr50_1276644_c1 nmdc:mga0rr50_1276644_c1_144_353 69
364 3300003203 JGI25406J46586_10115600 JGI25406J46586_101156003 70
365 3300005293 Ga0065715_10525617 Ga0065715_105256171 70
366 3300005293 Ga0065715_10556172 Ga0065715_105561723 70
367 3300005330 Ga0070690_101705739 Ga0070690_1017057391 70
368 3300005334 Ga0068869_101588449 Ga0068869_1015884493 70
369 3300005334 Ga0068869_101604483 Ga0068869_1016044831 70
370 3300005336 Ga0070680_100103935 Ga0070680_1001039352 70
371 3300005336 Ga0070680_100358107 Ga0070680_1003581073 70
372 3300005338 Ga0068868_100861687 Ga0068868_1008616872 70
373 3300005340 Ga0070689_100583276 Ga0070689_1005832762 70
374 3300005340 Ga0070689_101379943 Ga0070689_1013799432 70
375 3300005341 Ga0070691_10709065 Ga0070691_107090653 70
376 3300005345 Ga0070692_10203432 Ga0070692_102034323 70
377 3300005347 Ga0070668_100079427 Ga0070668_1000794272 70
378 3300005347 Ga0070668_100142760 Ga0070668_1001427603 70
379 3300005353 Ga0070669_100006617 Ga0070669_1000066173 70
380 3300005356 Ga0070674_101079036 Ga0070674_1010790362 70
381 3300005406 Ga0070703_10001660 Ga0070703_100016606 70
382 3300005406 Ga0070703_10456501 Ga0070703_104565012 70
383 3300005434 Ga0070709_10045904 Ga0070709_100459042 70
384 3300005434 Ga0070709_10154070 Ga0070709_101540703 70
385 3300005434 Ga0070709_10264690 Ga0070709_102646903 70
386 3300005435 Ga0070714_100003128 Ga0070714_10000312810 70
387 3300005435 Ga0070714_100302845 Ga0070714_1003028452 70
388 3300005435 Ga0070714_101698467 Ga0070714_1016984672 70
389 3300005436 Ga0070713_100010397 Ga0070713_1000103975 70
390 3300005436 Ga0070713_100030154 Ga0070713_1000301544 70
391 3300005436 Ga0070713_100095619 Ga0070713_1000956194 70
392 3300005436 Ga0070713_100323505 Ga0070713_1003235053 70
393 3300005436 Ga0070713_100360917 Ga0070713_1003609172 70
394 3300005437 Ga0070710_10159850 Ga0070710_101598502 70
395 3300005437 Ga0070710_11022945 Ga0070710_110229452 70
396 3300005437 Ga0070710_11160455 Ga0070710_111604551 70
397 3300005437 Ga0070710_11192641 Ga0070710_111926412 70
398 3300005439 Ga0070711_100018228 Ga0070711_1000182286 70
399 3300005439 Ga0070711_100072732 Ga0070711_1000727323 70
400 3300005439 Ga0070711_100723820 Ga0070711_1007238202 70
401 3300005440 Ga0070705_100003341 Ga0070705_1000033413 70
402 3300005440 Ga0070705_100130161 Ga0070705_1001301613 70
403 3300005441 Ga0070700_101218881 Ga0070700_1012188811 70
404 3300005444 Ga0070694_100218210 Ga0070694_1002182102 70
405 3300005444 Ga0070694_100261432 Ga0070694_1002614323 70
406 3300005445 Ga0070708_100002244 Ga0070708_1000022447 70
407 3300005445 Ga0070708_101043203 Ga0070708_1010432031 70
408 3300005455 Ga0070663_101175447 Ga0070663_1011754472 70
409 3300005457 Ga0070662_100172467 Ga0070662_1001724673 70
410 3300005459 Ga0068867_100625791 Ga0068867_1006257913 70
411 3300005459 Ga0068867_100971251 Ga0068867_1009712513 70
412 3300005467 Ga0070706_100001656 Ga0070706_1000016567 70
413 3300005467 Ga0070706_100383998 Ga0070706_1003839983 70
414 3300005471 Ga0070698_101266250 Ga0070698_1012662502 70
415 3300005518 Ga0070699_100015160 Ga0070699_1000151602 70
