F476655

General Info

Members Datasets Scaffolds Average Seq Length
709 494 463 189

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10423691|Ga0207667_104236912
Length 224
Sequence MLIGFPGYVRRKLATLLELSTGAENAAVRGPKSAKGRRMSKLSVIIASTRPGRVGLPVGQWFFEQAKRHGKFDVELVDLKDRNLPLLDEPHHPRLRKYEHEHTKAWSAIVQASDAFVFVTPEYNYSVAPSLLNALDYVFHEWAYKAAGIVSYGGISGGMRSAQMLRQTLSVLKVVPLPEAVTIQFATQLLEDGVFRGSEPLEKAAVTMLDELFRWTDALAVLRK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
9 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
10 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
11 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
12 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
13 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
16 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
17 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
18 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
19 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
20 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
21 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
22 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
23 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
24 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
25 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
26 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
27 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
28 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
29 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
30 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
31 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
32 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
33 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
34 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
35 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
36 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
37 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
38 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
39 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
40 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
41 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
42 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
43 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
44 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
45 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
46 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
47 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
48 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
49 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
50 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
51 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
52 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
53 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
54 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
55 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
56 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
57 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
58 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
59 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
60 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
61 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
62 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
63 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
64 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
65 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
66 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
67 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
68 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
69 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
70 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
71 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
72 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
73 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
74 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
75 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
76 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
77 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
78 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
79 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
80 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
81 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
82 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
83 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
84 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
85 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
86 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
87 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
88 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
89 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
90 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
91 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
92 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
93 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
94 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
95 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
96 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
97 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
98 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
99 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
100 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
101 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
102 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
103 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
104 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
105 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
106 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
107 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
108 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
109 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
110 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
111 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
112 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
113 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
114 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
115 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
116 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
117 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
118 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
119 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
120 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
121 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
122 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
123 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
124 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
125 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
126 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
127 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
128 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
129 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
130 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
131 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
132 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
133 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
134 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
135 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
136 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
137 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
138 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
139 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
140 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
141 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
142 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
143 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
144 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
145 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
146 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
147 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
148 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
149 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
150 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
151 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
152 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
153 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
154 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
155 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
156 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
157 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
158 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
159 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
160 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
161 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
162 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
163 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
164 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
165 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
166 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
167 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
168 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
169 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
170 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
171 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
172 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
173 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
174 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
175 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
176 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
177 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
178 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
179 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
180 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
181 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
182 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
183 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
184 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
185 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
186 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
187 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
188 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
189 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
190 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
191 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
