F476655
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 709 | 494 | 463 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300025949|Ga0207667_10423691|Ga0207667_104236912 |
| Length | 224 |
| Sequence | MLIGFPGYVRRKLATLLELSTGAENAAVRGPKSAKGRRMSKLSVIIASTRPGRVGLPVGQWFFEQAKRHGKFDVELVDLKDRNLPLLDEPHHPRLRKYEHEHTKAWSAIVQASDAFVFVTPEYNYSVAPSLLNALDYVFHEWAYKAAGIVSYGGISGGMRSAQMLRQTLSVLKVVPLPEAVTIQFATQLLEDGVFRGSEPLEKAAVTMLDELFRWTDALAVLRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 9 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 10 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 11 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 12 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 13 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 14 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 15 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 16 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 17 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 18 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 19 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 20 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 21 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 22 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 23 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 24 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 25 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 26 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 27 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 28 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 29 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 30 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 31 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 32 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 33 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 34 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 35 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 36 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 37 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 38 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 39 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 40 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 41 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 42 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 43 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 44 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 45 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 46 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 47 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 48 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 49 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 50 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 51 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 52 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 53 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 54 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 55 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 56 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 57 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 58 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 59 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 60 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 61 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 62 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 63 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 64 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 65 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 66 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 67 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 68 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 69 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 70 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 71 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 72 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 73 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 74 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 75 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 76 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 77 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 78 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 79 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 80 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 81 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 82 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 83 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 84 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 85 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 86 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 87 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 88 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 89 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 90 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 91 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 92 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 93 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 94 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 95 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 96 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 97 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 98 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 99 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 100 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 101 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 102 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 103 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 104 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 105 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 106 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 107 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 108 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 109 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 110 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 111 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 112 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 113 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 114 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 115 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 116 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 117 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 118 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 119 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 120 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 121 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 122 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 123 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 124 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 125 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 126 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 127 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 128 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 129 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 130 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 131 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 132 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 133 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 134 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 135 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 136 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 137 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 138 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 139 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 140 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 141 