416 3300005530 Ga0070679_100017595 Ga0070679_1000175958 70
417 3300005530 Ga0070679_100979679 Ga0070679_1009796792 70
418 3300005536 Ga0070697_100001122 Ga0070697_1000011226 70
419 3300005536 Ga0070697_100823441 Ga0070697_1008234412 70
420 3300005545 Ga0070695_100016838 Ga0070695_1000168382 70
421 3300005545 Ga0070695_100023474 Ga0070695_1000234744 70
422 3300005545 Ga0070695_100731539 Ga0070695_1007315391 70
423 3300005546 Ga0070696_100002232 Ga0070696_10000223213 70
424 3300005546 Ga0070696_100580174 Ga0070696_1005801742 70
425 3300005547 Ga0070693_100000295 Ga0070693_10000029522 70
426 3300005547 Ga0070693_100126091 Ga0070693_1001260913 70
427 3300005547 Ga0070693_100339103 Ga0070693_1003391033 70
428 3300005549 Ga0070704_100007127 Ga0070704_1000071276 70
429 3300005549 Ga0070704_101962432 Ga0070704_1019624322 70
430 3300005617 Ga0068859_100820700 Ga0068859_1008207002 70
431 3300005617 Ga0068859_101272925 Ga0068859_1012729252 70
432 3300005618 Ga0068864_102024714 Ga0068864_1020247141 70
433 3300005718 Ga0068866_10055421 Ga0068866_100554213 70
434 3300005718 Ga0068866_10157226 Ga0068866_101572263 70
435 3300005718 Ga0068866_10394531 Ga0068866_103945313 70
436 3300005719 Ga0068861_100120644 Ga0068861_1001206444 70
437 3300005719 Ga0068861_100459299 Ga0068861_1004592991 70
438 3300005719 Ga0068861_101368875 Ga0068861_1013688752 70
439 3300005840 Ga0068870_10625745 Ga0068870_106257451 70
440 3300005841 Ga0068863_101368418 Ga0068863_1013684182 70
441 3300005843 Ga0068860_100271543 Ga0068860_1002715433 70
442 3300005843 Ga0068860_100313462 Ga0068860_1003134623 70
443 3300005937 Ga0081455_10729459 Ga0081455_107294593 70
444 3300005985 Ga0081539_10007242 Ga0081539_100072426 70
445 3300006028 Ga0070717_10012117 Ga0070717_100121174 70
446 3300006028 Ga0070717_10374526 Ga0070717_103745261 70
447 3300006028 Ga0070717_10630547 Ga0070717_106305472 70
448 3300006163 Ga0070715_10000253 Ga0070715_100002537 70
449 3300006163 Ga0070715_10215973 Ga0070715_102159732 70
450 3300006163 Ga0070715_10238212 Ga0070715_102382122 70
451 3300006173 Ga0070716_100000178 Ga0070716_1000001783 70
452 3300006173 Ga0070716_100000490 Ga0070716_1000004909 70
453 3300006173 Ga0070716_100368242 Ga0070716_1003682422 70
454 3300006173 Ga0070716_100495241 Ga0070716_1004952412 70
455 3300006175 Ga0070712_100018290 Ga0070712_1000182902 70
456 3300006175 Ga0070712_100154487 Ga0070712_1001544871 70
457 3300006175 Ga0070712_100195428 Ga0070712_1001954283 70
458 3300006175 Ga0070712_100226607 Ga0070712_1002266072 70
459 3300006175 Ga0070712_100286398 Ga0070712_1002863982 70
460 3300006175 Ga0070712_100818760 Ga0070712_1008187603 70
461 3300006358 Ga0068871_101000732 Ga0068871_1010007322 70
462 3300006844 Ga0075428_100001386 Ga0075428_10000138610 70
463 3300006844 Ga0075428_100077778 Ga0075428_1000777783 70
464 3300006844 Ga0075428_100166723 Ga0075428_1001667232 70
465 3300006846 Ga0075430_100016434 Ga0075430_1000164344 70
466 3300006847 Ga0075431_100001716 Ga0075431_10000171619 70
467 3300006847 Ga0075431_100944516 Ga0075431_1009445162 70