192 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
193 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
194 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
195 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
196 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
197 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
198 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
199 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
200 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
201 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
202 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
203 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
204 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
205 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
206 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
207 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
208 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
209 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
210 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
211 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
212 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
213 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
214 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
215 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
216 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
217 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
218 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
219 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
220 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
221 3004167301 Mesorhizobium loti 582 Isolate Unclassified
222 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
223 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
224 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
225 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
226 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
227 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
228 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
229 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
230 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
231 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
232 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
233 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
234 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
235 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
236 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
237 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
238 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
239 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
240 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
241 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
242 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
243 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
244 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
245 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
246 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
247 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
248 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
249 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
250 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
251 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
252 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
253 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
254 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
255 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
256 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
257 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
258 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
259 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
260 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
261 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
262 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
263 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
264 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
265 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
266 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
267 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
268 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
269 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
270 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
271 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
272 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
273 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
274 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
275 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
276 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
277 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
278 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
279 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
280 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
281 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
282 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
283 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
284 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
285 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
286 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
287 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
288 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
289 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
290 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
291 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
292 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
293 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
294 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
295 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
296 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
297 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
298 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
299 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
300 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
301 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
302 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
303 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
304 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
305 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
306 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
307 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
310 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
313 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
314 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
357 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
359 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
360 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
361 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
362 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
363 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
364 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
365 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
366 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
367 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
368 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
369 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
370 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
371 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
372 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
373 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
374 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
375 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
376 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
377 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
378 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
379 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
380 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
381 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
382 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
385 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
386 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
387 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
388 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
389 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
390 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
391 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
394 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
395 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
396 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
397 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
398 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
399 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
400 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
401 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
402 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
403 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
404 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
405 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
406 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
407 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
410 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
416 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
417 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
418 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
419 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
420 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
421 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
422 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
425 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
426 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
427 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
428 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
429 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
431 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
445 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
451 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
452 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
453 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
454 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
455 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
456 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
457 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