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 142 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 143 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 144 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 145 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 146 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 147 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 148 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 149 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 150 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 151 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 152 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 153 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 154 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 155 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 156 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 157 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 158 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 159 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 160 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 161 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 162 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 163 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 164 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 165 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 166 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 167 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 168 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 169 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 170 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 171 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 172 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 173 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 174 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 175 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 176 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 177 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 178 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 179 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 180 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 181 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 182 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 183 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 184 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 185 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 186 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 187 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 188 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 189 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 190 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 191 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 192 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 193 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 194 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 195 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 196 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 197 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 198 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 199 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 200 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 201 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 202 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 203 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 204 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 205 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 206 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 207 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 208 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 209 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 210 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 211 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 212 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 213 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 214 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 215 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 216 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 217 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 218 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 219 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 220 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 221 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 222 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 223 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 224 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 225 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 226 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 227 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 228 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 229 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 230 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 231 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 232 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 233 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 234 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 235 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 236 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 237 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 238 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 239 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 240 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 241 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 243 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 245 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 248 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 253 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 256 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 257 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 259 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 265 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 266 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 267 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 268 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 269 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 270 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 271 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 272 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 273 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 274 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 275 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 276 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 277 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 279 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 280 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 281 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 282 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 283 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 284 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 285 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 286 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 287 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 288 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 289 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 290 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 293 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 294 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 295 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 296 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 297 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 298 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 299 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 