468 3300006847 Ga0075431_100982536 Ga0075431_1009825362 70
469 3300006852 Ga0075433_10070444 Ga0075433_100704442 70
470 3300006852 Ga0075433_10146922 Ga0075433_101469222 70
471 3300006852 Ga0075433_10354082 Ga0075433_103540822 70
472 3300006852 Ga0075433_11002137 Ga0075433_110021372 70
473 3300006871 Ga0075434_100010157 Ga0075434_1000101577 70
474 3300006871 Ga0075434_100032344 Ga0075434_1000323442 70
475 3300006871 Ga0075434_100200547 Ga0075434_1002005472 70
476 3300006871 Ga0075434_100304454 Ga0075434_1003044542 70
477 3300006871 Ga0075434_101555358 Ga0075434_1015553582 70
478 3300006871 Ga0075434_101805847 Ga0075434_1018058471 70
479 3300006880 Ga0075429_100035141 Ga0075429_1000351414 70
480 3300006880 Ga0075429_101549598 Ga0075429_1015495982 70
481 3300006881 Ga0068865_100874566 Ga0068865_1008745662 70
482 3300006914 Ga0075436_100000734 Ga0075436_1000007342 70
483 3300006914 Ga0075436_100023339 Ga0075436_1000233395 70
484 3300006914 Ga0075436_100258236 Ga0075436_1002582361 70
485 3300006931 Ga0097620_100820571 Ga0097620_1008205712 70
486 3300006931 Ga0097620_101272729 Ga0097620_1012727292 70
487 3300007076 Ga0075435_100049318 Ga0075435_1000493183 70
488 3300007076 Ga0075435_100139239 Ga0075435_1001392394 70
489 3300007076 Ga0075435_100675337 Ga0075435_1006753372 70
490 3300007265 Ga0099794_10014819 Ga0099794_100148196 70
491 3300007265 Ga0099794_10089003 Ga0099794_100890032 70
492 3300007265 Ga0099794_10145911 Ga0099794_101459112 70
493 3300007265 Ga0099794_10184624 Ga0099794_101846242 70
494 3300007265 Ga0099794_10253522 Ga0099794_102535221 70
495 3300007265 Ga0099794_10275485 Ga0099794_102754852 70
496 3300007265 Ga0099794_10324344 Ga0099794_103243442 70
497 3300007265 Ga0099794_10471416 Ga0099794_104714161 70
498 3300007788 Ga0099795_10009030 Ga0099795_100090302 70
499 3300009093 Ga0105240_10095144 Ga0105240_100951442 70
500 3300009094 Ga0111539_10646729 Ga0111539_106467292 70
501 3300009101 Ga0105247_10030211 Ga0105247_100302112 70
502 3300009101 Ga0105247_11074752 Ga0105247_110747522 70
503 3300009147 Ga0114129_10000075 Ga0114129_1000007532 70
504 3300009147 Ga0114129_10027832 Ga0114129_100278328 70
505 3300009148 Ga0105243_10320718 Ga0105243_103207182 70
506 3300009148 Ga0105243_10859482 Ga0105243_108594822 70
507 3300009174 Ga0105241_10322899 Ga0105241_103228992 70
508 3300009174 Ga0105241_12438448 Ga0105241_124384481 70
509 3300009176 Ga0105242_11495424 Ga0105242_114954242 70
510 3300009545 Ga0105237_10070700 Ga0105237_100707003 70
511 3300009553 Ga0105249_10151901 Ga0105249_101519012 70
512 3300013100 Ga0157373_10854251 Ga0157373_108542512 70
513 3300013297 Ga0157378_10019350 Ga0157378_100193502 70
514 3300013297 Ga0157378_10937446 Ga0157378_109374462 70
515 3300013306 Ga0163162_10038434 Ga0163162_100384346 70
516 3300013306 Ga0163162_10349710 Ga0163162_103497103 70
517 3300013306 Ga0163162_12918810 Ga0163162_129188102 70
518 3300013308 Ga0157375_10667818 Ga0157375_106678182 70
519 3300014325 Ga0163163_12209526 Ga0163163_122095263 70
520 3300014326 Ga0157380_10147330 Ga0157380_101473302 70
521 3300014968 Ga0157379_11237236 Ga0157379_112372362 70