458 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
462 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
463 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
467 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
468 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
469 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
470 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
471 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
472 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
473 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
474 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
475 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
476 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
477 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
478 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
479 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
480 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
481 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
482 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
483 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
484 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
485 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
486 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
487 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
488 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
489 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
490 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
491 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
492 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
493 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
494 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.02
Metatranscriptomes 0.28
Isolates 34.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.63
Nodule 30.32
Rhizoplane 1.55
Rhizosphere 52.47
Stem 0
Stem Tuber 0
Unclassified 9.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000147 3300003214 Bacteria 116564
2 JGI25165J46597_1000206 3300003214 Bacteria 84821
3 rootH2_10092887 3300003320 Bacteria 1668
4 rootL2_10117744 3300003322 Bacteria 1201
5 rootH1_10160586 3300003323 Bacteria 4820
6 rootH1_10312064 3300003323 Bacteria 5387
7 Ga0055529_1001765 3300003763 Bacteria 5361
8 Ga0055526_1019219 3300003771 Bacteria 2500
9 Ga0055524_1000504 3300003775 Bacteria 30479
10 Ga0055528_1000035 3300003790 Bacteria 117498
11 Ga0065165_1002490 3300005262 Bacteria 15444
12 Ga0070658_10134475 3300005327 Bacteria 2062
13 Ga0070658_10534785 3300005327 Bacteria 1014
14 Ga0070683_100034345 3300005329 Bacteria 4632
15 Ga0070666_10009665 3300005335 Bacteria 6022
16 Ga0070666_10084779 3300005335 Bacteria 2169
17 Ga0070680_100000084 3300005336 Bacteria 51930
18 Ga0070680_100345585 3300005336 Bacteria 1265
19 Ga0070691_10002328 3300005341 Bacteria 8425
20 Ga0070661_100395270 3300005344 Bacteria 1092
21 Ga0070661_100692719 3300005344 Bacteria 830
22 Ga0070692_10217600 3300005345 Bacteria 1127
23 Ga0070674_100297715 3300005356 Bacteria 1285
24 Ga0070667_100004911 3300005367 Bacteria 11203
25 Ga0070667_100063380 3300005367 Bacteria 3132
26 Ga0070667_100393315 3300005367 Bacteria 1261
27 Ga0070667_100522837 3300005367 Bacteria 1089
28 Ga0070709_10007167 3300005434 Bacteria 6106
29 Ga0070714_100020316 3300005435 Bacteria 5421
30 Ga0070714_100023481 3300005435 Bacteria 5068
31 Ga0070713_100000121 3300005436 Bacteria 50650
32 Ga0070705_100294385 3300005440 Bacteria 1160
33 Ga0070663_100000968 3300005455 Bacteria 15595
34 Ga0070663_100706325 3300005455 Bacteria 857
35 Ga0070681_10000001 3300005458 Bacteria 946857
36 Ga0070681_10156799 3300005458 Bacteria 2201
37 Ga0070681_10221711 3300005458 Bacteria 1806
38 Ga0070679_100000211 3300005530 Bacteria 47596
39 Ga0070679_100024727 3300005530 Bacteria 5886
40 Ga0070684_100284844 3300005535 Bacteria 1514
41 Ga0070684_100337959 3300005535 Bacteria 1384
42 Ga0068853_100005255 3300005539 Bacteria 10138
43 Ga0068853_100008770 3300005539 Bacteria 8134
44 Ga0068853_100022594 3300005539 Bacteria 5255
45 Ga0068853_100350248 3300005539 Bacteria 1374
46 Ga0070672_100000146 3300005543 Bacteria 38299
47 Ga0070695_100006141 3300005545 Bacteria 7099
48 Ga0070696_100822551 3300005546 Unclassified 766
49 Ga0070693_100041131 3300005547 Bacteria 2599
50 Ga0070665_100029417 3300005548 Bacteria 5529
51 Ga0070665_100089160 3300005548 Bacteria 3090
52 Ga0070665_100355410 3300005548 Bacteria 1471
53 Ga0070665_100445071 3300005548 Bacteria 1305
54 Ga0068855_100336119 3300005563 Bacteria 1666
55 Ga0068855_100415225 3300005563 Bacteria 1473
56 Ga0068857_100050176 3300005577 Bacteria 3702
57 Ga0068857_100597731 3300005577 Bacteria 1043
58 Ga0068854_100045814 3300005578 Bacteria 3111
59 Ga0068854_100393096 3300005578 Bacteria 1145
60 Ga0068856_100000497 3300005614 Bacteria 43608
61 Ga0068856_100001104 3300005614 Bacteria 28526
62 Ga0068856_100092115 3300005614 Bacteria 3015
63 Ga0068856_100103190 3300005614 Bacteria 2845
64 Ga0068856_100457618 3300005614 Bacteria 1297
65 Ga0068856_100782977 3300005614 Bacteria 974
66 Ga0068856_101199044 3300005614 Bacteria 775
67 Ga0068852_100009705 3300005616 Bacteria 7153
68 Ga0068852_100058403 3300005616 Bacteria 3342
69 Ga0068852_101063193 3300005616 Bacteria 829
70 Ga0068858_100022763 3300005842 Bacteria 5843
71 Ga0068858_100395669 3300005842 Bacteria 1327
72 Ga0068860_100069966 3300005843 Bacteria 3336
73 Ga0075365_10008092 3300006038 Bacteria 5940
74 Ga0075365_10022752 3300006038 Bacteria 3931
75 Ga0075365_10133630 3300006038 Bacteria 1718
76 Ga0075365_10228554 3300006038 Bacteria 1306
77 Ga0075365_10552867 3300006038 Bacteria 814
78 Ga0075364_10135445 3300006051 Bacteria 1654
79 Ga0075364_10153855 3300006051 Bacteria 1550
80 Ga0070716_100034675 3300006173 Bacteria 2769
81 Ga0070712_100001870 3300006175 Bacteria 12848
82 Ga0070712_100007861 3300006175 Bacteria 6681
83 Ga0075362_10371273 3300006177 Bacteria 718
84 Ga0075367_10111931 3300006178 Bacteria 1676
85 Ga0075367_10362619 3300006178 Bacteria 915
86 Ga0097621_101452061 3300006237 Unclassified 650
87 Ga0075370_10134098 3300006353 Bacteria 1446
88 Ga0075434_100061761 3300006871 Bacteria 3729
89 Ga0068865_100236011 3300006881 Bacteria 1437
90 Ga0075436_100000720 3300006914 Bacteria 21898
91 Ga0075436_100005085 3300006914 Bacteria 9053
92 Ga0079104_1000015 3300006946 Bacteria 321803
93 Ga0075435_100288332 3300007076 Bacteria 1402
94 Ga0105240_10096531 3300009093 Bacteria 3602
95 Ga0105240_10331478 3300009093 Bacteria 1731
96 Ga0105240_10909847 3300009093 Bacteria 946
97 Ga0105245_10738282 3300009098 Bacteria 1020
98 Ga0105247_10198525 3300009101 Bacteria 1347
99 Ga0105243_10522164 3300009148 Bacteria 1129
100 Ga0105241_10277567 3300009174 Bacteria 1430
101 Ga0105241_10585030 3300009174 Bacteria 1006
102 Ga0105237_10006681 3300009545 Bacteria 12750
103 Ga0105237_10064036 3300009545 Bacteria 3674
104 Ga0105237_10094540 3300009545 Bacteria 2978
105 Ga0105237_10461265 3300009545 Bacteria 1276
106 Ga0105238_10009161 3300009551 Bacteria 9910
107 Ga0105238_10009675 3300009551 Bacteria 9649
108 Ga0105239_10011411 3300010375 Bacteria 9910
109 Ga0105239_10076398 3300010375 Bacteria 3684
110 Ga0105239_10196692 3300010375 Bacteria 2258
111 Ga0105239_10236593 3300010375 Bacteria 2050
112 Ga0105239_10764425 3300010375 Bacteria 1106
113 Ga0105239_10877570 3300010375 Bacteria 1029
114 Ga0157373_10004706 3300013100 Bacteria 10262
115 Ga0157371_10112424 3300013102 Bacteria 1933
116 Ga0157370_10000726 3300013104 Bacteria 41325
117 Ga0157370_10155938 3300013104 Bacteria 2124
118 Ga0157370_10292337 3300013104 Bacteria 1505
119 Ga0157370_10765199 3300013104 Bacteria 880
120 Ga0157369_10003048 3300013105 Bacteria 19997
121 Ga0157369_10088602 3300013105 Bacteria 3303
122 Ga0157369_10306827 3300013105 Bacteria 1651
123 Ga0157369_10324674 3300013105 Bacteria 1600
124 Ga0157369_10397991 3300013105 Bacteria 1429
125 Ga0157374_10537397 3300013296 Bacteria 1176
126 Ga0157378_11180109 3300013297 Unclassified 804
127 Ga0163162_10015754 3300013306 Bacteria 7390
128 Ga0163162_10124212 3300013306 Bacteria 2687
129 Ga0163162_10677947 3300013306 Bacteria 1153
130 Ga0157375_10061972 3300013308 Bacteria 3715
131 Ga0157375_11286390 3300013308 Bacteria 859
132 Ga0163163_10536821 3300014325 Bacteria 1232
133 Ga0163163_10684450 3300014325 Bacteria 1089
134 Ga0182008_10019963 3300014497 Bacteria 3453
135 Ga0182008_10170103 3300014497 Bacteria 1100
136 Ga0157379_10006090 3300014968 Bacteria 10387
137 Ga0157379_10009377 3300014968 Bacteria 8529
138 Ga0157379_10019447 3300014968 Bacteria 5998
139 Ga0157379_11440688 3300014968 Bacteria 669
140 Ga0157376_10356367 3300014969 Bacteria 1402
141 Ga0182006_1088117 3300015261 Bacteria 1121
142 Ga0163161_10669882 3300017792 Bacteria 861
143 Ga0224712_10069545 3300022467 Bacteria 1425
144 Ga0209258_106168 3300025242 Bacteria 1916
145 Ga0209148_1000032 3300025254 Bacteria 557660
146 Ga0209148_1006034 3300025254 Bacteria 2677
147 Ga0209233_1000034 3300025261 Bacteria 578898
148 Ga0209455_1000235 3300025272 Bacteria 69582
149 Ga0209673_1000220 3300025273 Bacteria 113086
150 Ga0209130_1039409 3300025284 Bacteria 920
151 Ga0209025_1085908 3300025294 Bacteria 1048
152 Ga0209564_1000955 3300025295 Bacteria 36777
153 Ga0209256_1000341 3300025299 Bacteria 76526
154 Ga0207680_10001621 3300025903 Bacteria 10641
155 Ga0207680_10069794 3300025903 Bacteria 2172
156 Ga0207647_10019675 3300025904 Bacteria 4537
157 Ga0207699_10005327 3300025906 Bacteria 6163
158 Ga0207699_10132920 3300025906 Bacteria 1625
159 Ga0207645_10081036 3300025907 Bacteria 2081
160 Ga0207705_10125703 3300025909 Bacteria 1906
161 Ga0207654_10363649 3300025911 Bacteria 999
162 Ga0207654_10460724 3300025911 Bacteria 893
163 Ga0207707_10000001 3300025912 Bacteria 1212482
164 Ga0207707_10164350 3300025912 Bacteria 1940
165 Ga0207707_10384779 3300025912 Bacteria 1206
166 Ga0207695_10140718 3300025913 Bacteria 2362
167 Ga0207695_10210451 3300025913 Bacteria 1855
168 Ga0207695_10216764 3300025913 Bacteria 1822
169 Ga0207695_10786428 3300025913 Bacteria 832
170 Ga0207671_10022974 3300025914 Bacteria 4709
171 Ga0207671_10128703 3300025914 Bacteria 1942
172 Ga0207671_10246164 3300025914 Bacteria 1405
173 Ga0207671_10292990 3300025914 Bacteria 1285
174 Ga0207693_10002910 3300025915 Bacteria 14823
175 Ga0207693_10006853 3300025915 Bacteria 9407
176 Ga0207663_10103240 3300025916 Bacteria 1920
177 Ga0207660_10000665 3300025917 Bacteria 22961
178 Ga0207660_10149038 3300025917 Bacteria 1796
179 Ga0207657_10298426 3300025919 Bacteria 1276
180 Ga0207649_10930565 3300025920 Bacteria 682
181 Ga0207652_10000363 3300025921 Bacteria 47059
182 Ga0207652_10001986 3300025921 Bacteria 17698
183 Ga0207652_10283382 3300025921 Bacteria 1495
184 Ga0207694_10003257 3300025924 Bacteria 12933
185 Ga0207694_10013789 3300025924 Bacteria 6093