300 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 302 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 305 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 307 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 308 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 310 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 311 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 312 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 313 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 314 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 315 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 316 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 357 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 359 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 360 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 361 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 362 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 363 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 364 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 365 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 366 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 367 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 368 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 369 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 370 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 371 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 372 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 373 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 374 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 375 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 376 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 377 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 378 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 379 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 381 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 382 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 383 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 384 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 385 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 386 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 387 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 388 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 389 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 390 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 391 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 392 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 393 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 416 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 417 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 418 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 419 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 420 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 421 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 422 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 423 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 424 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 425 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 426 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 427 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 428 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 429 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 431 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 443 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 453 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 454 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 458 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 460 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 461 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 462 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 463 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 464 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 465 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 466 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 470 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 472 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 474 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 475 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 477 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 478 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 479 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 480 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 483 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 484 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 485 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 486 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 487 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 488 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 489 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 490 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 491 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 492 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 493 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 494 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 65.02 |
| Metatranscriptomes | 0.28 |
| Isolates | 34.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.63 |
| Nodule | 30.32 |
| Rhizoplane | 1.55 |
| Rhizosphere | 52.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000147 | 3300003214 | Bacteria | 116564 |
| 2 | JGI25165J46597_1000206 | 3300003214 | Bacteria | 84821 |
| 3 | rootH2_10092887 | 3300003320 | Bacteria | 1668 |
| 4 | rootL2_10117744 | 3300003322 | Bacteria | 1201 |
| 5 | rootH1_10160586 | 3300003323 | Bacteria | 4820 |
| 6 | rootH1_10312064 | 3300003323 | Bacteria | 5387 |
| 7 | Ga0055529_1001765 | 3300003763 | Bacteria | 5361 |
| 8 | Ga0055526_1019219 | 3300003771 | Bacteria | 2500 |
| 9 | Ga0055524_1000504 | 3300003775 | Bacteria | 30479 |
| 10 | Ga0055528_1000035 | 3300003790 | Bacteria | 117498 |
| 11 | Ga0065165_1002490 | 3300005262 | Bacteria | 15444 |
| 12 | Ga0070658_10134475 | 3300005327 | Bacteria | 2062 |
| 13 | Ga0070658_10534785 | 3300005327 | Bacteria | 1014 |
| 14 | Ga0070683_100034345 | 3300005329 | Bacteria | 4632 |
| 15 | Ga0070666_10009665 | 3300005335 | Bacteria | 6022 |
| 16 | Ga0070666_10084779 | 3300005335 | Bacteria | 2169 |
| 17 | Ga0070680_100000084 | 3300005336 | Bacteria | 51930 |
| 18 | Ga0070680_100345585 | 3300005336 | Bacteria | 1265 |
| 19 | Ga0070691_10002328 | 3300005341 | Bacteria | 8425 |
| 20 | Ga0070661_100395270 | 3300005344 | Bacteria | 1092 |
| 21 | Ga0070661_100692719 | 3300005344 | Bacteria | 830 |
| 22 | Ga0070692_10217600 | 3300005345 | Bacteria | 1127 |
| 23 | Ga0070674_100297715 | 3300005356 | Bacteria | 1285 |
| 24 | Ga0070667_100004911 | 3300005367 | Bacteria | 11203 |
| 25 | Ga0070667_100063380 | 3300005367 | Bacteria | 3132 |
| 26 | Ga0070667_100393315 | 3300005367 | Bacteria | 1261 |
| 27 | Ga0070667_100522837 | 3300005367 | Bacteria | 1089 |
| 28 | Ga0070709_10007167 | 3300005434 | Bacteria | 6106 |
| 29 | Ga0070714_100020316 | 3300005435 | Bacteria | 5421 |
| 30 | Ga0070714_100023481 | 3300005435 | Bacteria | 5068 |
| 31 | Ga0070713_100000121 | 3300005436 | Bacteria | 50650 |
| 32 | Ga0070705_100294385 | 3300005440 | Bacteria | 1160 |
| 33 | Ga0070663_100000968 | 3300005455 | Bacteria | 15595 |
| 34 | Ga0070663_100706325 | 3300005455 | Bacteria | 857 |
| 35 | Ga0070681_10000001 | 3300005458 | Bacteria | 946857 |
| 36 | Ga0070681_10156799 | 3300005458 | Bacteria | 2201 |
| 37 | Ga0070681_10221711 | 3300005458 | Bacteria | 1806 |
| 38 | Ga0070679_100000211 | 3300005530 | Bacteria | 47596 |
| 39 | Ga0070679_100024727 | 3300005530 | Bacteria | 5886 |
| 40 | Ga0070684_100284844 | 3300005535 | Bacteria | 1514 |
| 41 | Ga0070684_100337959 | 3300005535 | Bacteria | 1384 |
| 42 | Ga0068853_100005255 | 3300005539 | Bacteria | 10138 |