522 3300014968 Ga0157379_11723075 Ga0157379_117230751 70
523 3300017792 Ga0163161_10325414 Ga0163161_103254143 70
524 3300021361 Ga0213872_10416486 Ga0213872_104164861 70
525 3300024227 Ga0228598_1006840 Ga0228598_10068403 70
526 3300025885 Ga0207653_10001051 Ga0207653_100010516 70
527 3300025898 Ga0207692_10199554 Ga0207692_101995542 70
528 3300025898 Ga0207692_10787837 Ga0207692_107878372 70
529 3300025899 Ga0207642_10317225 Ga0207642_103172252 70
530 3300025905 Ga0207685_10004549 Ga0207685_100045496 70
531 3300025905 Ga0207685_10414292 Ga0207685_104142923 70
532 3300025906 Ga0207699_10051030 Ga0207699_100510302 70
533 3300025906 Ga0207699_11186629 Ga0207699_111866292 70
534 3300025908 Ga0207643_10732606 Ga0207643_107326063 70
535 3300025910 Ga0207684_10054909 Ga0207684_100549096 70
536 3300025911 Ga0207654_10976403 Ga0207654_109764032 70
537 3300025914 Ga0207671_10398154 Ga0207671_103981543 70
538 3300025915 Ga0207693_10012010 Ga0207693_100120107 70
539 3300025915 Ga0207693_10058732 Ga0207693_100587324 70
540 3300025915 Ga0207693_10331581 Ga0207693_103315813 70
541 3300025915 Ga0207693_10900236 Ga0207693_109002362 70
542 3300025916 Ga0207663_10007120 Ga0207663_100071205 70
543 3300025916 Ga0207663_10023743 Ga0207663_100237436 70
544 3300025916 Ga0207663_10435253 Ga0207663_104352532 70
545 3300025917 Ga0207660_10098100 Ga0207660_100981002 70
546 3300025917 Ga0207660_10272638 Ga0207660_102726382 70
547 3300025918 Ga0207662_11001301 Ga0207662_110013011 70
548 3300025921 Ga0207652_10013414 Ga0207652_100134149 70
549 3300025922 Ga0207646_11643632 Ga0207646_116436321 70
550 3300025923 Ga0207681_10419035 Ga0207681_104190352 70
551 3300025928 Ga0207700_10007789 Ga0207700_100077896 70
552 3300025928 Ga0207700_10176955 Ga0207700_101769553 70
553 3300025928 Ga0207700_10189481 Ga0207700_101894811 70
554 3300025928 Ga0207700_10263921 Ga0207700_102639212 70
555 3300025928 Ga0207700_10642004 Ga0207700_106420042 70
556 3300025929 Ga0207664_10016879 Ga0207664_100168797 70
557 3300025929 Ga0207664_11330818 Ga0207664_113308182 70
558 3300025933 Ga0207706_10058516 Ga0207706_100585163 70
559 3300025934 Ga0207686_10236802 Ga0207686_102368023 70
560 3300025935 Ga0207709_10113776 Ga0207709_101137762 70
561 3300025936 Ga0207670_10505697 Ga0207670_105056972 70
562 3300025937 Ga0207669_10819732 Ga0207669_108197322 70
563 3300025938 Ga0207704_10573485 Ga0207704_105734853 70
564 3300025939 Ga0207665_10000015 Ga0207665_1000001585 70
565 3300025939 Ga0207665_10001233 Ga0207665_1000123316 70
566 3300025939 Ga0207665_10360962 Ga0207665_103609622 70
567 3300025940 Ga0207691_10037114 Ga0207691_100371145 70
568 3300025941 Ga0207711_10945457 Ga0207711_109454572 70
569 3300025961 Ga0207712_10099148 Ga0207712_100991482 70
570 3300025972 Ga0207668_10189174 Ga0207668_101891743 70
571 3300025972 Ga0207668_10499826 Ga0207668_104998262 70
572 3300026023 Ga0207677_10236897 Ga0207677_102368972 70
573 3300026035 Ga0207703_12224117 Ga0207703_122241172 70
574 3300026067 Ga0207678_10302149 Ga0207678_103021492 70
575 3300026089 Ga0207648_10168510 Ga0207648_101685102 70