186 Ga0207694_10548451 3300025924 Bacteria 970
187 Ga0207700_10000972 3300025928 Bacteria 16548
188 Ga0207664_10082472 3300025929 Bacteria 2619
189 Ga0207664_10146300 3300025929 Bacteria 2004
190 Ga0207706_10561918 3300025933 Bacteria 982
191 Ga0207709_10202432 3300025935 Bacteria 1419
192 Ga0207669_10066733 3300025937 Bacteria 2239
193 Ga0207669_10558116 3300025937 Bacteria 925
194 Ga0207704_10110643 3300025938 Bacteria 1856
195 Ga0207665_10024569 3300025939 Bacteria 3973
196 Ga0207691_10000929 3300025940 Bacteria 29103
197 Ga0207689_10023487 3300025942 Bacteria 5175
198 Ga0207661_10006966 3300025944 Bacteria 8017
199 Ga0207661_10736880 3300025944 Bacteria 907
200 Ga0207679_10114199 3300025945 Bacteria 2138
201 Ga0207667_10003097 3300025949 Bacteria 20583
202 Ga0207667_10423691 3300025949 Bacteria 1354
203 Ga0207651_10413690 3300025960 Bacteria 1150
204 Ga0207668_10576174 3300025972 Bacteria 978
205 Ga0207640_10294523 3300025981 Bacteria 1281
206 Ga0207658_10006509 3300025986 Bacteria 7975
207 Ga0207658_10176936 3300025986 Bacteria 1763
208 Ga0207658_10263590 3300025986 Bacteria 1470
209 Ga0207703_10283135 3300026035 Bacteria 1506
210 Ga0207639_10003680 3300026041 Bacteria 10305
211 Ga0207639_10227452 3300026041 Bacteria 1615
212 Ga0207639_10499416 3300026041 Bacteria 1111
213 Ga0207678_10002188 3300026067 Bacteria 17658
214 Ga0207678_10142927 3300026067 Bacteria 2042
215 Ga0207678_10545841 3300026067 Bacteria 1013
216 Ga0207702_10000182 3300026078 Bacteria 75732
217 Ga0207702_10109063 3300026078 Bacteria 2457
218 Ga0207702_10308478 3300026078 Bacteria 1504
219 Ga0207702_10899645 3300026078 Bacteria 877
220 Ga0207702_11109069 3300026078 Bacteria 785
221 Ga0207702_11113090 3300026078 Bacteria 784
222 Ga0207648_10038561 3300026089 Bacteria 4204
223 Ga0207674_10000003 3300026116 Bacteria 241674
224 Ga0207674_10293323 3300026116 Bacteria 1575
225 Ga0207674_10322230 3300026116 Bacteria 1495
226 Ga0207675_101154430 3300026118 Bacteria 795
227 Ga0207698_10069452 3300026142 Bacteria 2786
228 Ga0207698_10082986 3300026142 Bacteria 2592
229 Ga0207698_10247023 3300026142 Bacteria 1630
230 Ga0209281_1000034 3300027111 Bacteria 382562
231 Ga0268266_10000406 3300028379 Bacteria 65477
232 Ga0265318_10061041 3300028577 Bacteria 1404
233 Ga0307515_10000135 3300028794 Bacteria 175323
234 Ga0307515_10392165 3300028794 Bacteria 1017
235 Ga0307515_10607983 3300028794 Bacteria 704
236 Ga0265338_10012850 3300028800 Bacteria 9516
237 Ga0265338_10077160 3300028800 Bacteria 2818
238 Ga0265338_10734726 3300028800 Bacteria 679
239 Ga0265324_10034856 3300029957 Unclassified 1753
240 Ga0265324_10120647 3300029957 Bacteria 890
241 Ga0265332_10009365 3300031238 Bacteria 4374
242 Ga0265332_10019146 3300031238 Bacteria 3022
243 Ga0265320_10011465 3300031240 Bacteria 5215
244 Ga0265325_10066570 3300031241 Unclassified 1816
245 Ga0265329_10163114 3300031242 Bacteria 725
246 Ga0265340_10162669 3300031247 Bacteria 1014
247 Ga0265339_10002104 3300031249 Bacteria 14518
248 Ga0265331_10009923 3300031250 Bacteria 5299
249 Ga0265331_10032315 3300031250 Bacteria 2594
250 Ga0265316_10019847 3300031344 Bacteria 5738
251 Ga0265316_10091967 3300031344 Unclassified 2313
252 Ga0265316_10142424 3300031344 Bacteria 1800
253 Ga0265313_10005068 3300031595 Bacteria 9815
254 Ga0265313_10043077 3300031595 Bacteria 2212
255 Ga0307508_10413544 3300031616 Bacteria 940
256 Ga0307514_10032680 3300031649 Bacteria 4160
257 Ga0316575_10037339 3300031665 Bacteria 1913
258 Ga0265314_10088148 3300031711 Bacteria 2027
259 Ga0265314_10128814 3300031711 Bacteria 1581
260 Ga0265342_10022458 3300031712 Bacteria 4010
261 Ga0307414_10028478 3300032004 Bacteria 3625
262 Ga0373923_0318477 3300035111 Bacteria 738
263 Ga0373956_0363297 3300035119 Bacteria 690
264 Ga0373935_0116171 3300035692 Bacteria 1782
265 Ga0373937_0115038 3300036401 Bacteria 2504
266 Ga0373937_0142087 3300036401 Bacteria 2246
267 Ga0373925_0083414 3300037068 Bacteria 2434
268 Ga0395900_0161871 3300037418 Bacteria 2282
269 Ga0395900_0570482 3300037418 Bacteria 1074
270 Ga0395905_0103611 3300037471 Bacteria 2671
271 Ga0395905_0285902 3300037471 Bacteria 1536
272 Ga0395905_0310119 3300037471 Bacteria 1466
273 Ga0395901_0046061 3300038443 Bacteria 4529
274 Ga0451789_0634181 3300041443 Bacteria 1699
275 Ga0451807_0244631 3300041486 Bacteria 809
276 Ga0451807_0783002 3300041486 Bacteria 3638
277 Ga0466972_0148224 3300044658 Bacteria 1103
278 Ga0466965_0082735 3300044683 Bacteria 1624
279 Ga0466965_0317056 3300044683 Bacteria 849
280 Ga0466970_0225636 3300044765 Bacteria 1046
281 Ga0466960_0365316 3300044901 Bacteria 826
282 Ga0466958_0129192 3300045836 Bacteria 1586
283 Ga0466967_0975842 3300045976 Bacteria 843
284 Ga0495638_0055367 3300046460 Bacteria 2463
285 Ga0495651_0415451 3300046462 Bacteria 876
286 Ga0495580_0203140 3300046472 Bacteria 1365
287 Ga0495664_0099811 3300046477 Bacteria 1748
288 Ga0495596_0117712 3300046500 Bacteria 1032
289 Ga0495607_0112652 3300046501 Bacteria 1440
290 Ga0495610_0097193 3300046512 Bacteria 1325
291 Ga0495620_0061259 3300046515 Bacteria 1566
292 Ga0495628_0528307 3300046516 Bacteria 849
293 Ga0495632_0060453 3300046519 Bacteria 1841
294 Ga0495643_0021764 3300046522 Bacteria 3670
295 Ga0495643_0079222 3300046522 Bacteria 1713
296 Ga0495654_0000758 3300046530 Bacteria 24982
297 Ga0495587_0067596 3300046536 Bacteria 2083
298 Ga0495645_0091891 3300046543 Bacteria 2167
299 Ga0495668_0016973 3300046616 Bacteria 4228
300 Ga0495623_0173937 3300046679 Bacteria 1256
301 Ga0495672_0129214 3300047320 Bacteria 1331
302 Ga0495675_0081926 3300047444 Bacteria 2032
303 Ga0495686_0264890 3300047472 Bacteria 961
304 Ga0495686_0349062 3300047472 Bacteria 805
305 Ga0495626_0104020 3300048091 Bacteria 1235
306 Ga0496102_0112455 3300048905 Bacteria 2540
307 Ga0496102_0400423 3300048905 Bacteria 1291
308 Ga0496103_0288867 3300048906 Bacteria 1055
309 Ga0496111_0382284 3300048914 Unclassified 1041
310 Ga0496112_0071701 3300048915 Bacteria 3424
311 Ga0496112_0121106 3300048915 Bacteria 2586
312 Ga0496113_0485546 3300048916 Bacteria 992
313 Ga0496116_0002552 3300048919 Bacteria 19027
314 Ga0496116_0076191 3300048919 Bacteria 2102
315 Ga0496117_0000657 3300048920 Bacteria 55296
316 Ga0496118_0015429 3300048921 Bacteria 7070
317 Ga0496119_0083930 3300048922 Bacteria 1828
318 Ga0496119_0199566 3300048922 Bacteria 1036
319 Ga0496120_0005277 3300048923 Bacteria 10370
320 Ga0496120_0047499 3300048923 Bacteria 2475
321 Ga0496121_0001349 3300048924 Bacteria 41966
322 Ga0496121_0028932 3300048924 Bacteria 5143
323 Ga0496121_0030943 3300048924 Bacteria 4904
324 Ga0496122_0000462 3300048925 Bacteria 84546
325 Ga0496122_0009404 3300048925 Bacteria 10311
326 Ga0496123_0000048 3300048926 Bacteria 244152
327 Ga0496123_0062761 3300048926 Bacteria 2378
328 Ga0496124_0004660 3300048927 Bacteria 15865
329 Ga0496124_0008227 3300048927 Bacteria 10938
330 Ga0496124_0013964 3300048927 Bacteria 7800
331 Ga0496124_0129217 3300048927 Bacteria 2009
332 Ga0496124_0169885 3300048927 Bacteria 1690
333 Ga0496124_0280947 3300048927 Bacteria 1213
334 Ga0496124_0391585 3300048927 Bacteria 968
335 Ga0496125_0028346 3300048928 Bacteria 5061
336 Ga0496125_0062096 3300048928 Bacteria 2991
337 Ga0496125_0148717 3300048928 Bacteria 1614
338 Ga0496126_0001325 3300048929 Bacteria 39349
339 Ga0496126_0263675 3300048929 Bacteria 1432
340 Ga0501310_003256 3300049130 Bacteria 1582
341 Ga0501300_008000 3300049523 Bacteria 1550
342 Ga0501031_0007354 3300049568 Bacteria 7178
343 Ga0501031_0283423 3300049568 Bacteria 1075
344 Ga0501032_0004327 3300049569 Bacteria 10724
345 Ga0501033_0000411 3300049570 Bacteria 40975
346 Ga0501033_0169718 3300049570 Bacteria 1567
347 Ga0501034_0066799 3300049571 Bacteria 3609
348 Ga0501034_0089094 3300049571 Bacteria 3083
349 Ga0501034_0121713 3300049571 Bacteria 2595
350 Ga0501034_0164635 3300049571 Bacteria 2187
351 Ga0501034_0311838 3300049571 Bacteria 1507
352 Ga0501034_0746850 3300049571 Bacteria 874
353 Ga0501036_0008520 3300049572 Bacteria 8405
354 Ga0501037_0000324 3300049573 Bacteria 40550
355 Ga0501037_0286873 3300049573 Bacteria 1146
356 Ga0501038_0000335 3300049574 Bacteria 40628
357 Ga0501039_0085417 3300049575 Bacteria 2458
358 Ga0501042_0107080 3300049578 Bacteria 2012
359 Ga0501043_0000374 3300049579 Bacteria 40575
360 Ga0501043_0082976 3300049579 Bacteria 2520
361 Ga0501043_0145614 3300049579 Bacteria 1855
362 Ga0501043_0486826 3300049579 Bacteria 923
363 Ga0501046_0006886 3300049580 Bacteria 10018
364 Ga0501047_0000540 3300049581 Bacteria 40769
365 Ga0501047_0007507 3300049581 Bacteria 10261
366 Ga0501047_0236549 3300049581 Bacteria 1678
367 Ga0501047_0479536 3300049581 Bacteria 1071
368 Ga0501048_0000171 3300049582 Bacteria 40760
369 Ga0501048_0121656 3300049582 Bacteria 1844
370 Ga0501048_0471770 3300049582 Bacteria 899
371 Ga0501067_0004466 3300049583 Bacteria 7716
372 Ga0501067_0017381 3300049583 Bacteria 3975
373 Ga0501067_0295755 3300049583 Bacteria 901
374 Ga0501068_0050921 3300049584 Bacteria 2504
375 Ga0501068_0076043 3300049584 Bacteria 2054
376 Ga0501068_0320457 3300049584 Bacteria 994
377 Ga0501068_0408890 3300049584 Bacteria 875
378 Ga0501069_0042179 3300049585 Bacteria 2523
379 Ga0501069_0052577 3300049585 Bacteria 2268
380 Ga0501069_0072901 3300049585 Bacteria 1925
381 Ga0501070_0000029 3300049586 Bacteria 140083
382 Ga0501070_0000371 3300049586 Bacteria 40848
383 Ga0501070_0007754 3300049586 Bacteria 9100
384 Ga0501070_0049552 3300049586 Bacteria 3488
385 Ga0501070_0051906 3300049586 Bacteria 3403
386 Ga0501070_0085394 3300049586 Bacteria 2613
387 Ga0501071_0177277 3300049587 Bacteria 1596
388 Ga0501071_1029949 3300049587 Bacteria 636
389 Ga0501072_0026799 3300049588 Bacteria 4496
390 Ga0501072_0037477 3300049588 Bacteria 3803
391 Ga0501073_0002398 3300049589 Bacteria 14023
392 Ga0501073_0007762 3300049589 Bacteria 7967
393 Ga0501073_0011067 3300049589 Bacteria 6599
394 Ga0501073_0025790 3300049589 Bacteria 4211
395 Ga0501074_0005944 3300049590 Bacteria 8800
396 Ga0501074_0009980 3300049590 Bacteria 6896
397 Ga0501074_0054892 3300049590 Bacteria 2873
398 Ga0501074_0094971 3300049590 Bacteria 2135
399 Ga0501074_0182509 3300049590 Bacteria 1497
400 Ga0501074_0329389 3300049590 Unclassified 1084
401 Ga0501217_011439 3300049661 Bacteria 1963
402 Ga0501238_003936 3300049671 Bacteria 1841
403 Ga0501079_0001199 3300049741 Bacteria 18177
404 Ga0501079_0009255 3300049741 Bacteria 7463
405 Ga0501079_0052653 3300049741 Bacteria 3141
406 Ga0501079_0238291 3300049741 Bacteria 1421
407 Ga0501079_0249639 3300049741 Bacteria 1387
408 Ga0501080_0006875 3300049742 Bacteria 10257
409 Ga0501080_0007826 3300049742 Bacteria 9667
410 Ga0501080_0126439 3300049742 Bacteria 2367
411 Ga0501080_0164827 3300049742 Bacteria 2045
412 Ga0501080_0194530 3300049742 Bacteria 1863
413 Ga0501080_0497348 3300049742 Bacteria 1090