| 43 | Ga0068853_100008770 | 3300005539 | Bacteria | 8134 |
| 44 | Ga0068853_100022594 | 3300005539 | Bacteria | 5255 |
| 45 | Ga0068853_100350248 | 3300005539 | Bacteria | 1374 |
| 46 | Ga0070672_100000146 | 3300005543 | Bacteria | 38299 |
| 47 | Ga0070695_100006141 | 3300005545 | Bacteria | 7099 |
| 48 | Ga0070696_100822551 | 3300005546 | Unclassified | 766 |
| 49 | Ga0070693_100041131 | 3300005547 | Bacteria | 2599 |
| 50 | Ga0070665_100029417 | 3300005548 | Bacteria | 5529 |
| 51 | Ga0070665_100089160 | 3300005548 | Bacteria | 3090 |
| 52 | Ga0070665_100355410 | 3300005548 | Bacteria | 1471 |
| 53 | Ga0070665_100445071 | 3300005548 | Bacteria | 1305 |
| 54 | Ga0068855_100336119 | 3300005563 | Bacteria | 1666 |
| 55 | Ga0068855_100415225 | 3300005563 | Bacteria | 1473 |
| 56 | Ga0068857_100050176 | 3300005577 | Bacteria | 3702 |
| 57 | Ga0068857_100597731 | 3300005577 | Bacteria | 1043 |
| 58 | Ga0068854_100045814 | 3300005578 | Bacteria | 3111 |
| 59 | Ga0068854_100393096 | 3300005578 | Bacteria | 1145 |
| 60 | Ga0068856_100000497 | 3300005614 | Bacteria | 43608 |
| 61 | Ga0068856_100001104 | 3300005614 | Bacteria | 28526 |
| 62 | Ga0068856_100092115 | 3300005614 | Bacteria | 3015 |
| 63 | Ga0068856_100103190 | 3300005614 | Bacteria | 2845 |
| 64 | Ga0068856_100457618 | 3300005614 | Bacteria | 1297 |
| 65 | Ga0068856_100782977 | 3300005614 | Bacteria | 974 |
| 66 | Ga0068856_101199044 | 3300005614 | Bacteria | 775 |
| 67 | Ga0068852_100009705 | 3300005616 | Bacteria | 7153 |
| 68 | Ga0068852_100058403 | 3300005616 | Bacteria | 3342 |
| 69 | Ga0068852_101063193 | 3300005616 | Bacteria | 829 |
| 70 | Ga0068858_100022763 | 3300005842 | Bacteria | 5843 |
| 71 | Ga0068858_100395669 | 3300005842 | Bacteria | 1327 |
| 72 | Ga0068860_100069966 | 3300005843 | Bacteria | 3336 |
| 73 | Ga0075365_10008092 | 3300006038 | Bacteria | 5940 |
| 74 | Ga0075365_10022752 | 3300006038 | Bacteria | 3931 |
| 75 | Ga0075365_10133630 | 3300006038 | Bacteria | 1718 |
| 76 | Ga0075365_10228554 | 3300006038 | Bacteria | 1306 |
| 77 | Ga0075365_10552867 | 3300006038 | Bacteria | 814 |
| 78 | Ga0075364_10135445 | 3300006051 | Bacteria | 1654 |
| 79 | Ga0075364_10153855 | 3300006051 | Bacteria | 1550 |
| 80 | Ga0070716_100034675 | 3300006173 | Bacteria | 2769 |
| 81 | Ga0070712_100001870 | 3300006175 | Bacteria | 12848 |
| 82 | Ga0070712_100007861 | 3300006175 | Bacteria | 6681 |
| 83 | Ga0075362_10371273 | 3300006177 | Bacteria | 718 |
| 84 | Ga0075367_10111931 | 3300006178 | Bacteria | 1676 |
| 85 | Ga0075367_10362619 | 3300006178 | Bacteria | 915 |
| 86 | Ga0097621_101452061 | 3300006237 | Unclassified | 650 |
| 87 | Ga0075370_10134098 | 3300006353 | Bacteria | 1446 |
| 88 | Ga0075434_100061761 | 3300006871 | Bacteria | 3729 |
| 89 | Ga0068865_100236011 | 3300006881 | Bacteria | 1437 |
| 90 | Ga0075436_100000720 | 3300006914 | Bacteria | 21898 |
| 91 | Ga0075436_100005085 | 3300006914 | Bacteria | 9053 |
| 92 | Ga0079104_1000015 | 3300006946 | Bacteria | 321803 |
| 93 | Ga0075435_100288332 | 3300007076 | Bacteria | 1402 |
| 94 | Ga0105240_10096531 | 3300009093 | Bacteria | 3602 |
| 95 | Ga0105240_10331478 | 3300009093 | Bacteria | 1731 |
| 96 | Ga0105240_10909847 | 3300009093 | Bacteria | 946 |
| 97 | Ga0105245_10738282 | 3300009098 | Bacteria | 1020 |
| 98 | Ga0105247_10198525 | 3300009101 | Bacteria | 1347 |
| 99 | Ga0105243_10522164 | 3300009148 | Bacteria | 1129 |
| 100 | Ga0105241_10277567 | 3300009174 | Bacteria | 1430 |
| 101 | Ga0105241_10585030 | 3300009174 | Bacteria | 1006 |
| 102 | Ga0105237_10006681 | 3300009545 | Bacteria | 12750 |
| 103 | Ga0105237_10064036 | 3300009545 | Bacteria | 3674 |
| 104 | Ga0105237_10094540 | 3300009545 | Bacteria | 2978 |
| 105 | Ga0105237_10461265 | 3300009545 | Bacteria | 1276 |
| 106 | Ga0105238_10009161 | 3300009551 | Bacteria | 9910 |
| 107 | Ga0105238_10009675 | 3300009551 | Bacteria | 9649 |
| 108 | Ga0105239_10011411 | 3300010375 | Bacteria | 9910 |
| 109 | Ga0105239_10076398 | 3300010375 | Bacteria | 3684 |
| 110 | Ga0105239_10196692 | 3300010375 | Bacteria | 2258 |
| 111 | Ga0105239_10236593 | 3300010375 | Bacteria | 2050 |
| 112 | Ga0105239_10764425 | 3300010375 | Bacteria | 1106 |
| 113 | Ga0105239_10877570 | 3300010375 | Bacteria | 1029 |
| 114 | Ga0157373_10004706 | 3300013100 | Bacteria | 10262 |
| 115 | Ga0157371_10112424 | 3300013102 | Bacteria | 1933 |
| 116 | Ga0157370_10000726 | 3300013104 | Bacteria | 41325 |
| 117 | Ga0157370_10155938 | 3300013104 | Bacteria | 2124 |
| 118 | Ga0157370_10292337 | 3300013104 | Bacteria | 1505 |
| 119 | Ga0157370_10765199 | 3300013104 | Bacteria | 880 |
| 120 | Ga0157369_10003048 | 3300013105 | Bacteria | 19997 |
| 121 | Ga0157369_10088602 | 3300013105 | Bacteria | 3303 |
| 122 | Ga0157369_10306827 | 3300013105 | Bacteria | 1651 |
| 123 | Ga0157369_10324674 | 3300013105 | Bacteria | 1600 |
| 124 | Ga0157369_10397991 | 3300013105 | Bacteria | 1429 |
| 125 | Ga0157374_10537397 | 3300013296 | Bacteria | 1176 |
| 126 | Ga0157378_11180109 | 3300013297 | Unclassified | 804 |
| 127 | Ga0163162_10015754 | 3300013306 | Bacteria | 7390 |
| 128 | Ga0163162_10124212 | 3300013306 | Bacteria | 2687 |
| 129 | Ga0163162_10677947 | 3300013306 | Bacteria | 1153 |
| 130 | Ga0157375_10061972 | 3300013308 | Bacteria | 3715 |
| 131 | Ga0157375_11286390 | 3300013308 | Bacteria | 859 |
| 132 | Ga0163163_10536821 | 3300014325 | Bacteria | 1232 |
| 133 | Ga0163163_10684450 | 3300014325 | Bacteria | 1089 |
| 134 | Ga0182008_10019963 | 3300014497 | Bacteria | 3453 |
| 135 | Ga0182008_10170103 | 3300014497 | Bacteria | 1100 |
| 136 | Ga0157379_10006090 | 3300014968 | Bacteria | 10387 |
| 137 | Ga0157379_10009377 | 3300014968 | Bacteria | 8529 |
| 138 | Ga0157379_10019447 | 3300014968 | Bacteria | 5998 |
| 139 | Ga0157379_11440688 | 3300014968 | Bacteria | 669 |
| 140 | Ga0157376_10356367 | 3300014969 | Bacteria | 1402 |
| 141 | Ga0182006_1088117 | 3300015261 | Bacteria | 1121 |
| 142 | Ga0163161_10669882 | 3300017792 | Bacteria | 861 |
| 143 | Ga0224712_10069545 | 3300022467 | Bacteria | 1425 |
| 144 | Ga0209258_106168 | 3300025242 | Bacteria | 1916 |
| 145 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 146 | Ga0209148_1006034 | 3300025254 | Bacteria | 2677 |
| 147 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 148 | Ga0209455_1000235 | 3300025272 | Bacteria | 69582 |
| 149 | Ga0209673_1000220 | 3300025273 | Bacteria | 113086 |
| 150 | Ga0209130_1039409 | 3300025284 | Bacteria | 920 |
| 151 | Ga0209025_1085908 | 3300025294 | Bacteria | 1048 |
| 152 | Ga0209564_1000955 | 3300025295 | Bacteria | 36777 |
| 153 | Ga0209256_1000341 | 3300025299 | Bacteria | 76526 |
| 154 | Ga0207680_10001621 | 3300025903 | Bacteria | 10641 |
| 155 | Ga0207680_10069794 | 3300025903 | Bacteria | 2172 |
| 156 | Ga0207647_10019675 | 3300025904 | Bacteria | 4537 |
| 157 | Ga0207699_10005327 | 3300025906 | Bacteria | 6163 |
| 158 | Ga0207699_10132920 | 3300025906 | Bacteria | 1625 |
| 159 | Ga0207645_10081036 | 3300025907 | Bacteria | 2081 |
| 160 | Ga0207705_10125703 | 3300025909 | Bacteria | 1906 |
| 161 | Ga0207654_10363649 | 3300025911 | Bacteria | 999 |
| 162 | Ga0207654_10460724 | 3300025911 | Bacteria | 893 |
| 163 | Ga0207707_10000001 | 3300025912 | Bacteria | 1212482 |
| 164 | Ga0207707_10164350 | 3300025912 | Bacteria | 1940 |
| 165 | Ga0207707_10384779 | 3300025912 | Bacteria | 1206 |
| 166 | Ga0207695_10140718 | 3300025913 | Bacteria | 2362 |
| 167 | Ga0207695_10210451 | 3300025913 | Bacteria | 1855 |
| 168 | Ga0207695_10216764 | 3300025913 | Bacteria | 1822 |
| 169 | Ga0207695_10786428 | 3300025913 | Bacteria | 832 |
| 170 | Ga0207671_10022974 | 3300025914 | Bacteria | 4709 |
| 171 | Ga0207671_10128703 | 3300025914 | Bacteria | 1942 |
| 172 | Ga0207671_10246164 | 3300025914 | Bacteria | 1405 |
| 173 | Ga0207671_10292990 | 3300025914 | Bacteria | 1285 |
| 174 | Ga0207693_10002910 | 3300025915 | Bacteria | 14823 |
| 175 | Ga0207693_10006853 | 3300025915 | Bacteria | 9407 |
| 176 | Ga0207663_10103240 | 3300025916 | Bacteria | 1920 |
| 177 | Ga0207660_10000665 | 3300025917 | Bacteria | 22961 |