576 3300026118 Ga0207675_100114002 Ga0207675_1001140023 70
577 3300026118 Ga0207675_100170215 Ga0207675_1001702154 70
578 3300026118 Ga0207675_100365389 Ga0207675_1003653892 70
579 3300027671 Ga0209588_1012680 Ga0209588_10126803 70
580 3300027671 Ga0209588_1016448 Ga0209588_10164482 70
581 3300027671 Ga0209588_1016784 Ga0209588_10167844 70
582 3300027671 Ga0209588_1036120 Ga0209588_10361203 70
583 3300027907 Ga0207428_10037777 Ga0207428_100377773 70
584 3300027907 Ga0207428_10443939 Ga0207428_104439392 70
585 3300027907 Ga0207428_10456466 Ga0207428_104564662 70
586 3300027907 Ga0207428_10506024 Ga0207428_105060243 70
587 3300028380 Ga0268265_12355789 Ga0268265_123557893 70
588 3300028381 Ga0268264_10082201 Ga0268264_100822014 70
589 3300028800 Ga0265338_10668045 Ga0265338_106680453 70
590 3300031090 Ga0265760_10263989 Ga0265760_102639892 70
591 3300031240 Ga0265320_10237009 Ga0265320_102370093 70
592 3300031241 Ga0265325_10347502 Ga0265325_103475021 70
593 3300031595 Ga0265313_10420753 Ga0265313_104207532 70
594 3300031730 Ga0307516_10864004 Ga0307516_108640042 70
595 3300035083 Ga0373926_0000611 Ga0373926_0000611_3579_3791 70
596 3300035083 Ga0373926_0068355 Ga0373926_0068355_662_874 70
597 3300035083 Ga0373926_0166039 Ga0373926_0166039_165_377 70
598 3300035085 Ga0373929_0181358 Ga0373929_0181358_83_304 70
599 3300035111 Ga0373923_0376838 Ga0373923_0376838_392_604 70
600 3300035115 Ga0373941_0511369 Ga0373941_0511369_145_357 70
601 3300035116 Ga0373945_0423205 Ga0373945_0423205_186_398 70
602 3300035116 Ga0373945_0547727 Ga0373945_0547727_178_390 70
603 3300035118 Ga0373954_0045616 Ga0373954_0045616_1646_1858 70
604 3300035118 Ga0373954_0533031 Ga0373954_0533031_109_321 70
605 3300035118 Ga0373954_0550258 Ga0373954_0550258_240_452 70
606 3300035170 Ga0373943_0985064 Ga0373943_0985064_273_485 70
607 3300035171 Ga0373946_0006398 Ga0373946_0006398_1358_1570 70
608 3300035172 Ga0373955_0180858 Ga0373955_0180858_539_751 70
609 3300035172 Ga0373955_0453851 Ga0373955_0453851_42_254 70
610 3300035207 Ga0373942_0269095 Ga0373942_0269095_278_496 70
611 3300035242 Ga0373962_0270757 Ga0373962_0270757_140_358 70
612 3300035691 Ga0373931_0187341 Ga0373931_0187341_336_548 70
613 3300035691 Ga0373931_0586114 Ga0373931_0586114_254_475 70
614 3300035692 Ga0373935_0310347 Ga0373935_0310347_124_336 70
615 3300035692 Ga0373935_0317448 Ga0373935_0317448_330_542 70
616 3300035692 Ga0373935_1086485 Ga0373935_1086485_55_267 70
617 3300035695 Ga0373927_0000786 Ga0373927_0000786_12083_12295 70
618 3300035695 Ga0373927_0003818 Ga0373927_0003818_5389_5601 70
619 3300035695 Ga0373927_0111232 Ga0373927_0111232_924_1136 70
620 3300035695 Ga0373927_0189597 Ga0373927_0189597_412_624 70
621 3300035724 Ga0373933_1135182 Ga0373933_1135182_65_277 70
622 3300035725 Ga0373947_0016152 Ga0373947_0016152_3370_3582 70
623 3300035725 Ga0373947_0518013 Ga0373947_0518013_105_317 70
624 3300036401 Ga0373937_0066395 Ga0373937_0066395_326_538 70
625 3300036401 Ga0373937_0342388 Ga0373937_0342388_317_529 70
626 3300036401 Ga0373937_1132494 Ga0373937_1132494_19_231 70