414 Ga0501080_0953880 3300049742 Bacteria 746
415 Ga0501083_0001714 3300049744 Bacteria 14938
416 Ga0501083_0006953 3300049744 Bacteria 8027
417 Ga0501083_0016153 3300049744 Bacteria 5227
418 Ga0501083_0060531 3300049744 Bacteria 2529
419 Ga0501270_033293 3300049767 Unclassified 862
420 Ga0501035_0000859 3300049822 Bacteria 32391
421 Ga0501035_0003367 3300049822 Bacteria 15300
422 Ga0501035_0007925 3300049822 Bacteria 9917
423 Ga0501035_0099079 3300049822 Unclassified 2559
424 Ga0501035_0470895 3300049822 Bacteria 1037
425 Ga0501044_0000687 3300049823 Bacteria 40888
426 Ga0501044_0012882 3300049823 Bacteria 9051
427 Ga0501044_0164723 3300049823 Bacteria 2192
428 Ga0501044_0553988 3300049823 Bacteria 1047
429 Ga0501044_1096470 3300049823 Bacteria 665
430 Ga0501045_0132713 3300049824 Bacteria 1851
431 Ga0501226_004919 3300049853 Bacteria 1533
432 nmdc:mga00v17_374632_c1 3300050491 Bacteria 925
433 nmdc:mga00v17_55880_c1 3300050491 Bacteria 2412
434 nmdc:mga0yw44_512173_c1 3300050492 Bacteria 814
435 nmdc:mga0k408_470064_c1 3300050493 Bacteria 746
436 nmdc:mga06z11_98647_c1 3300050494 Bacteria 1599
437 nmdc:mga0n895_22304_c1 3300050512 Bacteria 5935
438 nmdc:mga0rr50_277539_c1 3300050513 Bacteria 1398
439 nmdc:mga08x19_89_c1 3300050514 Bacteria 82051
440 Ga0500610_0023027 3300053079 Bacteria 3078
441 Ga0495655_0011775 3300053083 Bacteria 1765
442 Ga0500578_0595362 3300053086 Bacteria 609
443 Ga0500608_105415 3300053122 Bacteria 1300
444 Ga0500618_000056 3300053125 Bacteria 98509
445 Ga0500618_000304 3300053125 Bacteria 36803
446 Ga0500618_035559 3300053125 Bacteria 1156
447 Ga0500655_007157 3300053133 Bacteria 2006
448 Ga0500559_0073153 3300053136 Bacteria 1546
449 Ga0500559_0239748 3300053136 Unclassified 855
450 Ga0500568_0000436 3300053139 Bacteria 31383
451 Ga0500568_0123550 3300053139 Bacteria 964
452 Ga0500604_0045268 3300053151 Bacteria 1342
453 Ga0500620_000040 3300053155 Bacteria 23734
454 Ga0500611_020812 3300053727 Bacteria 1244
455 Ga0501084_0105471 3300054114 Bacteria 2367
456 Ga0501084_0180482 3300054114 Bacteria 1782
457 Ga0501084_0663404 3300054114 Bacteria 880
458 Ga0501082_0005048 3300060353 Bacteria 11509
459 Ga0501082_0007327 3300060353 Bacteria 9522
460 Ga0501082_0009005 3300060353 Bacteria 8613
461 Ga0501082_0020207 3300060353 Bacteria 5739
462 Ga0501082_0156508 3300060353 Bacteria 1980
463 Ga0501082_0876877 3300060353 Unclassified 785

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2968138860 2968146467 163
2 iso_pu_bacteria 2869169390 2869176996 167
3 3300048905 Ga0496102_0112455 Ga0496102_0112455_1714_2238 170
4 3300003323 rootH1_10312064 rootH1_103120642 175
5 3300025986 Ga0207658_10176936 Ga0207658_101769362 180
6 3300031665 Ga0316575_10037339 Ga0316575_100373391 181
7 iso_pu_bacteria 2513237305 2514419050 181
8 3300010375 Ga0105239_10011411 Ga0105239_1001141111 182
9 3300013105 Ga0157369_10324674 Ga0157369_103246742 182
10 3300035119 Ga0373956_0363297 Ga0373956_0363297_108_665 182
11 3300046462 Ga0495651_0415451 Ga0495651_0415451_33_590 182
12 3300046477 Ga0495664_0099811 Ga0495664_0099811_792_1349 182
13 3300046516 Ga0495628_0528307 Ga0495628_0528307_274_831 182
14 3300046536 Ga0495587_0067596 Ga0495587_0067596_524_1081 182
15 3300046543 Ga0495645_0091891 Ga0495645_0091891_333_890 182
16 3300005539 Ga0068853_100008770 Ga0068853_1000087706 183
17 3300013104 Ga0157370_10292337 Ga0157370_102923372 183
18 3300026041 Ga0207639_10227452 Ga0207639_102274522 183
19 3300026067 Ga0207678_10142927 Ga0207678_101429271 183
20 3300037418 Ga0395900_0570482 Ga0395900_0570482_162_728 183
21 3300045836 Ga0466958_0129192 Ga0466958_0129192_913_1482 183
22 3300049590 Ga0501074_0182509 Ga0501074_0182509_597_1166 183
23 3300049823 Ga0501044_1096470 Ga0501044_1096470_57_626 183
24 3300005336 Ga0070680_100345585 Ga0070680_1003455852 184
25 3300044683 Ga0466965_0317056 Ga0466965_0317056_64_630 184
26 3300049568 Ga0501031_0007354 Ga0501031_0007354_3322_3876 184
27 3300049569 Ga0501032_0004327 Ga0501032_0004327_3519_4073 184
28 3300049570 Ga0501033_0000411 Ga0501033_0000411_36841_37395 184
29 3300049570 Ga0501033_0169718 Ga0501033_0169718_691_1245 184
30 3300049571 Ga0501034_0121713 Ga0501034_0121713_1082_1636 184
31 3300049571 Ga0501034_0311838 Ga0501034_0311838_544_1098 184
32 3300049572 Ga0501036_0008520 Ga0501036_0008520_4477_5031 184
33 3300049573 Ga0501037_0000324 Ga0501037_0000324_3439_3993 184
34 3300049574 Ga0501038_0000335 Ga0501038_0000335_3372_3926 184
35 3300049575 Ga0501039_0085417 Ga0501039_0085417_1577_2131 184
36 3300049578 Ga0501042_0107080 Ga0501042_0107080_374_928 184
37 3300049579 Ga0501043_0000374 Ga0501043_0000374_36573_37127 184
38 3300049580 Ga0501046_0006886 Ga0501046_0006886_6090_6644 184
39 3300049581 Ga0501047_0000540 Ga0501047_0000540_36841_37395 184
40 3300049582 Ga0501048_0000171 Ga0501048_0000171_3375_3929 184
41 3300049584 Ga0501068_0076043 Ga0501068_0076043_534_1088 184
42 3300049585 Ga0501069_0042179 Ga0501069_0042179_1434_1988 184
43 3300049586 Ga0501070_0000371 Ga0501070_0000371_3520_4074 184
44 3300049588 Ga0501072_0037477 Ga0501072_0037477_2139_2693 184
45 3300049589 Ga0501073_0011067 Ga0501073_0011067_3347_3901 184
46 3300049590 Ga0501074_0005944 Ga0501074_0005944_4800_5354 184
47 3300049741 Ga0501079_0009255 Ga0501079_0009255_6340_6894 184
48 3300049744 Ga0501083_0016153 Ga0501083_0016153_2023_2577 184
49 3300049822 Ga0501035_0003367 Ga0501035_0003367_11372_11926 184
50 3300049822 Ga0501035_0470895 Ga0501035_0470895_234_788 184
51 3300049823 Ga0501044_0000687 Ga0501044_0000687_36815_37369 184
52 3300049824 Ga0501045_0132713 Ga0501045_0132713_330_884 184
53 3300060353 Ga0501082_0009005 Ga0501082_0009005_2614_3168 184
54 iso_pu_bacteria 2643221547 2643754885 184
55 iso_pu_bacteria 2929138655 2929143347 184
56 iso_pu_bacteria 2995392953 2995395033 184
57 3300005616 Ga0068852_100009705 Ga0068852_1000097056 185
58 3300013104 Ga0157370_10155938 Ga0157370_101559381 185
59 3300031616 Ga0307508_10413544 Ga0307508_104135442 185
60 3300053155 Ga0500620_000040 Ga0500620_000040_11689_12246 185
61 iso_pu_bacteria 2508501123 2509114465 185
62 iso_pu_bacteria 2509276018 2509368378 185
63 iso_pu_bacteria 2509276022 2509393222 185
64 iso_pu_bacteria 2510065059 2510314659 185
65 iso_pu_bacteria 2512875016 2512934215 185
66 iso_pu_bacteria 2512875024 2512962517 185
67 iso_pu_bacteria 2513237164 2514038651 185
68 iso_pu_bacteria 2588253730 2588520368 185
69 iso_pu_bacteria 2643221595 2643983941 185
70 iso_pu_bacteria 2643221627 2644156071 185
71 iso_pu_bacteria 2687453392 2688595633 185
72 iso_pu_bacteria 2721755686 2723572832 185
73 iso_pu_bacteria 2756170246 2756674284 185
74 iso_pu_bacteria 2757320392 2757569653 185
75 iso_pu_bacteria 2791355123 2792746818 185
76 iso_pu_bacteria 2818991461 2819686902 185
77 iso_pu_bacteria 2821123053 2821125839 185
78 iso_pu_bacteria 2838736955 2838737712 185
79 iso_pu_bacteria 2840878972 2840879738 185
80 iso_pu_bacteria 2841840854 2841841919 185
81 iso_pu_bacteria 2842140634 2842141698 185
82 iso_pu_bacteria 2844002411 2844003838 185
83 iso_pu_bacteria 2856320880 2856321943 185
84 iso_pu_bacteria 2856328259 2856332885 185
85 iso_pu_bacteria 2856334872 2856340266 185
86 iso_pu_bacteria 2857367948 2857373453 185
87 iso_pu_bacteria 2857531043 2857532400 185
88 iso_pu_bacteria 2869234852 2869238744 185
89 iso_pu_bacteria 2869242130 2869246208 185
90 iso_pu_bacteria 2869249662 2869252447 185
91 iso_pu_bacteria 2869256925 2869260673 185
92 iso_pu_bacteria 2869264136 2869267185 185
93 iso_pu_bacteria 2869271264 2869275484 185
94 iso_pu_bacteria 2869278585 2869280120 185
95 iso_pu_bacteria 2871435913 2871437758 185
96 iso_pu_bacteria 2871451962 2871458090 185
97 iso_pu_bacteria 2871459585 2871465496 185
98 iso_pu_bacteria 2871466892 2871470621 185
99 iso_pu_bacteria 2871481445 2871485679 185
100 iso_pu_bacteria 2871488783 2871491059 185
101 iso_pu_bacteria 2874116593 2874118340 185
102 iso_pu_bacteria 2874123672 2874131408 185
103 iso_pu_bacteria 2874131515 2874133467 185
104 iso_pu_bacteria 2874139085 2874143328 185
105 iso_pu_bacteria 2874162495 2874164802 185
106 iso_pu_bacteria 2874168670 2874172023 185
107 iso_pu_bacteria 2876363079 2876363523 185
108 iso_pu_bacteria 2876386047 2876387535 185
109 iso_pu_bacteria 2876399893 2876403907 185
110 iso_pu_bacteria 2876406927 2876407817 185
111 iso_pu_bacteria 2876420981 2876425832 185
112 iso_pu_bacteria 2878730984 2878734975 185
113 iso_pu_bacteria 2878738818 2878740605 185
114 iso_pu_bacteria 2878753008 2878755469 185
115 iso_pu_bacteria 2878774303 2878775717 185
116 iso_pu_bacteria 2878781027 2878781319 185
117 iso_pu_bacteria 2881155292 2881158960 185
118 iso_pu_bacteria 2881845957 2881850979 185
119 iso_pu_bacteria 2881861095 2881861593 185
120 iso_pu_bacteria 2882632389 2882634795 185
121 iso_pu_bacteria 2882912400 2882915119 185
122 iso_pu_bacteria 2885318864 2885324250 185
123 iso_pu_bacteria 2885350715 2885351341 185
124 iso_pu_bacteria 2888337043 2888342976 185
125 iso_pu_bacteria 2903448605 2903454394 185
126 iso_pu_bacteria 2903492973 2903499056 185
127 iso_pu_bacteria 2903513507 2903516290 185
128 iso_pu_bacteria 2903521522 2903525473 185
129 iso_pu_bacteria 2903528002 2903531782 185
130 iso_pu_bacteria 2906363423 2906369605 185
131 iso_pu_bacteria 2906370794 2906375550 185
132 iso_pu_bacteria 2906378014 2906378832 185
133 iso_pu_bacteria 2906386501 2906392187 185
134 iso_pu_bacteria 2906401398 2906403043 185
135 iso_pu_bacteria 2906408224 2906413708 185
136 iso_pu_bacteria 2922151315 2922155105 185
137 iso_pu_bacteria 2922172374 2922177872 185
138 iso_pu_bacteria 2922178524 2922185427 185
139 iso_pu_bacteria 2924710171 2924715976 185
140 iso_pu_bacteria 2924733363 2924736684 185
141 iso_pu_bacteria 2924741084 2924742779 185
142 iso_pu_bacteria 2924748358 2924751449 185
143 iso_pu_bacteria 2924762789 2924764033 185
144 iso_pu_bacteria 2924776078 2924778206 185
145 iso_pu_bacteria 2924784321 2924791559 185
146 iso_pu_bacteria 2937822353 2937826355 185
147 iso_pu_bacteria 2937848649 2937854700 185
148 iso_pu_bacteria 2937861824 2937865009 185
149 iso_pu_bacteria 2937868953 2937870689 185
150 iso_pu_bacteria 2937877337 2937878002 185
151 iso_pu_bacteria 2937972304 2937973989 185
152 iso_pu_bacteria 2937980651 2937983714 185
153 iso_pu_bacteria 2958034702 2958035986 185
154 iso_pu_bacteria 2958041894 2958045292 185
155 iso_pu_bacteria 2958064165 2958068034 185
156 iso_pu_bacteria 2958084443 2958085113 185
157 iso_pu_bacteria 2958092219 2958097986 185
158 iso_pu_bacteria 2958108152 2958110377 185
159 iso_pu_bacteria 2958122699 2958125469 185
160 iso_pu_bacteria 2958137437 2958140383 185
161 iso_pu_bacteria 2958158011 2958162386 185
162 iso_pu_bacteria 2961127735 2961135438 185
163 iso_pu_bacteria 2961136820 2961140808 185
164 iso_pu_bacteria 2961170736 2961176587 185
165 iso_pu_bacteria 2961183825 2961185724 185
166 iso_pu_bacteria 2963644680 2963644983 185