| 178 | Ga0207660_10149038 | 3300025917 | Bacteria | 1796 |
| 179 | Ga0207657_10298426 | 3300025919 | Bacteria | 1276 |
| 180 | Ga0207649_10930565 | 3300025920 | Bacteria | 682 |
| 181 | Ga0207652_10000363 | 3300025921 | Bacteria | 47059 |
| 182 | Ga0207652_10001986 | 3300025921 | Bacteria | 17698 |
| 183 | Ga0207652_10283382 | 3300025921 | Bacteria | 1495 |
| 184 | Ga0207694_10003257 | 3300025924 | Bacteria | 12933 |
| 185 | Ga0207694_10013789 | 3300025924 | Bacteria | 6093 |
| 186 | Ga0207694_10548451 | 3300025924 | Bacteria | 970 |
| 187 | Ga0207700_10000972 | 3300025928 | Bacteria | 16548 |
| 188 | Ga0207664_10082472 | 3300025929 | Bacteria | 2619 |
| 189 | Ga0207664_10146300 | 3300025929 | Bacteria | 2004 |
| 190 | Ga0207706_10561918 | 3300025933 | Bacteria | 982 |
| 191 | Ga0207709_10202432 | 3300025935 | Bacteria | 1419 |
| 192 | Ga0207669_10066733 | 3300025937 | Bacteria | 2239 |
| 193 | Ga0207669_10558116 | 3300025937 | Bacteria | 925 |
| 194 | Ga0207704_10110643 | 3300025938 | Bacteria | 1856 |
| 195 | Ga0207665_10024569 | 3300025939 | Bacteria | 3973 |
| 196 | Ga0207691_10000929 | 3300025940 | Bacteria | 29103 |
| 197 | Ga0207689_10023487 | 3300025942 | Bacteria | 5175 |
| 198 | Ga0207661_10006966 | 3300025944 | Bacteria | 8017 |
| 199 | Ga0207661_10736880 | 3300025944 | Bacteria | 907 |
| 200 | Ga0207679_10114199 | 3300025945 | Bacteria | 2138 |
| 201 | Ga0207667_10003097 | 3300025949 | Bacteria | 20583 |
| 202 | Ga0207667_10423691 | 3300025949 | Bacteria | 1354 |
| 203 | Ga0207651_10413690 | 3300025960 | Bacteria | 1150 |
| 204 | Ga0207668_10576174 | 3300025972 | Bacteria | 978 |
| 205 | Ga0207640_10294523 | 3300025981 | Bacteria | 1281 |
| 206 | Ga0207658_10006509 | 3300025986 | Bacteria | 7975 |
| 207 | Ga0207658_10176936 | 3300025986 | Bacteria | 1763 |
| 208 | Ga0207658_10263590 | 3300025986 | Bacteria | 1470 |
| 209 | Ga0207703_10283135 | 3300026035 | Bacteria | 1506 |
| 210 | Ga0207639_10003680 | 3300026041 | Bacteria | 10305 |
| 211 | Ga0207639_10227452 | 3300026041 | Bacteria | 1615 |
| 212 | Ga0207639_10499416 | 3300026041 | Bacteria | 1111 |
| 213 | Ga0207678_10002188 | 3300026067 | Bacteria | 17658 |
| 214 | Ga0207678_10142927 | 3300026067 | Bacteria | 2042 |
| 215 | Ga0207678_10545841 | 3300026067 | Bacteria | 1013 |
| 216 | Ga0207702_10000182 | 3300026078 | Bacteria | 75732 |
| 217 | Ga0207702_10109063 | 3300026078 | Bacteria | 2457 |
| 218 | Ga0207702_10308478 | 3300026078 | Bacteria | 1504 |
| 219 | Ga0207702_10899645 | 3300026078 | Bacteria | 877 |
| 220 | Ga0207702_11109069 | 3300026078 | Bacteria | 785 |
| 221 | Ga0207702_11113090 | 3300026078 | Bacteria | 784 |
| 222 | Ga0207648_10038561 | 3300026089 | Bacteria | 4204 |
| 223 | Ga0207674_10000003 | 3300026116 | Bacteria | 241674 |
| 224 | Ga0207674_10293323 | 3300026116 | Bacteria | 1575 |
| 225 | Ga0207674_10322230 | 3300026116 | Bacteria | 1495 |
| 226 | Ga0207675_101154430 | 3300026118 | Bacteria | 795 |
| 227 | Ga0207698_10069452 | 3300026142 | Bacteria | 2786 |
| 228 | Ga0207698_10082986 | 3300026142 | Bacteria | 2592 |
| 229 | Ga0207698_10247023 | 3300026142 | Bacteria | 1630 |
| 230 | Ga0209281_1000034 | 3300027111 | Bacteria | 382562 |
| 231 | Ga0268266_10000406 | 3300028379 | Bacteria | 65477 |
| 232 | Ga0265318_10061041 | 3300028577 | Bacteria | 1404 |
| 233 | Ga0307515_10000135 | 3300028794 | Bacteria | 175323 |
| 234 | Ga0307515_10392165 | 3300028794 | Bacteria | 1017 |
| 235 | Ga0307515_10607983 | 3300028794 | Bacteria | 704 |
| 236 | Ga0265338_10012850 | 3300028800 | Bacteria | 9516 |
| 237 | Ga0265338_10077160 | 3300028800 | Bacteria | 2818 |
| 238 | Ga0265338_10734726 | 3300028800 | Bacteria | 679 |
| 239 | Ga0265324_10034856 | 3300029957 | Unclassified | 1753 |
| 240 | Ga0265324_10120647 | 3300029957 | Bacteria | 890 |
| 241 | Ga0265332_10009365 | 3300031238 | Bacteria | 4374 |
| 242 | Ga0265332_10019146 | 3300031238 | Bacteria | 3022 |
| 243 | Ga0265320_10011465 | 3300031240 | Bacteria | 5215 |
| 244 | Ga0265325_10066570 | 3300031241 | Unclassified | 1816 |
| 245 | Ga0265329_10163114 | 3300031242 | Bacteria | 725 |
| 246 | Ga0265340_10162669 | 3300031247 | Bacteria | 1014 |
| 247 | Ga0265339_10002104 | 3300031249 | Bacteria | 14518 |
| 248 | Ga0265331_10009923 | 3300031250 | Bacteria | 5299 |
| 249 | Ga0265331_10032315 | 3300031250 | Bacteria | 2594 |
| 250 | Ga0265316_10019847 | 3300031344 | Bacteria | 5738 |
| 251 | Ga0265316_10091967 | 3300031344 | Unclassified | 2313 |
| 252 | Ga0265316_10142424 | 3300031344 | Bacteria | 1800 |
| 253 | Ga0265313_10005068 | 3300031595 | Bacteria | 9815 |
| 254 | Ga0265313_10043077 | 3300031595 | Bacteria | 2212 |
| 255 | Ga0307508_10413544 | 3300031616 | Bacteria | 940 |
| 256 | Ga0307514_10032680 | 3300031649 | Bacteria | 4160 |
| 257 | Ga0316575_10037339 | 3300031665 | Bacteria | 1913 |
| 258 | Ga0265314_10088148 | 3300031711 | Bacteria | 2027 |
| 259 | Ga0265314_10128814 | 3300031711 | Bacteria | 1581 |
| 260 | Ga0265342_10022458 | 3300031712 | Bacteria | 4010 |
| 261 | Ga0307414_10028478 | 3300032004 | Bacteria | 3625 |
| 262 | Ga0373923_0318477 | 3300035111 | Bacteria | 738 |
| 263 | Ga0373956_0363297 | 3300035119 | Bacteria | 690 |
| 264 | Ga0373935_0116171 | 3300035692 | Bacteria | 1782 |
| 265 | Ga0373937_0115038 | 3300036401 | Bacteria | 2504 |
| 266 | Ga0373937_0142087 | 3300036401 | Bacteria | 2246 |
| 267 | Ga0373925_0083414 | 3300037068 | Bacteria | 2434 |
| 268 | Ga0395900_0161871 | 3300037418 | Bacteria | 2282 |
| 269 | Ga0395900_0570482 | 3300037418 | Bacteria | 1074 |
| 270 | Ga0395905_0103611 | 3300037471 | Bacteria | 2671 |
| 271 | Ga0395905_0285902 | 3300037471 | Bacteria | 1536 |
| 272 | Ga0395905_0310119 | 3300037471 | Bacteria | 1466 |
| 273 | Ga0395901_0046061 | 3300038443 | Bacteria | 4529 |
| 274 | Ga0451789_0634181 | 3300041443 | Bacteria | 1699 |
| 275 | Ga0451807_0244631 | 3300041486 | Bacteria | 809 |
| 276 | Ga0451807_0783002 | 3300041486 | Bacteria | 3638 |
| 277 | Ga0466972_0148224 | 3300044658 | Bacteria | 1103 |
| 278 | Ga0466965_0082735 | 3300044683 | Bacteria | 1624 |
| 279 | Ga0466965_0317056 | 3300044683 | Bacteria | 849 |
| 280 | Ga0466970_0225636 | 3300044765 | Bacteria | 1046 |
| 281 | Ga0466960_0365316 | 3300044901 | Bacteria | 826 |
| 282 | Ga0466958_0129192 | 3300045836 | Bacteria | 1586 |
| 283 | Ga0466967_0975842 | 3300045976 | Bacteria | 843 |
| 284 | Ga0495638_0055367 | 3300046460 | Bacteria | 2463 |
| 285 | Ga0495651_0415451 | 3300046462 | Bacteria | 876 |
| 286 | Ga0495580_0203140 | 3300046472 | Bacteria | 1365 |
| 287 | Ga0495664_0099811 | 3300046477 | Bacteria | 1748 |
| 288 | Ga0495596_0117712 | 3300046500 | Bacteria | 1032 |
| 289 | Ga0495607_0112652 | 3300046501 | Bacteria | 1440 |
| 290 | Ga0495610_0097193 | 3300046512 | Bacteria | 1325 |
| 291 | Ga0495620_0061259 | 3300046515 | Bacteria | 1566 |
| 292 | Ga0495628_0528307 | 3300046516 | Bacteria | 849 |
| 293 | Ga0495632_0060453 | 3300046519 | Bacteria | 1841 |
| 294 | Ga0495643_0021764 | 3300046522 | Bacteria | 3670 |
| 295 | Ga0495643_0079222 | 3300046522 | Bacteria | 1713 |
| 296 | Ga0495654_0000758 | 3300046530 | Bacteria | 24982 |
| 297 | Ga0495587_0067596 | 3300046536 | Bacteria | 2083 |
| 298 | Ga0495645_0091891 | 3300046543 | Bacteria | 2167 |
| 299 | Ga0495668_0016973 | 3300046616 | Bacteria | 4228 |
| 300 | Ga0495623_0173937 | 3300046679 | Bacteria | 1256 |
| 301 | Ga0495672_0129214 | 3300047320 | Bacteria | 1331 |
| 302 | Ga0495675_0081926 | 3300047444 | Bacteria | 2032 |
| 303 | Ga0495686_0264890 | 3300047472 | Bacteria | 961 |
| 304 | Ga0495686_0349062 | 3300047472 | Bacteria | 805 |
| 305 | Ga0495626_0104020 | 3300048091 | Bacteria | 1235 |
| 306 | Ga0496102_0112455 | 3300048905 | Bacteria | 2540 |
| 307 | Ga0496102_0400423 | 3300048905 | Bacteria | 1291 |
| 308 | Ga0496103_0288867 | 3300048906 | Bacteria | 1055 |
| 309 | Ga0496111_0382284 | 3300048914 | Unclassified | 1041 |
| 310 | Ga0496112_0071701 | 3300048915 | Bacteria | 3424 |
| 311 | Ga0496112_0121106 | 3300048915 | Bacteria | 2586 |
| 312 | Ga0496113_0485546 | 3300048916 | Bacteria | 992 |