627 3300037068 Ga0373925_0001038 Ga0373925_0001038_12123_12335 70
628 3300037068 Ga0373925_0227229 Ga0373925_0227229_69_281 70
629 3300037068 Ga0373925_0270106 Ga0373925_0270106_416_628 70
630 3300037068 Ga0373925_0325824 Ga0373925_0325824_387_599 70
631 3300037068 Ga0373925_0556247 Ga0373925_0556247_446_658 70
632 3300037068 Ga0373925_1682289 Ga0373925_1682289_152_364 70
633 3300037312 Ga0395899_0058403 Ga0395899_0058403_676_897 70
634 3300037418 Ga0395900_0011181 Ga0395900_0011181_711_929 70
635 3300037418 Ga0395900_0043417 Ga0395900_0043417_4102_4323 70
636 3300037471 Ga0395905_0000567 Ga0395905_0000567_7615_7833 70
637 3300038443 Ga0395901_0001390 Ga0395901_0001390_12103_12324 70
638 3300039437 Ga0436365_0353434 Ga0436365_0353434_2005_2217 70
639 3300039437 Ga0436365_1276255 Ga0436365_1276255_476_688 70
640 3300039447 Ga0436361_0451209 Ga0436361_0451209_292_510 70
641 3300039450 Ga0436363_1192250 Ga0436363_1192250_239_451 70
642 3300044694 Ga0466963_0663537 Ga0466963_0663537_221_436 70
643 3300045051 Ga0451576_0235331 Ga0451576_0235331_847_1059 70
644 3300045051 Ga0451576_1095313 Ga0451576_1095313_41_259 70
645 3300045836 Ga0466958_1012198 Ga0466958_1012198_187_402 70
646 3300046454 Ga0495592_0752526 Ga0495592_0752526_302_514 70
647 3300046455 Ga0495603_0063126 Ga0495603_0063126_325_546 70
648 3300046455 Ga0495603_0625100 Ga0495603_0625100_38_250 70
649 3300046462 Ga0495651_0172470 Ga0495651_0172470_1076_1288 70
650 3300046462 Ga0495651_0357786 Ga0495651_0357786_226_438 70
651 3300046472 Ga0495580_0002472 Ga0495580_0002472_4632_4844 70
652 3300046472 Ga0495580_0203860 Ga0495580_0203860_656_868 70
653 3300046472 Ga0495580_0854505 Ga0495580_0854505_358_570 70
654 3300046473 Ga0495582_0162211 Ga0495582_0162211_969_1181 70
655 3300046475 Ga0495639_0229007 Ga0495639_0229007_254_466 70
656 3300046477 Ga0495664_0144379 Ga0495664_0144379_740_952 70
657 3300046491 Ga0495584_0250670 Ga0495584_0250670_486_707 70
658 3300046499 Ga0495594_0034320 Ga0495594_0034320_600_821 70
659 3300046499 Ga0495594_0194197 Ga0495594_0194197_173_385 70
660 3300046499 Ga0495594_0442760 Ga0495594_0442760_240_452 70
661 3300046519 Ga0495632_0410033 Ga0495632_0410033_242_520 70
662 3300046523 Ga0495644_0153771 Ga0495644_0153771_213_434 70
663 3300046526 Ga0495666_0007843 Ga0495666_0007843_1419_1631 70
664 3300046528 Ga0495642_0074780 Ga0495642_0074780_584_796 70
665 3300046536 Ga0495587_0004260 Ga0495587_0004260_5059_5271 70
666 3300046543 Ga0495645_0087801 Ga0495645_0087801_1480_1692 70
667 3300046557 Ga0495622_0464980 Ga0495622_0464980_241_462 70
668 3300046558 Ga0495633_0240529 Ga0495633_0240529_244_465 70
669 3300046663 Ga0495635_0684443 Ga0495635_0684443_140_352 70
670 3300046664 Ga0495659_0176401 Ga0495659_0176401_101_322 70
671 3300046664 Ga0495659_0533518 Ga0495659_0533518_29_241 70
672 3300046684 Ga0495669_0063069 Ga0495669_0063069_170_391 70
673 3300046684 Ga0495669_0241039 Ga0495669_0241039_561_779 70
674 3300046690 Ga0495624_0130295 Ga0495624_0130295_769_981 70
675 3300047317 Ga0495604_1013738 Ga0495604_1013738_262_474 70