167 iso_pu_bacteria 2965025482 2965030332 185
168 iso_pu_bacteria 2965032056 2965034303 185
169 iso_pu_bacteria 2965040258 2965041560 185
170 iso_pu_bacteria 2965047637 2965049185 185
171 iso_pu_bacteria 2965089291 2965094276 185
172 iso_pu_bacteria 2965110997 2965113466 185
173 iso_pu_bacteria 2967996073 2968001396 185
174 iso_pu_bacteria 2968003550 2968007449 185
175 iso_pu_bacteria 2968016561 2968017240 185
176 iso_pu_bacteria 2968083720 2968088735 185
177 iso_pu_bacteria 2970469710 2970470597 185
178 iso_pu_bacteria 2970489779 2970490187 185
179 iso_pu_bacteria 2970503327 2970509258 185
180 iso_pu_bacteria 2970510686 2970514769 185
181 iso_pu_bacteria 2970532167 2970533022 185
182 iso_pu_bacteria 2970547951 2970550449 185
183 iso_pu_bacteria 2970593180 2970594717 185
184 iso_pu_bacteria 2970619444 2970624240 185
185 iso_pu_bacteria 2970627176 2970627989 185
186 iso_pu_bacteria 2977821940 2977824608 185
187 iso_pu_bacteria 2977828996 2977835331 185
188 iso_pu_bacteria 2977851361 2977857612 185
189 iso_pu_bacteria 2977872689 2977873675 185
190 iso_pu_bacteria 2977907340 2977911529 185
191 iso_pu_bacteria 2977915119 2977916140 185
192 iso_pu_bacteria 2977922695 2977925889 185
193 iso_pu_bacteria 2977935797 2977941858 185
194 iso_pu_bacteria 2977950692 2977951477 185
195 iso_pu_bacteria 2977957713 2977963401 185
196 iso_pu_bacteria 2977986579 2977991583 185
197 iso_pu_bacteria 2979764755 2979771385 185
198 iso_pu_bacteria 2979772303 2979778347 185
199 iso_pu_bacteria 2979793036 2979798186 185
200 iso_pu_bacteria 2979808191 2979813937 185
201 iso_pu_bacteria 2987645492 2987649030 185
202 iso_pu_bacteria 2987666974 2987667570 185
203 iso_pu_bacteria 2987673487 2987674492 185
204 iso_pu_bacteria 2996348954 2996348984 185
205 iso_pu_bacteria 2996386984 2996391674 185
206 iso_pu_bacteria 3000135777 3000142601 185
207 iso_pu_bacteria 3004167301 3004172844 185
208 iso_pu_bacteria 3004195979 3004197867 185
209 iso_pu_bacteria 3004211236 3004216443 185
210 iso_pu_bacteria 3004218560 3004218654 185
211 iso_pu_bacteria 3004232784 3004239402 185
212 iso_pu_bacteria 3004239961 3004242173 185
213 iso_pu_bacteria 3004248173 3004254687 185
214 iso_pu_bacteria 3004275668 3004275696 185
215 iso_pu_bacteria 3004289098 3004291189 185
216 iso_pu_bacteria 649633066 649870200 185
217 iso_pu_bacteria 8004300914 8004301745 185
218 iso_pu_bacteria 8004312739 8004315002 185
219 iso_pu_bacteria 8004361976 8004365392 185
220 iso_pu_bacteria 8004374579 8004377048 185
221 iso_pu_bacteria 8004695233 8004701173 185
222 iso_pu_bacteria 8004727605 8004727915 185
223 3300005543 Ga0070672_100000146 Ga0070672_10000014629 186
224 3300005614 Ga0068856_100782977 Ga0068856_1007829771 186
225 3300005614 Ga0068856_101199044 Ga0068856_1011990441 186
226 3300013104 Ga0157370_10765199 Ga0157370_107651991 186
227 3300025940 Ga0207691_10000929 Ga0207691_100009297 186
228 3300026078 Ga0207702_11109069 Ga0207702_111090691 186
229 3300026078 Ga0207702_11113090 Ga0207702_111130901 186
230 3300028794 Ga0307515_10392165 Ga0307515_103921652 186
231 3300041443 Ga0451789_0634181 Ga0451789_0634181_548_1108 186
232 3300041486 Ga0451807_0783002 Ga0451807_0783002_1029_1589 186
233 3300045976 Ga0466967_0975842 Ga0466967_0975842_246_824 186
234 3300047320 Ga0495672_0129214 Ga0495672_0129214_234_854 186
235 3300049571 Ga0501034_0066799 Ga0501034_0066799_1762_2334 186
236 3300049823 Ga0501044_0553988 Ga0501044_0553988_438_1016 186
237 3300060353 Ga0501082_0007327 Ga0501082_0007327_189_761 186
238 iso_pu_bacteria 2599185301 2599935482 186
239 iso_pu_bacteria 2693429783 2694628202 186
240 iso_pu_bacteria 2693429784 2694640941 186
241 iso_pu_bacteria 2847686936 2847689678 186
242 iso_pu_bacteria 2856364286 2856366140 186
243 iso_pu_bacteria 2857349434 2857352605 186
244 iso_pu_bacteria 2869285874 2869291005 186
245 iso_pu_bacteria 2871429161 2871433287 186
246 iso_pu_bacteria 2871444079 2871446871 186
247 iso_pu_bacteria 2871495908 2871498899 186
248 iso_pu_bacteria 2874102143 2874103089 186
249 iso_pu_bacteria 2874146452 2874148771 186
250 iso_pu_bacteria 2874155637 2874160817 186
251 iso_pu_bacteria 2876369609 2876374733 186
252 iso_pu_bacteria 2876377896 2876385861 186
253 iso_pu_bacteria 2876392853 2876397357 186
254 iso_pu_bacteria 2876413966 2876418857 186
255 iso_pu_bacteria 2878745973 2878750900 186
256 iso_pu_bacteria 2878760144 2878763112 186
257 iso_pu_bacteria 2878767105 2878770087 186
258 iso_pu_bacteria 2881161766 2881164662 186
259 iso_pu_bacteria 2885305155 2885306502 186
260 iso_pu_bacteria 2885326080 2885328473 186
261 iso_pu_bacteria 2885334103 2885340578 186
262 iso_pu_bacteria 2888350351 2888352789 186
263 iso_pu_bacteria 2889010040 2889014564 186
264 iso_pu_bacteria 2889016732 2889020454 186
265 iso_pu_bacteria 2903492973 2903506244 186
266 iso_pu_bacteria 2903540706 2903543698 186
267 iso_pu_bacteria 2904659560 2904664111 186
268 iso_pu_bacteria 2906308376 2906313825 186
269 iso_pu_bacteria 2906321335 2906326534 186
270 iso_pu_bacteria 2906328253 2906334872 186
271 iso_pu_bacteria 2922158528 2922161022 186
272 iso_pu_bacteria 2924726620 2924727215 186
273 iso_pu_bacteria 2937813078 2937819870 186
274 iso_pu_bacteria 2937891427 2937897731 186
275 iso_pu_bacteria 2937994558 2937997547 186
276 iso_pu_bacteria 2938014810 2938018174 186
277 iso_pu_bacteria 2958041894 2958042056 186
278 iso_pu_bacteria 2958100919 2958101720 186
279 iso_pu_bacteria 2958115193 2958119435 186
280 iso_pu_bacteria 2958130278 2958135405 186
281 iso_pu_bacteria 2958165035 2958168020 186
282 iso_pu_bacteria 2958172287 2958177092 186
283 iso_pu_bacteria 2958179912 2958184434 186
284 iso_pu_bacteria 2961077736 2961082489 186
285 iso_pu_bacteria 2961114664 2961118749 186
286 iso_pu_bacteria 2961163497 2961166486 186
287 iso_pu_bacteria 2965018300 2965021306 186
288 iso_pu_bacteria 2965062239 2965065546 186
289 iso_pu_bacteria 2965119406 2965119782 186
290 iso_pu_bacteria 2968091066 2968093869 186
291 iso_pu_bacteria 2968097103 2968101348 186
292 iso_pu_bacteria 2968110612 2968115250 186
293 iso_pu_bacteria 2968117919 2968121950 186
294 iso_pu_bacteria 2968128360 2968134146 186
295 iso_pu_bacteria 2968171901 2968174890 186
296 iso_pu_bacteria 2970554993 2970557960 186
297 iso_pu_bacteria 2977843712 2977845502 186
298 iso_pu_bacteria 2977858184 2977864794 186
299 iso_pu_bacteria 2977942078 2977950683 186
300 iso_pu_bacteria 2979710463 2979717429 186
301 iso_pu_bacteria 2979742915 2979747415 186
302 iso_pu_bacteria 2979779861 2979781886 186
303 iso_pu_bacteria 2987636660 2987641197 186
304 iso_pu_bacteria 2987652177 2987656533 186
305 iso_pu_bacteria 2987659509 2987662496 186
306 iso_pu_bacteria 2996341866 2996342227 186
307 iso_pu_bacteria 3004188549 3004191546 186
308 iso_pu_bacteria 3004203850 3004210003 186
309 iso_pu_bacteria 8004387939 8004393294 186
310 iso_pu_bacteria 8004445564 8004446365 186
311 iso_pu_bacteria 8004640170 8004644258 186
312 iso_pu_bacteria 8004703790 8004707019 186
313 iso_pu_bacteria 8004714634 8004720081 186
314 3300003323 rootH1_10160586 rootH1_101605865 187
315 3300003771 Ga0055526_1019219 Ga0055526_10192192 187
316 3300003775 Ga0055524_1000504 Ga0055524_100050430 187
317 3300003790 Ga0055528_1000035 Ga0055528_100003530 187
318 3300005616 Ga0068852_100058403 Ga0068852_1000584035 187
319 3300013102 Ga0157371_10112424 Ga0157371_101124242 187
320 3300013105 Ga0157369_10397991 Ga0157369_103979911 187
321 3300025273 Ga0209673_1000220 Ga0209673_100022086 187
322 3300025295 Ga0209564_1000955 Ga0209564_10009554 187
323 3300025299 Ga0209256_1000341 Ga0209256_100034155 187
324 3300025949 Ga0207667_10423691 Ga0207667_104236912 187
325 3300026142 Ga0207698_10069452 Ga0207698_100694525 187
326 3300046530 Ga0495654_0000758 Ga0495654_0000758_18319_18882 187
327 3300048919 Ga0496116_0076191 Ga0496116_0076191_1283_1846 187
328 3300048921 Ga0496118_0015429 Ga0496118_0015429_2237_2800 187
329 3300048924 Ga0496121_0001349 Ga0496121_0001349_16146_16709 187
330 3300048925 Ga0496122_0009404 Ga0496122_0009404_2703_3266 187
331 3300048926 Ga0496123_0062761 Ga0496123_0062761_918_1481 187
332 3300048927 Ga0496124_0008227 Ga0496124_0008227_2794_3357 187
333 3300048927 Ga0496124_0013964 Ga0496124_0013964_4395_4958 187
334 3300048929 Ga0496126_0263675 Ga0496126_0263675_48_626 187
335 3300053122 Ga0500608_105415 Ga0500608_105415_642_1214 187
336 3300053125 Ga0500618_000056 Ga0500618_000056_6080_6643 187
337 3300053125 Ga0500618_000304 Ga0500618_000304_7527_8090 187
338 3300053136 Ga0500559_0073153 Ga0500559_0073153_179_751 187
339 3300053136 Ga0500559_0239748 Ga0500559_0239748_102_665 187
340 3300003320 rootH2_10092887 rootH2_100928872 188
341 3300005329 Ga0070683_100034345 Ga0070683_1000343455 188
342 3300005335 Ga0070666_10009665 Ga0070666_100096654 188
343 3300005335 Ga0070666_10084779 Ga0070666_100847792 188
344 3300005344 Ga0070661_100395270 Ga0070661_1003952701 188
345 3300005367 Ga0070667_100004911 Ga0070667_1000049114 188
346 3300005367 Ga0070667_100063380 Ga0070667_1000633802 188
347 3300005435 Ga0070714_100020316 Ga0070714_1000203168 188
348 3300005455 Ga0070663_100000968 Ga0070663_10000096810 188
349 3300005458 Ga0070681_10156799 Ga0070681_101567992 188
350 3300005530 Ga0070679_100024727 Ga0070679_1000247274 188
351 3300005548 Ga0070665_100089160 Ga0070665_1000891602 188
352 3300005548 Ga0070665_100355410 Ga0070665_1003554103 188
353 3300009093 Ga0105240_10909847 Ga0105240_109098471 188
354 3300009101 Ga0105247_10198525 Ga0105247_101985252 188
355 3300013306 Ga0163162_10015754 Ga0163162_100157549 188
356 3300013308 Ga0157375_10061972 Ga0157375_100619723 188
357 3300014325 Ga0163163_10684450 Ga0163163_106844502 188
358 3300014968 Ga0157379_11440688 Ga0157379_114406881 188
359 3300017792 Ga0163161_10669882 Ga0163161_106698822 188
360 3300025242 Ga0209258_106168 Ga0209258_1061682 188
361 3300025284 Ga0209130_1039409 Ga0209130_10394091 188
362 3300025903 Ga0207680_10001621 Ga0207680_100016217 188
363 3300025903 Ga0207680_10069794 Ga0207680_100697942 188
364 3300025912 Ga0207707_10164350 Ga0207707_101643502 188
365 3300025917 Ga0207660_10149038 Ga0207660_101490382 188
366 3300025920 Ga0207649_10930565 Ga0207649_109305651 188
367 3300025921 Ga0207652_10001986 Ga0207652_1000198613 188
368 3300025929 Ga0207664_10082472 Ga0207664_100824722 188
369 3300025944 Ga0207661_10006966 Ga0207661_100069665 188
370 3300025986 Ga0207658_10006509 Ga0207658_100065092 188
371 3300026067 Ga0207678_10002188 Ga0207678_1000218813 188
372 3300028379 Ga0268266_10000406 Ga0268266_100004069 188
373 3300028577 Ga0265318_10061041 Ga0265318_100610411 188
374 3300031238 Ga0265332_10009365 Ga0265332_100093653 188
375 3300031240 Ga0265320_10011465 Ga0265320_100114654 188
376 3300031247 Ga0265340_10162669 Ga0265340_101626692 188
377 3300031250 Ga0265331_10009923 Ga0265331_100099231 188
378 3300031344 Ga0265316_10019847 Ga0265316_100198477 188