| 313 | Ga0496116_0002552 | 3300048919 | Bacteria | 19027 |
| 314 | Ga0496116_0076191 | 3300048919 | Bacteria | 2102 |
| 315 | Ga0496117_0000657 | 3300048920 | Bacteria | 55296 |
| 316 | Ga0496118_0015429 | 3300048921 | Bacteria | 7070 |
| 317 | Ga0496119_0083930 | 3300048922 | Bacteria | 1828 |
| 318 | Ga0496119_0199566 | 3300048922 | Bacteria | 1036 |
| 319 | Ga0496120_0005277 | 3300048923 | Bacteria | 10370 |
| 320 | Ga0496120_0047499 | 3300048923 | Bacteria | 2475 |
| 321 | Ga0496121_0001349 | 3300048924 | Bacteria | 41966 |
| 322 | Ga0496121_0028932 | 3300048924 | Bacteria | 5143 |
| 323 | Ga0496121_0030943 | 3300048924 | Bacteria | 4904 |
| 324 | Ga0496122_0000462 | 3300048925 | Bacteria | 84546 |
| 325 | Ga0496122_0009404 | 3300048925 | Bacteria | 10311 |
| 326 | Ga0496123_0000048 | 3300048926 | Bacteria | 244152 |
| 327 | Ga0496123_0062761 | 3300048926 | Bacteria | 2378 |
| 328 | Ga0496124_0004660 | 3300048927 | Bacteria | 15865 |
| 329 | Ga0496124_0008227 | 3300048927 | Bacteria | 10938 |
| 330 | Ga0496124_0013964 | 3300048927 | Bacteria | 7800 |
| 331 | Ga0496124_0129217 | 3300048927 | Bacteria | 2009 |
| 332 | Ga0496124_0169885 | 3300048927 | Bacteria | 1690 |
| 333 | Ga0496124_0280947 | 3300048927 | Bacteria | 1213 |
| 334 | Ga0496124_0391585 | 3300048927 | Bacteria | 968 |
| 335 | Ga0496125_0028346 | 3300048928 | Bacteria | 5061 |
| 336 | Ga0496125_0062096 | 3300048928 | Bacteria | 2991 |
| 337 | Ga0496125_0148717 | 3300048928 | Bacteria | 1614 |
| 338 | Ga0496126_0001325 | 3300048929 | Bacteria | 39349 |
| 339 | Ga0496126_0263675 | 3300048929 | Bacteria | 1432 |
| 340 | Ga0501310_003256 | 3300049130 | Bacteria | 1582 |
| 341 | Ga0501300_008000 | 3300049523 | Bacteria | 1550 |
| 342 | Ga0501031_0007354 | 3300049568 | Bacteria | 7178 |
| 343 | Ga0501031_0283423 | 3300049568 | Bacteria | 1075 |
| 344 | Ga0501032_0004327 | 3300049569 | Bacteria | 10724 |
| 345 | Ga0501033_0000411 | 3300049570 | Bacteria | 40975 |
| 346 | Ga0501033_0169718 | 3300049570 | Bacteria | 1567 |
| 347 | Ga0501034_0066799 | 3300049571 | Bacteria | 3609 |
| 348 | Ga0501034_0089094 | 3300049571 | Bacteria | 3083 |
| 349 | Ga0501034_0121713 | 3300049571 | Bacteria | 2595 |
| 350 | Ga0501034_0164635 | 3300049571 | Bacteria | 2187 |
| 351 | Ga0501034_0311838 | 3300049571 | Bacteria | 1507 |
| 352 | Ga0501034_0746850 | 3300049571 | Bacteria | 874 |
| 353 | Ga0501036_0008520 | 3300049572 | Bacteria | 8405 |
| 354 | Ga0501037_0000324 | 3300049573 | Bacteria | 40550 |
| 355 | Ga0501037_0286873 | 3300049573 | Bacteria | 1146 |
| 356 | Ga0501038_0000335 | 3300049574 | Bacteria | 40628 |
| 357 | Ga0501039_0085417 | 3300049575 | Bacteria | 2458 |
| 358 | Ga0501042_0107080 | 3300049578 | Bacteria | 2012 |
| 359 | Ga0501043_0000374 | 3300049579 | Bacteria | 40575 |
| 360 | Ga0501043_0082976 | 3300049579 | Bacteria | 2520 |
| 361 | Ga0501043_0145614 | 3300049579 | Bacteria | 1855 |
| 362 | Ga0501043_0486826 | 3300049579 | Bacteria | 923 |
| 363 | Ga0501046_0006886 | 3300049580 | Bacteria | 10018 |
| 364 | Ga0501047_0000540 | 3300049581 | Bacteria | 40769 |
| 365 | Ga0501047_0007507 | 3300049581 | Bacteria | 10261 |
| 366 | Ga0501047_0236549 | 3300049581 | Bacteria | 1678 |
| 367 | Ga0501047_0479536 | 3300049581 | Bacteria | 1071 |
| 368 | Ga0501048_0000171 | 3300049582 | Bacteria | 40760 |
| 369 | Ga0501048_0121656 | 3300049582 | Bacteria | 1844 |
| 370 | Ga0501048_0471770 | 3300049582 | Bacteria | 899 |
| 371 | Ga0501067_0004466 | 3300049583 | Bacteria | 7716 |
| 372 | Ga0501067_0017381 | 3300049583 | Bacteria | 3975 |
| 373 | Ga0501067_0295755 | 3300049583 | Bacteria | 901 |
| 374 | Ga0501068_0050921 | 3300049584 | Bacteria | 2504 |
| 375 | Ga0501068_0076043 | 3300049584 | Bacteria | 2054 |
| 376 | Ga0501068_0320457 | 3300049584 | Bacteria | 994 |
| 377 | Ga0501068_0408890 | 3300049584 | Bacteria | 875 |
| 378 | Ga0501069_0042179 | 3300049585 | Bacteria | 2523 |
| 379 | Ga0501069_0052577 | 3300049585 | Bacteria | 2268 |
| 380 | Ga0501069_0072901 | 3300049585 | Bacteria | 1925 |
| 381 | Ga0501070_0000029 | 3300049586 | Bacteria | 140083 |
| 382 | Ga0501070_0000371 | 3300049586 | Bacteria | 40848 |
| 383 | Ga0501070_0007754 | 3300049586 | Bacteria | 9100 |
| 384 | Ga0501070_0049552 | 3300049586 | Bacteria | 3488 |
| 385 | Ga0501070_0051906 | 3300049586 | Bacteria | 3403 |
| 386 | Ga0501070_0085394 | 3300049586 | Bacteria | 2613 |
| 387 | Ga0501071_0177277 | 3300049587 | Bacteria | 1596 |
| 388 | Ga0501071_1029949 | 3300049587 | Bacteria | 636 |
| 389 | Ga0501072_0026799 | 3300049588 | Bacteria | 4496 |
| 390 | Ga0501072_0037477 | 3300049588 | Bacteria | 3803 |
| 391 | Ga0501073_0002398 | 3300049589 | Bacteria | 14023 |
| 392 | Ga0501073_0007762 | 3300049589 | Bacteria | 7967 |
| 393 | Ga0501073_0011067 | 3300049589 | Bacteria | 6599 |
| 394 | Ga0501073_0025790 | 3300049589 | Bacteria | 4211 |
| 395 | Ga0501074_0005944 | 3300049590 | Bacteria | 8800 |
| 396 | Ga0501074_0009980 | 3300049590 | Bacteria | 6896 |
| 397 | Ga0501074_0054892 | 3300049590 | Bacteria | 2873 |
| 398 | Ga0501074_0094971 | 3300049590 | Bacteria | 2135 |
| 399 | Ga0501074_0182509 | 3300049590 | Bacteria | 1497 |
| 400 | Ga0501074_0329389 | 3300049590 | Unclassified | 1084 |
| 401 | Ga0501217_011439 | 3300049661 | Bacteria | 1963 |
| 402 | Ga0501238_003936 | 3300049671 | Bacteria | 1841 |
| 403 | Ga0501079_0001199 | 3300049741 | Bacteria | 18177 |
| 404 | Ga0501079_0009255 | 3300049741 | Bacteria | 7463 |
| 405 | Ga0501079_0052653 | 3300049741 | Bacteria | 3141 |
| 406 | Ga0501079_0238291 | 3300049741 | Bacteria | 1421 |
| 407 | Ga0501079_0249639 | 3300049741 | Bacteria | 1387 |
| 408 | Ga0501080_0006875 | 3300049742 | Bacteria | 10257 |
| 409 | Ga0501080_0007826 | 3300049742 | Bacteria | 9667 |
| 410 | Ga0501080_0126439 | 3300049742 | Bacteria | 2367 |
| 411 | Ga0501080_0164827 | 3300049742 | Bacteria | 2045 |
| 412 | Ga0501080_0194530 | 3300049742 | Bacteria | 1863 |
| 413 | Ga0501080_0497348 | 3300049742 | Bacteria | 1090 |
| 414 | Ga0501080_0953880 | 3300049742 | Bacteria | 746 |
| 415 | Ga0501083_0001714 | 3300049744 | Bacteria | 14938 |
| 416 | Ga0501083_0006953 | 3300049744 | Bacteria | 8027 |
| 417 | Ga0501083_0016153 | 3300049744 | Bacteria | 5227 |
| 418 | Ga0501083_0060531 | 3300049744 | Bacteria | 2529 |
| 419 | Ga0501270_033293 | 3300049767 | Unclassified | 862 |
| 420 | Ga0501035_0000859 | 3300049822 | Bacteria | 32391 |
| 421 | Ga0501035_0003367 | 3300049822 | Bacteria | 15300 |
| 422 | Ga0501035_0007925 | 3300049822 | Bacteria | 9917 |
| 423 | Ga0501035_0099079 | 3300049822 | Unclassified | 2559 |
| 424 | Ga0501035_0470895 | 3300049822 | Bacteria | 1037 |
| 425 | Ga0501044_0000687 | 3300049823 | Bacteria | 40888 |
| 426 | Ga0501044_0012882 | 3300049823 | Bacteria | 9051 |
| 427 | Ga0501044_0164723 | 3300049823 | Bacteria | 2192 |
| 428 | Ga0501044_0553988 | 3300049823 | Bacteria | 1047 |
| 429 | Ga0501044_1096470 | 3300049823 | Bacteria | 665 |
| 430 | Ga0501045_0132713 | 3300049824 | Bacteria | 1851 |
| 431 | Ga0501226_004919 | 3300049853 | Bacteria | 1533 |
| 432 | nmdc:mga00v17_374632_c1 | 3300050491 | Bacteria | 925 |
| 433 | nmdc:mga00v17_55880_c1 | 3300050491 | Bacteria | 2412 |
| 434 | nmdc:mga0yw44_512173_c1 | 3300050492 | Bacteria | 814 |
| 435 | nmdc:mga0k408_470064_c1 | 3300050493 | Bacteria | 746 |
| 436 | nmdc:mga06z11_98647_c1 | 3300050494 | Bacteria | 1599 |
| 437 | nmdc:mga0n895_22304_c1 | 3300050512 | Bacteria | 5935 |
| 438 | nmdc:mga0rr50_277539_c1 | 3300050513 | Bacteria | 1398 |
| 439 | nmdc:mga08x19_89_c1 | 3300050514 | Bacteria | 82051 |
| 440 | Ga0500610_0023027 | 3300053079 | Bacteria | 3078 |
| 441 | Ga0495655_0011775 | 3300053083 | Bacteria | 1765 |
| 442 | Ga0500578_0595362 | 3300053086 | Bacteria | 609 |
| 443 | Ga0500608_105415 | 3300053122 | Bacteria | 1300 |
| 444 | Ga0500618_000056 | 3300053125 | Bacteria | 98509 |
| 445 | Ga0500618_000304 | 3300053125 | Bacteria | 36803 |
| 446 | Ga0500618_035559 | 3300053125 | Bacteria | 1156 |
| 447 | Ga0500655_007157 | 3300053133 | Bacteria | 2006 |
| 448 | Ga0500559_0073153 | 3300053136 | Bacteria | 1546 |