676 3300047318 Ga0495636_0073682 Ga0495636_0073682_964_1176 70
677 3300047319 Ga0495674_0384478 Ga0495674_0384478_429_641 70
678 3300047443 Ga0495687_067960 Ga0495687_067960_448_726 70
679 3300048911 Ga0496108_1486085 Ga0496108_1486085_84_302 70
680 3300048918 Ga0496115_0568471 Ga0496115_0568471_331_543 70
681 3300048921 Ga0496118_0106844 Ga0496118_0106844_1109_1396 70
682 3300048924 Ga0496121_0124859 Ga0496121_0124859_1485_1772 70
683 3300048928 Ga0496125_0000271 Ga0496125_0000271_67246_67533 70
684 3300048929 Ga0496126_0063201 Ga0496126_0063201_880_1167 70
685 3300049583 Ga0501067_0242904 Ga0501067_0242904_26_244 70
686 3300050507 nmdc:mga05p37_1122_c2 nmdc:mga05p37_1122_c2_21691_21912 70
687 3300050507 nmdc:mga05p37_212744_c1 nmdc:mga05p37_212744_c1_1880_2098 70
688 3300050507 nmdc:mga05p37_338924_c1 nmdc:mga05p37_338924_c1_279_500 70
689 3300050507 nmdc:mga05p37_5195_c1 nmdc:mga05p37_5195_c1_8151_8369 70
690 3300050507 nmdc:mga05p37_871111_c1 nmdc:mga05p37_871111_c1_705_926 70
691 3300050508 nmdc:mga09592_254919_c1 nmdc:mga09592_254919_c1_807_1028 70
692 3300050509 nmdc:mga0qj67_8892_c1 nmdc:mga0qj67_8892_c1_4918_5139 70
693 3300050510 nmdc:mga06r32_476_c1 nmdc:mga06r32_476_c1_5593_5814 70
694 3300050510 nmdc:mga06r32_849411_c1 nmdc:mga06r32_849411_c1_224_445 70
695 3300050511 nmdc:mga08y16_171126_c2 nmdc:mga08y16_171126_c2_787_1005 70
696 3300050511 nmdc:mga08y16_2146_c1 nmdc:mga08y16_2146_c1_10145_10366 70
697 3300050512 nmdc:mga0n895_1022573_c1 nmdc:mga0n895_1022573_c1_469_687 70
698 3300050512 nmdc:mga0n895_13067_c1 nmdc:mga0n895_13067_c1_1588_1806 70
699 3300050512 nmdc:mga0n895_16651_c1 nmdc:mga0n895_16651_c1_4137_4355 70
700 3300050512 nmdc:mga0n895_299467_c1 nmdc:mga0n895_299467_c1_365_577 70
701 3300050513 nmdc:mga0rr50_124348_c1 nmdc:mga0rr50_124348_c1_408_626 70
702 3300050513 nmdc:mga0rr50_1851477_c1 nmdc:mga0rr50_1851477_c1_110_328 70
703 3300050514 nmdc:mga08x19_125874_c1 nmdc:mga08x19_125874_c1_605_823 70
704 3300050514 nmdc:mga08x19_2595_c1 nmdc:mga08x19_2595_c1_749_961 70
705 3300050514 nmdc:mga08x19_411614_c1 nmdc:mga08x19_411614_c1_80_292 70
706 3300050514 nmdc:mga08x19_462374_c1 nmdc:mga08x19_462374_c1_588_809 70
707 3300050515 nmdc:mga0a205_1020705_c1 nmdc:mga0a205_1020705_c1_397_615 70
708 3300050515 nmdc:mga0a205_20947_c1 nmdc:mga0a205_20947_c1_1475_1693 70
709 3300050515 nmdc:mga0a205_5985_c1 nmdc:mga0a205_5985_c1_964_1182 70
710 3300053077 Ga0495601_0097366 Ga0495601_0097366_1586_1798 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03994

DUF350

Domain of Unknown Function (DUF350)

27

81

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End GO Terms
AF-A0A3B1D870-F1-model_v4 DUF350 domain-containing protein 0.8996 8 70 GO:0005886
AF-A0A1B6Z3S6-F1-model_v4 deleted 0.8994 7 69
AF-I0KG56-F1-model_v4 DUF350 domain-containing protein 0.8951 7 70 GO:0005886
AF-A0A2V7VIR0-F1-model_v4 DUF350 domain-containing protein 0.891 6 68 GO:0005886
AF-A0A251X6H9-F1-model_v4 DUF350 domain-containing protein 0.8829 7 67 GO:0005886

Feature Viewer

pLDDT pTM Quality
84.98 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map