379 3300031711 Ga0265314_10128814 Ga0265314_101288142 188
380 3300031712 Ga0265342_10022458 Ga0265342_100224585 188
381 3300032004 Ga0307414_10028478 Ga0307414_100284784 188
382 3300041486 Ga0451807_0244631 Ga0451807_0244631_132_704 188
383 3300048919 Ga0496116_0002552 Ga0496116_0002552_12963_13529 188
384 3300048920 Ga0496117_0000657 Ga0496117_0000657_31769_32335 188
385 3300048924 Ga0496121_0030943 Ga0496121_0030943_3727_4293 188
386 3300048927 Ga0496124_0004660 Ga0496124_0004660_5890_6456 188
387 3300048927 Ga0496124_0169885 Ga0496124_0169885_381_956 188
388 3300048927 Ga0496124_0280947 Ga0496124_0280947_204_779 188
389 3300048928 Ga0496125_0062096 Ga0496125_0062096_316_882 188
390 3300048928 Ga0496125_0148717 Ga0496125_0148717_482_1057 188
391 3300049130 Ga0501310_003256 Ga0501310_003256_159_725 188
392 3300049523 Ga0501300_008000 Ga0501300_008000_891_1457 188
393 3300049571 Ga0501034_0746850 Ga0501034_0746850_24_590 188
394 3300049579 Ga0501043_0145614 Ga0501043_0145614_692_1267 188
395 3300049579 Ga0501043_0486826 Ga0501043_0486826_260_835 188
396 3300049581 Ga0501047_0236549 Ga0501047_0236549_737_1312 188
397 3300049581 Ga0501047_0479536 Ga0501047_0479536_335_910 188
398 3300049582 Ga0501048_0471770 Ga0501048_0471770_174_749 188
399 3300049583 Ga0501067_0295755 Ga0501067_0295755_294_869 188
400 3300049584 Ga0501068_0050921 Ga0501068_0050921_1464_2045 188
401 3300049584 Ga0501068_0320457 Ga0501068_0320457_61_627 188
402 3300049584 Ga0501068_0408890 Ga0501068_0408890_44_619 188
403 3300049585 Ga0501069_0052577 Ga0501069_0052577_340_906 188
404 3300049586 Ga0501070_0000029 Ga0501070_0000029_85309_85881 188
405 3300049586 Ga0501070_0049552 Ga0501070_0049552_2480_3055 188
406 3300049586 Ga0501070_0051906 Ga0501070_0051906_1137_1718 188
407 3300049587 Ga0501071_0177277 Ga0501071_0177277_770_1345 188
408 3300049587 Ga0501071_1029949 Ga0501071_1029949_18_599 188
409 3300049589 Ga0501073_0002398 Ga0501073_0002398_12999_13571 188
410 3300049589 Ga0501073_0025790 Ga0501073_0025790_624_1205 188
411 3300049590 Ga0501074_0009980 Ga0501074_0009980_1567_2148 188
412 3300049590 Ga0501074_0094971 Ga0501074_0094971_1119_1691 188
413 3300049661 Ga0501217_011439 Ga0501217_011439_1249_1815 188
414 3300049671 Ga0501238_003936 Ga0501238_003936_1031_1597 188
415 3300049741 Ga0501079_0052653 Ga0501079_0052653_1194_1769 188
416 3300049741 Ga0501079_0238291 Ga0501079_0238291_663_1235 188
417 3300049741 Ga0501079_0249639 Ga0501079_0249639_409_990 188
418 3300049742 Ga0501080_0006875 Ga0501080_0006875_6108_6683 188
419 3300049742 Ga0501080_0007826 Ga0501080_0007826_3211_3792 188
420 3300049742 Ga0501080_0126439 Ga0501080_0126439_569_1135 188
421 3300049742 Ga0501080_0194530 Ga0501080_0194530_433_1008 188
422 3300049742 Ga0501080_0953880 Ga0501080_0953880_146_718 188
423 3300049744 Ga0501083_0001714 Ga0501083_0001714_11279_11851 188
424 3300049744 Ga0501083_0006953 Ga0501083_0006953_1933_2514 188
425 3300049744 Ga0501083_0060531 Ga0501083_0060531_1472_2047 188
426 3300049853 Ga0501226_004919 Ga0501226_004919_847_1413 188
427 3300053139 Ga0500568_0000436 Ga0500568_0000436_23530_24096 188
428 3300053139 Ga0500568_0123550 Ga0500568_0123550_166_732 188
429 3300054114 Ga0501084_0180482 Ga0501084_0180482_540_1121 188
430 3300054114 Ga0501084_0663404 Ga0501084_0663404_214_789 188
431 3300060353 Ga0501082_0005048 Ga0501082_0005048_6746_7327 188
432 3300060353 Ga0501082_0020207 Ga0501082_0020207_3483_4055 188
433 3300003763 Ga0055529_1001765 Ga0055529_10017653 189
434 3300005262 Ga0065165_1002490 Ga0065165_100249014 189
435 3300005327 Ga0070658_10134475 Ga0070658_101344752 189
436 3300005327 Ga0070658_10534785 Ga0070658_105347852 189
437 3300005336 Ga0070680_100000084 Ga0070680_10000008429 189
438 3300005341 Ga0070691_10002328 Ga0070691_100023285 189
439 3300005344 Ga0070661_100692719 Ga0070661_1006927191 189
440 3300005345 Ga0070692_10217600 Ga0070692_102176002 189
441 3300005356 Ga0070674_100297715 Ga0070674_1002977152 189
442 3300005367 Ga0070667_100522837 Ga0070667_1005228371 189
443 3300005434 Ga0070709_10007167 Ga0070709_100071675 189
444 3300005435 Ga0070714_100023481 Ga0070714_1000234816 189
445 3300005436 Ga0070713_100000121 Ga0070713_10000012149 189
446 3300005440 Ga0070705_100294385 Ga0070705_1002943852 189
447 3300005455 Ga0070663_100706325 Ga0070663_1007063251 189
448 3300005458 Ga0070681_10000001 Ga0070681_10000001555 189
449 3300005530 Ga0070679_100000211 Ga0070679_1000002114 189
450 3300005535 Ga0070684_100337959 Ga0070684_1003379592 189
451 3300005539 Ga0068853_100005255 Ga0068853_10000525511 189
452 3300005539 Ga0068853_100350248 Ga0068853_1003502482 189
453 3300005545 Ga0070695_100006141 Ga0070695_1000061419 189
454 3300005546 Ga0070696_100822551 Ga0070696_1008225511 189
455 3300005547 Ga0070693_100041131 Ga0070693_1000411315 189
456 3300005548 Ga0070665_100029417 Ga0070665_1000294175 189
457 3300005548 Ga0070665_100445071 Ga0070665_1004450712 189
458 3300005563 Ga0068855_100336119 Ga0068855_1003361192 189
459 3300005563 Ga0068855_100415225 Ga0068855_1004152252 189
460 3300005577 Ga0068857_100050176 Ga0068857_1000501763 189
461 3300005577 Ga0068857_100597731 Ga0068857_1005977312 189
462 3300005578 Ga0068854_100045814 Ga0068854_1000458142 189
463 3300005578 Ga0068854_100393096 Ga0068854_1003930962 189
464 3300005614 Ga0068856_100000497 Ga0068856_10000049710 189
465 3300005614 Ga0068856_100001104 Ga0068856_10000110426 189
466 3300005614 Ga0068856_100103190 Ga0068856_1001031904 189
467 3300005614 Ga0068856_100457618 Ga0068856_1004576182 189
468 3300005842 Ga0068858_100022763 Ga0068858_1000227635 189
469 3300005842 Ga0068858_100395669 Ga0068858_1003956692 189
470 3300005843 Ga0068860_100069966 Ga0068860_1000699664 189
471 3300006038 Ga0075365_10008092 Ga0075365_100080923 189
472 3300006038 Ga0075365_10022752 Ga0075365_100227522 189
473 3300006038 Ga0075365_10133630 Ga0075365_101336302 189
474 3300006038 Ga0075365_10228554 Ga0075365_102285542 189
475 3300006038 Ga0075365_10552867 Ga0075365_105528671 189
476 3300006051 Ga0075364_10135445 Ga0075364_101354452 189
477 3300006051 Ga0075364_10153855 Ga0075364_101538551 189
478 3300006173 Ga0070716_100034675 Ga0070716_1000346752 189
479 3300006175 Ga0070712_100001870 Ga0070712_1000018709 189
480 3300006175 Ga0070712_100007861 Ga0070712_1000078615 189
481 3300006177 Ga0075362_10371273 Ga0075362_103712731 189
482 3300006178 Ga0075367_10111931 Ga0075367_101119312 189
483 3300006178 Ga0075367_10362619 Ga0075367_103626191 189
484 3300006237 Ga0097621_101452061 Ga0097621_1014520611 189
485 3300006353 Ga0075370_10134098 Ga0075370_101340982 189
486 3300006871 Ga0075434_100061761 Ga0075434_1000617613 189
487 3300006881 Ga0068865_100236011 Ga0068865_1002360112 189
488 3300006914 Ga0075436_100000720 Ga0075436_10000072010 189
489 3300006914 Ga0075436_100005085 Ga0075436_1000050859 189
490 3300006946 Ga0079104_1000015 Ga0079104_100001596 189
491 3300007076 Ga0075435_100288332 Ga0075435_1002883322 189
492 3300009093 Ga0105240_10331478 Ga0105240_103314782 189
493 3300009098 Ga0105245_10738282 Ga0105245_107382822 189
494 3300009148 Ga0105243_10522164 Ga0105243_105221642 189
495 3300009174 Ga0105241_10277567 Ga0105241_102775672 189
496 3300009545 Ga0105237_10006681 Ga0105237_100066817 189
497 3300009545 Ga0105237_10094540 Ga0105237_100945401 189
498 3300009551 Ga0105238_10009161 Ga0105238_100091617 189
499 3300010375 Ga0105239_10196692 Ga0105239_101966922 189
500 3300010375 Ga0105239_10877570 Ga0105239_108775702 189
501 3300013100 Ga0157373_10004706 Ga0157373_100047069 189
502 3300013104 Ga0157370_10000726 Ga0157370_100007261 189
503 3300013105 Ga0157369_10003048 Ga0157369_100030486 189
504 3300013105 Ga0157369_10088602 Ga0157369_100886022 189
505 3300013296 Ga0157374_10537397 Ga0157374_105373971 189
506 3300013297 Ga0157378_11180109 Ga0157378_111801092 189
507 3300013306 Ga0163162_10124212 Ga0163162_101242123 189
508 3300013306 Ga0163162_10677947 Ga0163162_106779472 189
509 3300013308 Ga0157375_11286390 Ga0157375_112863901 189
510 3300014325 Ga0163163_10536821 Ga0163163_105368212 189
511 3300014497 Ga0182008_10019963 Ga0182008_100199632 189
512 3300014497 Ga0182008_10170103 Ga0182008_101701031 189
513 3300014968 Ga0157379_10006090 Ga0157379_100060908 189
514 3300014968 Ga0157379_10009377 Ga0157379_1000937710 189
515 3300014968 Ga0157379_10019447 Ga0157379_100194478 189
516 3300014969 Ga0157376_10356367 Ga0157376_103563671 189
517 3300015261 Ga0182006_1088117 Ga0182006_10881172 189
518 3300022467 Ga0224712_10069545 Ga0224712_100695452 189
519 3300025254 Ga0209148_1000032 Ga0209148_1000032324 189
520 3300025254 Ga0209148_1006034 Ga0209148_10060341 189
521 3300025272 Ga0209455_1000235 Ga0209455_100023559 189
522 3300025906 Ga0207699_10005327 Ga0207699_100053276 189
523 3300025906 Ga0207699_10132920 Ga0207699_101329201 189
524 3300025907 Ga0207645_10081036 Ga0207645_100810361 189
525 3300025909 Ga0207705_10125703 Ga0207705_101257032 189
526 3300025911 Ga0207654_10363649 Ga0207654_103636492 189
527 3300025912 Ga0207707_10000001 Ga0207707_10000001239 189
528 3300025913 Ga0207695_10140718 Ga0207695_101407183 189
529 3300025913 Ga0207695_10210451 Ga0207695_102104512 189
530 3300025913 Ga0207695_10786428 Ga0207695_107864282 189
531 3300025914 Ga0207671_10128703 Ga0207671_101287032 189
532 3300025914 Ga0207671_10246164 Ga0207671_102461642 189
533 3300025915 Ga0207693_10002910 Ga0207693_100029109 189
534 3300025915 Ga0207693_10006853 Ga0207693_100068535 189
535 3300025916 Ga0207663_10103240 Ga0207663_101032402 189
536 3300025917 Ga0207660_10000665 Ga0207660_1000066524 189
537 3300025919 Ga0207657_10298426 Ga0207657_102984261 189
538 3300025921 Ga0207652_10000363 Ga0207652_100003632 189
539 3300025921 Ga0207652_10283382 Ga0207652_102833822 189
540 3300025924 Ga0207694_10013789 Ga0207694_100137897 189
541 3300025924 Ga0207694_10548451 Ga0207694_105484511 189
542 3300025928 Ga0207700_10000972 Ga0207700_1000097217 189
543 3300025929 Ga0207664_10146300 Ga0207664_101463002 189
544 3300025933 Ga0207706_10561918 Ga0207706_105619182 189
545 3300025935 Ga0207709_10202432 Ga0207709_102024322 189
546 3300025937 Ga0207669_10066733 Ga0207669_100667332 189
547 3300025937 Ga0207669_10558116 Ga0207669_105581161 189
548 3300025938 Ga0207704_10110643 Ga0207704_101106432 189
549 3300025939 Ga0207665_10024569 Ga0207665_100245696 189
550 3300025942 Ga0207689_10023487 Ga0207689_100234872 189
551 3300025945 Ga0207679_10114199 Ga0207679_101141992 189
552 3300025949 Ga0207667_10003097 Ga0207667_1000309717 189
553 3300025960 Ga0207651_10413690 Ga0207651_104136902 189
554 3300025972 Ga0207668_10576174 Ga0207668_105761742 189
555 3300025981 Ga0207640_10294523 Ga0207640_102945232 189
556 3300025986 Ga0207658_10263590 Ga0207658_102635902 189
557 3300026035 Ga0207703_10283135 Ga0207703_102831352 189
558 3300026041 Ga0207639_10499416 Ga0207639_104994162 189