| 449 | Ga0500559_0239748 | 3300053136 | Unclassified | 855 |
| 450 | Ga0500568_0000436 | 3300053139 | Bacteria | 31383 |
| 451 | Ga0500568_0123550 | 3300053139 | Bacteria | 964 |
| 452 | Ga0500604_0045268 | 3300053151 | Bacteria | 1342 |
| 453 | Ga0500620_000040 | 3300053155 | Bacteria | 23734 |
| 454 | Ga0500611_020812 | 3300053727 | Bacteria | 1244 |
| 455 | Ga0501084_0105471 | 3300054114 | Bacteria | 2367 |
| 456 | Ga0501084_0180482 | 3300054114 | Bacteria | 1782 |
| 457 | Ga0501084_0663404 | 3300054114 | Bacteria | 880 |
| 458 | Ga0501082_0005048 | 3300060353 | Bacteria | 11509 |
| 459 | Ga0501082_0007327 | 3300060353 | Bacteria | 9522 |
| 460 | Ga0501082_0009005 | 3300060353 | Bacteria | 8613 |
| 461 | Ga0501082_0020207 | 3300060353 | Bacteria | 5739 |
| 462 | Ga0501082_0156508 | 3300060353 | Bacteria | 1980 |
| 463 | Ga0501082_0876877 | 3300060353 | Unclassified | 785 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2968138860 | 2968146467 | 163 |
| 2 | iso_pu_bacteria | 2869169390 | 2869176996 | 167 |
| 3 | 3300048905 | Ga0496102_0112455 | Ga0496102_0112455_1714_2238 | 170 |
| 4 | 3300003323 | rootH1_10312064 | rootH1_103120642 | 175 |
| 5 | 3300025986 | Ga0207658_10176936 | Ga0207658_101769362 | 180 |
| 6 | 3300031665 | Ga0316575_10037339 | Ga0316575_100373391 | 181 |
| 7 | iso_pu_bacteria | 2513237305 | 2514419050 | 181 |
| 8 | 3300010375 | Ga0105239_10011411 | Ga0105239_1001141111 | 182 |
| 9 | 3300013105 | Ga0157369_10324674 | Ga0157369_103246742 | 182 |
| 10 | 3300035119 | Ga0373956_0363297 | Ga0373956_0363297_108_665 | 182 |
| 11 | 3300046462 | Ga0495651_0415451 | Ga0495651_0415451_33_590 | 182 |
| 12 | 3300046477 | Ga0495664_0099811 | Ga0495664_0099811_792_1349 | 182 |
| 13 | 3300046516 | Ga0495628_0528307 | Ga0495628_0528307_274_831 | 182 |
| 14 | 3300046536 | Ga0495587_0067596 | Ga0495587_0067596_524_1081 | 182 |
| 15 | 3300046543 | Ga0495645_0091891 | Ga0495645_0091891_333_890 | 182 |
| 16 | 3300005539 | Ga0068853_100008770 | Ga0068853_1000087706 | 183 |
| 17 | 3300013104 | Ga0157370_10292337 | Ga0157370_102923372 | 183 |
| 18 | 3300026041 | Ga0207639_10227452 | Ga0207639_102274522 | 183 |
| 19 | 3300026067 | Ga0207678_10142927 | Ga0207678_101429271 | 183 |
| 20 | 3300037418 | Ga0395900_0570482 | Ga0395900_0570482_162_728 | 183 |
| 21 | 3300045836 | Ga0466958_0129192 | Ga0466958_0129192_913_1482 | 183 |
| 22 | 3300049590 | Ga0501074_0182509 | Ga0501074_0182509_597_1166 | 183 |
| 23 | 3300049823 | Ga0501044_1096470 | Ga0501044_1096470_57_626 | 183 |
| 24 | 3300005336 | Ga0070680_100345585 | Ga0070680_1003455852 | 184 |
| 25 | 3300044683 | Ga0466965_0317056 | Ga0466965_0317056_64_630 | 184 |
| 26 | 3300049568 | Ga0501031_0007354 | Ga0501031_0007354_3322_3876 | 184 |
| 27 | 3300049569 | Ga0501032_0004327 | Ga0501032_0004327_3519_4073 | 184 |
| 28 | 3300049570 | Ga0501033_0000411 | Ga0501033_0000411_36841_37395 | 184 |
| 29 | 3300049570 | Ga0501033_0169718 | Ga0501033_0169718_691_1245 | 184 |
| 30 | 3300049571 | Ga0501034_0121713 | Ga0501034_0121713_1082_1636 | 184 |
| 31 | 3300049571 | Ga0501034_0311838 | Ga0501034_0311838_544_1098 | 184 |
| 32 | 3300049572 | Ga0501036_0008520 | Ga0501036_0008520_4477_5031 | 184 |
| 33 | 3300049573 | Ga0501037_0000324 | Ga0501037_0000324_3439_3993 | 184 |
| 34 | 3300049574 | Ga0501038_0000335 | Ga0501038_0000335_3372_3926 | 184 |
| 35 | 3300049575 | Ga0501039_0085417 | Ga0501039_0085417_1577_2131 | 184 |
| 36 | 3300049578 | Ga0501042_0107080 | Ga0501042_0107080_374_928 | 184 |
| 37 | 3300049579 | Ga0501043_0000374 | Ga0501043_0000374_36573_37127 | 184 |
| 38 | 3300049580 | Ga0501046_0006886 | Ga0501046_0006886_6090_6644 | 184 |
| 39 | 3300049581 | Ga0501047_0000540 | Ga0501047_0000540_36841_37395 | 184 |
| 40 | 3300049582 | Ga0501048_0000171 | Ga0501048_0000171_3375_3929 | 184 |
| 41 | 3300049584 | Ga0501068_0076043 | Ga0501068_0076043_534_1088 | 184 |
| 42 | 3300049585 | Ga0501069_0042179 | Ga0501069_0042179_1434_1988 | 184 |
| 43 | 3300049586 | Ga0501070_0000371 | Ga0501070_0000371_3520_4074 | 184 |
| 44 | 3300049588 | Ga0501072_0037477 | Ga0501072_0037477_2139_2693 | 184 |
| 45 | 3300049589 | Ga0501073_0011067 | Ga0501073_0011067_3347_3901 | 184 |
| 46 | 3300049590 | Ga0501074_0005944 | Ga0501074_0005944_4800_5354 | 184 |
| 47 | 3300049741 | Ga0501079_0009255 | Ga0501079_0009255_6340_6894 | 184 |
| 48 | 3300049744 | Ga0501083_0016153 | Ga0501083_0016153_2023_2577 | 184 |
| 49 | 3300049822 | Ga0501035_0003367 | Ga0501035_0003367_11372_11926 | 184 |
| 50 | 3300049822 | Ga0501035_0470895 | Ga0501035_0470895_234_788 | 184 |
| 51 | 3300049823 | Ga0501044_0000687 | Ga0501044_0000687_36815_37369 | 184 |
| 52 | 3300049824 | Ga0501045_0132713 | Ga0501045_0132713_330_884 | 184 |
| 53 | 3300060353 | Ga0501082_0009005 | Ga0501082_0009005_2614_3168 | 184 |
| 54 | iso_pu_bacteria | 2643221547 | 2643754885 | 184 |
| 55 | iso_pu_bacteria | 2929138655 | 2929143347 | 184 |
| 56 | iso_pu_bacteria | 2995392953 | 2995395033 | 184 |
| 57 | 3300005616 | Ga0068852_100009705 | Ga0068852_1000097056 | 185 |
| 58 | 3300013104 | Ga0157370_10155938 | Ga0157370_101559381 | 185 |
| 59 | 3300031616 | Ga0307508_10413544 | Ga0307508_104135442 | 185 |
| 60 | 3300053155 | Ga0500620_000040 | Ga0500620_000040_11689_12246 | 185 |
| 61 | iso_pu_bacteria | 2508501123 | 2509114465 | 185 |
| 62 | iso_pu_bacteria | 2509276018 | 2509368378 | 185 |
| 63 | iso_pu_bacteria | 2509276022 | 2509393222 | 185 |
| 64 | iso_pu_bacteria | 2510065059 | 2510314659 | 185 |
| 65 | iso_pu_bacteria | 2512875016 | 2512934215 | 185 |
| 66 | iso_pu_bacteria | 2512875024 | 2512962517 | 185 |
| 67 | iso_pu_bacteria | 2513237164 | 2514038651 | 185 |
| 68 | iso_pu_bacteria | 2588253730 | 2588520368 | 185 |
| 69 | iso_pu_bacteria | 2643221595 | 2643983941 | 185 |
| 70 | iso_pu_bacteria | 2643221627 | 2644156071 | 185 |
| 71 | iso_pu_bacteria | 2687453392 | 2688595633 | 185 |
| 72 | iso_pu_bacteria | 2721755686 | 2723572832 | 185 |
| 73 | iso_pu_bacteria | 2756170246 | 2756674284 | 185 |
| 74 | iso_pu_bacteria | 2757320392 | 2757569653 | 185 |
| 75 | iso_pu_bacteria | 2791355123 | 2792746818 | 185 |
| 76 | iso_pu_bacteria | 2818991461 | 2819686902 | 185 |
| 77 | iso_pu_bacteria | 2821123053 | 2821125839 | 185 |
| 78 | iso_pu_bacteria | 2838736955 | 2838737712 | 185 |
| 79 | iso_pu_bacteria | 2840878972 | 2840879738 | 185 |
| 80 | iso_pu_bacteria | 2841840854 | 2841841919 | 185 |
| 81 | iso_pu_bacteria | 2842140634 | 2842141698 | 185 |
| 82 | iso_pu_bacteria | 2844002411 | 2844003838 | 185 |
| 83 | iso_pu_bacteria | 2856320880 | 2856321943 | 185 |
| 84 | iso_pu_bacteria | 2856328259 | 2856332885 | 185 |
| 85 | iso_pu_bacteria | 2856334872 | 2856340266 | 185 |
| 86 | iso_pu_bacteria | 2857367948 | 2857373453 | 185 |
| 87 | iso_pu_bacteria | 2857531043 | 2857532400 | 185 |
| 88 | iso_pu_bacteria | 2869234852 | 2869238744 | 185 |
| 89 | iso_pu_bacteria | 2869242130 | 2869246208 | 185 |
| 90 | iso_pu_bacteria | 2869249662 | 2869252447 | 185 |
| 91 | iso_pu_bacteria | 2869256925 | 2869260673 | 185 |
| 92 | iso_pu_bacteria | 2869264136 | 2869267185 | 185 |
| 93 | iso_pu_bacteria | 2869271264 | 2869275484 | 185 |
| 94 | iso_pu_bacteria | 2869278585 | 2869280120 | 185 |
| 95 | iso_pu_bacteria | 2871435913 | 2871437758 | 185 |
| 96 | iso_pu_bacteria | 2871451962 | 2871458090 | 185 |
| 97 | iso_pu_bacteria | 2871459585 | 2871465496 | 185 |
| 98 | iso_pu_bacteria | 2871466892 | 2871470621 | 185 |
| 99 | iso_pu_bacteria | 2871481445 | 2871485679 | 185 |
| 100 | iso_pu_bacteria | 2871488783 | 2871491059 | 185 |
| 101 | iso_pu_bacteria | 2874116593 | 2874118340 | 185 |
| 102 | iso_pu_bacteria | 2874123672 | 2874131408 | 185 |
| 103 | iso_pu_bacteria | 2874131515 | 2874133467 | 185 |
| 104 | iso_pu_bacteria | 2874139085 | 2874143328 | 185 |
| 105 | iso_pu_bacteria | 2874162495 | 2874164802 | 185 |
| 106 | iso_pu_bacteria | 2874168670 | 2874172023 | 185 |
| 107 | iso_pu_bacteria | 2876363079 | 2876363523 | 185 |
| 108 | iso_pu_bacteria | 2876386047 | 2876387535 | 185 |
| 109 | iso_pu_bacteria | 2876399893 | 2876403907 | 185 |
| 110 | iso_pu_bacteria | 2876406927 | 2876407817 | 185 |