559 3300026067 Ga0207678_10545841 Ga0207678_105458412 189
560 3300026078 Ga0207702_10000182 Ga0207702_1000018214 189
561 3300026078 Ga0207702_10109063 Ga0207702_101090632 189
562 3300026078 Ga0207702_10308478 Ga0207702_103084782 189
563 3300026089 Ga0207648_10038561 Ga0207648_100385613 189
564 3300026116 Ga0207674_10000003 Ga0207674_1000000391 189
565 3300026116 Ga0207674_10293323 Ga0207674_102933232 189
566 3300026118 Ga0207675_101154430 Ga0207675_1011544301 189
567 3300026142 Ga0207698_10247023 Ga0207698_102470232 189
568 3300027111 Ga0209281_1000034 Ga0209281_1000034371 189
569 3300028794 Ga0307515_10000135 Ga0307515_1000013543 189
570 3300028794 Ga0307515_10607983 Ga0307515_106079832 189
571 3300028800 Ga0265338_10077160 Ga0265338_100771604 189
572 3300028800 Ga0265338_10734726 Ga0265338_107347261 189
573 3300029957 Ga0265324_10120647 Ga0265324_101206471 189
574 3300031250 Ga0265331_10032315 Ga0265331_100323154 189
575 3300031344 Ga0265316_10142424 Ga0265316_101424242 189
576 3300031595 Ga0265313_10043077 Ga0265313_100430772 189
577 3300031649 Ga0307514_10032680 Ga0307514_100326802 189
578 3300031711 Ga0265314_10088148 Ga0265314_100881483 189
579 3300035111 Ga0373923_0318477 Ga0373923_0318477_23_604 189
580 3300035692 Ga0373935_0116171 Ga0373935_0116171_143_724 189
581 3300036401 Ga0373937_0115038 Ga0373937_0115038_1394_1975 189
582 3300036401 Ga0373937_0142087 Ga0373937_0142087_1615_2196 189
583 3300037068 Ga0373925_0083414 Ga0373925_0083414_27_608 189
584 3300046460 Ga0495638_0055367 Ga0495638_0055367_1070_1639 189
585 3300046472 Ga0495580_0203140 Ga0495580_0203140_726_1307 189
586 3300046500 Ga0495596_0117712 Ga0495596_0117712_52_621 189
587 3300046501 Ga0495607_0112652 Ga0495607_0112652_466_1035 189
588 3300046512 Ga0495610_0097193 Ga0495610_0097193_677_1246 189
589 3300046515 Ga0495620_0061259 Ga0495620_0061259_12_581 189
590 3300046519 Ga0495632_0060453 Ga0495632_0060453_437_1006 189
591 3300046522 Ga0495643_0021764 Ga0495643_0021764_1383_1952 189
592 3300046522 Ga0495643_0079222 Ga0495643_0079222_934_1503 189
593 3300046616 Ga0495668_0016973 Ga0495668_0016973_1659_2228 189
594 3300046679 Ga0495623_0173937 Ga0495623_0173937_115_696 189
595 3300047444 Ga0495675_0081926 Ga0495675_0081926_751_1329 189
596 3300047472 Ga0495686_0264890 Ga0495686_0264890_274_843 189
597 3300047472 Ga0495686_0349062 Ga0495686_0349062_35_646 189
598 3300048091 Ga0495626_0104020 Ga0495626_0104020_653_1222 189
599 3300048914 Ga0496111_0382284 Ga0496111_0382284_256_837 189
600 3300048915 Ga0496112_0071701 Ga0496112_0071701_1365_1934 189
601 3300048916 Ga0496113_0485546 Ga0496113_0485546_380_949 189
602 3300048922 Ga0496119_0083930 Ga0496119_0083930_185_754 189
603 3300048923 Ga0496120_0047499 Ga0496120_0047499_217_828 189
604 3300048924 Ga0496121_0028932 Ga0496121_0028932_4304_4873 189
605 3300048925 Ga0496122_0000462 Ga0496122_0000462_43367_43936 189
606 3300048926 Ga0496123_0000048 Ga0496123_0000048_40611_41180 189
607 3300048927 Ga0496124_0129217 Ga0496124_0129217_1279_1848 189
608 3300048929 Ga0496126_0001325 Ga0496126_0001325_36488_37075 189
609 3300049568 Ga0501031_0283423 Ga0501031_0283423_74_643 189
610 3300049571 Ga0501034_0089094 Ga0501034_0089094_472_1047 189
611 3300049571 Ga0501034_0164635 Ga0501034_0164635_1538_2119 189
612 3300049573 Ga0501037_0286873 Ga0501037_0286873_432_1013 189
613 3300049579 Ga0501043_0082976 Ga0501043_0082976_1384_1965 189
614 3300049581 Ga0501047_0007507 Ga0501047_0007507_8222_8803 189
615 3300049582 Ga0501048_0121656 Ga0501048_0121656_1182_1763 189
616 3300049583 Ga0501067_0004466 Ga0501067_0004466_3384_3965 189
617 3300049583 Ga0501067_0017381 Ga0501067_0017381_2847_3461 189
618 3300049585 Ga0501069_0072901 Ga0501069_0072901_1302_1883 189
619 3300049586 Ga0501070_0007754 Ga0501070_0007754_7129_7710 189
620 3300049586 Ga0501070_0085394 Ga0501070_0085394_494_1063 189
621 3300049588 Ga0501072_0026799 Ga0501072_0026799_1057_1671 189
622 3300049589 Ga0501073_0007762 Ga0501073_0007762_3288_3869 189
623 3300049590 Ga0501074_0054892 Ga0501074_0054892_1415_1996 189
624 3300049590 Ga0501074_0329389 Ga0501074_0329389_146_760 189
625 3300049741 Ga0501079_0001199 Ga0501079_0001199_8284_8865 189
626 3300049742 Ga0501080_0164827 Ga0501080_0164827_50_631 189
627 3300049742 Ga0501080_0497348 Ga0501080_0497348_110_679 189
628 3300049767 Ga0501270_033293 Ga0501270_033293_51_620 189
629 3300049822 Ga0501035_0000859 Ga0501035_0000859_9469_10038 189
630 3300049822 Ga0501035_0007925 Ga0501035_0007925_8091_8672 189
631 3300049822 Ga0501035_0099079 Ga0501035_0099079_341_919 189
632 3300049823 Ga0501044_0012882 Ga0501044_0012882_7001_7582 189
633 3300049823 Ga0501044_0164723 Ga0501044_0164723_785_1354 189
634 3300050491 nmdc:mga00v17_374632_c1 nmdc:mga00v17_374632_c1_167_736 189
635 3300050491 nmdc:mga00v17_55880_c1 nmdc:mga00v17_55880_c1_854_1423 189
636 3300050492 nmdc:mga0yw44_512173_c1 nmdc:mga0yw44_512173_c1_149_718 189
637 3300050493 nmdc:mga0k408_470064_c1 nmdc:mga0k408_470064_c1_49_618 189
638 3300050512 nmdc:mga0n895_22304_c1 nmdc:mga0n895_22304_c1_4495_5076 189
639 3300050513 nmdc:mga0rr50_277539_c1 nmdc:mga0rr50_277539_c1_580_1161 189
640 3300050514 nmdc:mga08x19_89_c1 nmdc:mga08x19_89_c1_74520_75101 189
641 3300053079 Ga0500610_0023027 Ga0500610_0023027_1289_1858 189
642 3300053083 Ga0495655_0011775 Ga0495655_0011775_493_1062 189
643 3300053086 Ga0500578_0595362 Ga0500578_0595362_18_587 189
644 3300053125 Ga0500618_035559 Ga0500618_035559_266_835 189
645 3300053133 Ga0500655_007157 Ga0500655_007157_552_1121 189
646 3300053151 Ga0500604_0045268 Ga0500604_0045268_348_917 189
647 3300053727 Ga0500611_020812 Ga0500611_020812_324_893 189
648 3300054114 Ga0501084_0105471 Ga0501084_0105471_864_1445 189
649 3300060353 Ga0501082_0156508 Ga0501082_0156508_1294_1908 189
650 3300060353 Ga0501082_0876877 Ga0501082_0876877_177_758 189
651 iso_pu_bacteria 2503198000 2503198310 189
652 iso_pu_bacteria 637000159 637077366 189
653 3300003214 JGI25165J46597_1000147 JGI25165J46597_1000147100 190
654 3300003214 JGI25165J46597_1000206 JGI25165J46597_100020680 190
655 3300003322 rootL2_10117744 rootL2_101177442 190
656 3300005367 Ga0070667_100393315 Ga0070667_1003933153 190
657 3300005458 Ga0070681_10221711 Ga0070681_102217113 190
658 3300005535 Ga0070684_100284844 Ga0070684_1002848442 190
659 3300005539 Ga0068853_100022594 Ga0068853_1000225942 190
660 3300005614 Ga0068856_100092115 Ga0068856_1000921153 190
661 3300005616 Ga0068852_101063193 Ga0068852_1010631931 190
662 3300009093 Ga0105240_10096531 Ga0105240_100965312 190
663 3300009174 Ga0105241_10585030 Ga0105241_105850302 190
664 3300009545 Ga0105237_10064036 Ga0105237_100640362 190
665 3300009545 Ga0105237_10461265 Ga0105237_104612652 190
666 3300009551 Ga0105238_10009675 Ga0105238_100096753 190
667 3300010375 Ga0105239_10076398 Ga0105239_100763983 190
668 3300010375 Ga0105239_10236593 Ga0105239_102365932 190
669 3300010375 Ga0105239_10764425 Ga0105239_107644251 190
670 3300013105 Ga0157369_10306827 Ga0157369_103068272 190
671 3300025261 Ga0209233_1000034 Ga0209233_1000034100 190
672 3300025294 Ga0209025_1085908 Ga0209025_10859081 190
673 3300025904 Ga0207647_10019675 Ga0207647_100196752 190
674 3300025911 Ga0207654_10460724 Ga0207654_104607242 190
675 3300025912 Ga0207707_10384779 Ga0207707_103847792 190
676 3300025913 Ga0207695_10216764 Ga0207695_102167642 190
677 3300025914 Ga0207671_10022974 Ga0207671_100229742 190
678 3300025914 Ga0207671_10292990 Ga0207671_102929901 190
679 3300025924 Ga0207694_10003257 Ga0207694_100032576 190
680 3300025944 Ga0207661_10736880 Ga0207661_107368802 190
681 3300026041 Ga0207639_10003680 Ga0207639_1000368010 190
682 3300026078 Ga0207702_10899645 Ga0207702_108996451 190
683 3300026116 Ga0207674_10322230 Ga0207674_103222302 190
684 3300026142 Ga0207698_10082986 Ga0207698_100829862 190
685 3300028800 Ga0265338_10012850 Ga0265338_100128509 190
686 3300029957 Ga0265324_10034856 Ga0265324_100348561 190
687 3300031238 Ga0265332_10019146 Ga0265332_100191463 190
688 3300031241 Ga0265325_10066570 Ga0265325_100665702 190
689 3300031242 Ga0265329_10163114 Ga0265329_101631141 190
690 3300031249 Ga0265339_10002104 Ga0265339_1000210415 190
691 3300031344 Ga0265316_10091967 Ga0265316_100919671 190
692 3300031595 Ga0265313_10005068 Ga0265313_100050682 190
693 3300037418 Ga0395900_0161871 Ga0395900_0161871_153_725 190
694 3300037471 Ga0395905_0103611 Ga0395905_0103611_1994_2566 190
695 3300037471 Ga0395905_0285902 Ga0395905_0285902_379_960 190
696 3300037471 Ga0395905_0310119 Ga0395905_0310119_425_997 190
697 3300038443 Ga0395901_0046061 Ga0395901_0046061_313_885 190
698 3300044658 Ga0466972_0148224 Ga0466972_0148224_254_826 190
699 3300044683 Ga0466965_0082735 Ga0466965_0082735_727_1299 190
700 3300044765 Ga0466970_0225636 Ga0466970_0225636_288_860 190
701 3300044901 Ga0466960_0365316 Ga0466960_0365316_138_710 190
702 3300048905 Ga0496102_0400423 Ga0496102_0400423_709_1281 190
703 3300048906 Ga0496103_0288867 Ga0496103_0288867_331_903 190
704 3300048915 Ga0496112_0121106 Ga0496112_0121106_1255_1827 190
705 3300048922 Ga0496119_0199566 Ga0496119_0199566_280_852 190
706 3300048923 Ga0496120_0005277 Ga0496120_0005277_6519_7091 190
707 3300048927 Ga0496124_0391585 Ga0496124_0391585_222_794 190
708 3300048928 Ga0496125_0028346 Ga0496125_0028346_1130_1702 190
709 3300050494 nmdc:mga06z11_98647_c1 nmdc:mga06z11_98647_c1_630_1202 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

40

188

0.95

PF02525

Flavodoxin_2

Flavodoxin-like fold

40

168

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8745 6 182
2q62-assembly1.cif.gz_D crystal structure of arsh from sinorhizobium meliloti 0.8634 2 180
3gfs-assembly1.cif.gz_A structure of yhda, k109d/d137k variant 0.8629 6 181
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8619 6 182
2gsw-assembly2.cif.gz_D crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 0.8601 6 182
ID Description Score Start End Superfamily
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8654 7 182 3.40.50.360
af_Q54QT4_9_187_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.864 5 173 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8538 4 168 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8519 3 184 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8509 3 189 3.40.50.360
ID Description Score Start End GO Terms
AF-F7Y0G5-F1-model_v4 NADPH-dependent FMN reductase 0.9943 2 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A6M7V943-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9938 1 188 GO:0005829
GO:0010181
GO:0016491
AF-V7HJH4-F1-model_v4 NADPH-dependent FMN reductase 0.9938 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A4R9Z2D4-F1-model_v4 deleted 0.9936 1 188
AF-A0A4S0SGF3-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9935 1 188 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.4 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map