| 111 | iso_pu_bacteria | 2876420981 | 2876425832 | 185 |
| 112 | iso_pu_bacteria | 2878730984 | 2878734975 | 185 |
| 113 | iso_pu_bacteria | 2878738818 | 2878740605 | 185 |
| 114 | iso_pu_bacteria | 2878753008 | 2878755469 | 185 |
| 115 | iso_pu_bacteria | 2878774303 | 2878775717 | 185 |
| 116 | iso_pu_bacteria | 2878781027 | 2878781319 | 185 |
| 117 | iso_pu_bacteria | 2881155292 | 2881158960 | 185 |
| 118 | iso_pu_bacteria | 2881845957 | 2881850979 | 185 |
| 119 | iso_pu_bacteria | 2881861095 | 2881861593 | 185 |
| 120 | iso_pu_bacteria | 2882632389 | 2882634795 | 185 |
| 121 | iso_pu_bacteria | 2882912400 | 2882915119 | 185 |
| 122 | iso_pu_bacteria | 2885318864 | 2885324250 | 185 |
| 123 | iso_pu_bacteria | 2885350715 | 2885351341 | 185 |
| 124 | iso_pu_bacteria | 2888337043 | 2888342976 | 185 |
| 125 | iso_pu_bacteria | 2903448605 | 2903454394 | 185 |
| 126 | iso_pu_bacteria | 2903492973 | 2903499056 | 185 |
| 127 | iso_pu_bacteria | 2903513507 | 2903516290 | 185 |
| 128 | iso_pu_bacteria | 2903521522 | 2903525473 | 185 |
| 129 | iso_pu_bacteria | 2903528002 | 2903531782 | 185 |
| 130 | iso_pu_bacteria | 2906363423 | 2906369605 | 185 |
| 131 | iso_pu_bacteria | 2906370794 | 2906375550 | 185 |
| 132 | iso_pu_bacteria | 2906378014 | 2906378832 | 185 |
| 133 | iso_pu_bacteria | 2906386501 | 2906392187 | 185 |
| 134 | iso_pu_bacteria | 2906401398 | 2906403043 | 185 |
| 135 | iso_pu_bacteria | 2906408224 | 2906413708 | 185 |
| 136 | iso_pu_bacteria | 2922151315 | 2922155105 | 185 |
| 137 | iso_pu_bacteria | 2922172374 | 2922177872 | 185 |
| 138 | iso_pu_bacteria | 2922178524 | 2922185427 | 185 |
| 139 | iso_pu_bacteria | 2924710171 | 2924715976 | 185 |
| 140 | iso_pu_bacteria | 2924733363 | 2924736684 | 185 |
| 141 | iso_pu_bacteria | 2924741084 | 2924742779 | 185 |
| 142 | iso_pu_bacteria | 2924748358 | 2924751449 | 185 |
| 143 | iso_pu_bacteria | 2924762789 | 2924764033 | 185 |
| 144 | iso_pu_bacteria | 2924776078 | 2924778206 | 185 |
| 145 | iso_pu_bacteria | 2924784321 | 2924791559 | 185 |
| 146 | iso_pu_bacteria | 2937822353 | 2937826355 | 185 |
| 147 | iso_pu_bacteria | 2937848649 | 2937854700 | 185 |
| 148 | iso_pu_bacteria | 2937861824 | 2937865009 | 185 |
| 149 | iso_pu_bacteria | 2937868953 | 2937870689 | 185 |
| 150 | iso_pu_bacteria | 2937877337 | 2937878002 | 185 |
| 151 | iso_pu_bacteria | 2937972304 | 2937973989 | 185 |
| 152 | iso_pu_bacteria | 2937980651 | 2937983714 | 185 |
| 153 | iso_pu_bacteria | 2958034702 | 2958035986 | 185 |
| 154 | iso_pu_bacteria | 2958041894 | 2958045292 | 185 |
| 155 | iso_pu_bacteria | 2958064165 | 2958068034 | 185 |
| 156 | iso_pu_bacteria | 2958084443 | 2958085113 | 185 |
| 157 | iso_pu_bacteria | 2958092219 | 2958097986 | 185 |
| 158 | iso_pu_bacteria | 2958108152 | 2958110377 | 185 |
| 159 | iso_pu_bacteria | 2958122699 | 2958125469 | 185 |
| 160 | iso_pu_bacteria | 2958137437 | 2958140383 | 185 |
| 161 | iso_pu_bacteria | 2958158011 | 2958162386 | 185 |
| 162 | iso_pu_bacteria | 2961127735 | 2961135438 | 185 |
| 163 | iso_pu_bacteria | 2961136820 | 2961140808 | 185 |
| 164 | iso_pu_bacteria | 2961170736 | 2961176587 | 185 |
| 165 | iso_pu_bacteria | 2961183825 | 2961185724 | 185 |
| 166 | iso_pu_bacteria | 2963644680 | 2963644983 | 185 |
| 167 | iso_pu_bacteria | 2965025482 | 2965030332 | 185 |
| 168 | iso_pu_bacteria | 2965032056 | 2965034303 | 185 |
| 169 | iso_pu_bacteria | 2965040258 | 2965041560 | 185 |
| 170 | iso_pu_bacteria | 2965047637 | 2965049185 | 185 |
| 171 | iso_pu_bacteria | 2965089291 | 2965094276 | 185 |
| 172 | iso_pu_bacteria | 2965110997 | 2965113466 | 185 |
| 173 | iso_pu_bacteria | 2967996073 | 2968001396 | 185 |
| 174 | iso_pu_bacteria | 2968003550 | 2968007449 | 185 |
| 175 | iso_pu_bacteria | 2968016561 | 2968017240 | 185 |
| 176 | iso_pu_bacteria | 2968083720 | 2968088735 | 185 |
| 177 | iso_pu_bacteria | 2970469710 | 2970470597 | 185 |
| 178 | iso_pu_bacteria | 2970489779 | 2970490187 | 185 |
| 179 | iso_pu_bacteria | 2970503327 | 2970509258 | 185 |
| 180 | iso_pu_bacteria | 2970510686 | 2970514769 | 185 |
| 181 | iso_pu_bacteria | 2970532167 | 2970533022 | 185 |
| 182 | iso_pu_bacteria | 2970547951 | 2970550449 | 185 |
| 183 | iso_pu_bacteria | 2970593180 | 2970594717 | 185 |
| 184 | iso_pu_bacteria | 2970619444 | 2970624240 | 185 |
| 185 | iso_pu_bacteria | 2970627176 | 2970627989 | 185 |
| 186 | iso_pu_bacteria | 2977821940 | 2977824608 | 185 |
| 187 | iso_pu_bacteria | 2977828996 | 2977835331 | 185 |
| 188 | iso_pu_bacteria | 2977851361 | 2977857612 | 185 |
| 189 | iso_pu_bacteria | 2977872689 | 2977873675 | 185 |
| 190 | iso_pu_bacteria | 2977907340 | 2977911529 | 185 |
| 191 | iso_pu_bacteria | 2977915119 | 2977916140 | 185 |
| 192 | iso_pu_bacteria | 2977922695 | 2977925889 | 185 |
| 193 | iso_pu_bacteria | 2977935797 | 2977941858 | 185 |
| 194 | iso_pu_bacteria | 2977950692 | 2977951477 | 185 |
| 195 | iso_pu_bacteria | 2977957713 | 2977963401 | 185 |
| 196 | iso_pu_bacteria | 2977986579 | 2977991583 | 185 |
| 197 | iso_pu_bacteria | 2979764755 | 2979771385 | 185 |
| 198 | iso_pu_bacteria | 2979772303 | 2979778347 | 185 |
| 199 | iso_pu_bacteria | 2979793036 | 2979798186 | 185 |
| 200 | iso_pu_bacteria | 2979808191 | 2979813937 | 185 |
| 201 | iso_pu_bacteria | 2987645492 | 2987649030 | 185 |
| 202 | iso_pu_bacteria | 2987666974 | 2987667570 | 185 |
| 203 | iso_pu_bacteria | 2987673487 | 2987674492 | 185 |
| 204 | iso_pu_bacteria | 2996348954 | 2996348984 | 185 |
| 205 | iso_pu_bacteria | 2996386984 | 2996391674 | 185 |
| 206 | iso_pu_bacteria | 3000135777 | 3000142601 | 185 |
| 207 | iso_pu_bacteria | 3004167301 | 3004172844 | 185 |
| 208 | iso_pu_bacteria | 3004195979 | 3004197867 | 185 |
| 209 | iso_pu_bacteria | 3004211236 | 3004216443 | 185 |
| 210 | iso_pu_bacteria | 3004218560 | 3004218654 | 185 |
| 211 | iso_pu_bacteria | 3004232784 | 3004239402 | 185 |
| 212 | iso_pu_bacteria | 3004239961 | 3004242173 | 185 |
| 213 | iso_pu_bacteria | 3004248173 | 3004254687 | 185 |
| 214 | iso_pu_bacteria | 3004275668 | 3004275696 | 185 |
| 215 | iso_pu_bacteria | 3004289098 | 3004291189 | 185 |
| 216 | iso_pu_bacteria | 649633066 | 649870200 | 185 |
| 217 | iso_pu_bacteria | 8004300914 | 8004301745 | 185 |
| 218 | iso_pu_bacteria | 8004312739 | 8004315002 | 185 |
| 219 | iso_pu_bacteria | 8004361976 | 8004365392 | 185 |
| 220 | iso_pu_bacteria | 8004374579 | 8004377048 | 185 |
| 221 | iso_pu_bacteria | 8004695233 | 8004701173 | 185 |
| 222 | iso_pu_bacteria | 8004727605 | 8004727915 | 185 |
| 223 | 3300005543 | Ga0070672_100000146 | Ga0070672_10000014629 | 186 |
| 224 | 3300005614 | Ga0068856_100782977 | Ga0068856_1007829771 | 186 |
| 225 | 3300005614 | Ga0068856_101199044 | Ga0068856_1011990441 | 186 |
| 226 | 3300013104 | Ga0157370_10765199 | Ga0157370_107651991 | 186 |
| 227 | 3300025940 | Ga0207691_10000929 | Ga0207691_100009297 | 186 |
| 228 | 3300026078 | Ga0207702_11109069 | Ga0207702_111090691 | 186 |
| 229 | 3300026078 | Ga0207702_11113090 | Ga0207702_111130901 | 186 |
| 230 | 3300028794 | Ga0307515_10392165 | Ga0307515_103921652 | 186 |
| 231 | 3300041443 | Ga0451789_0634181 | Ga0451789_0634181_548_1108 | 186 |
| 232 | 3300041486 | Ga0451807_0783002 | Ga0451807_0783002_1029_1589 | 186 |
| 233 | 3300045976 | Ga0466967_0975842 | Ga0466967_0975842_246_824 | 186 |
| 234 | 3300047320 | Ga0495672_0129214 | Ga0495672_0129214_234_854 | 186 |
| 235 | 3300049571 | Ga0501034_0066799 | Ga0501034_0066799_1762_2334 | 186 |
| 236 | 3300049823 | Ga0501044_0553988 | Ga0501044_0553988_438_1016 | 186 |
| 237 | 3300060353 | Ga0501082_0007327 | Ga0501082_0007327_189_761 | 186 |
| 238 | iso_pu_bacteria | 2599185301 | 2599935482 | 186 |
| 239 | iso_pu_bacteria | 2693429783 | 2694628202 | 186 |
| 240 | iso_pu_bacteria | 2693429784 | 2694640941 | 186 |
| 241 | iso_pu_bacteria | 2847686936 | 2847689678 | 186 |
| 242 | iso_pu_bacteria | 2856364286 | 2856366140 | 186 |
| 243 | iso_pu_bacteria | 2857349434 | 2857352605 | 186 |
| 244 | iso_pu_bacteria | 2869285874 | 2869291005 | 186 |
| 245 | iso_pu_bacteria | 2871429161 | 2871433287 | 186 |
| 246 | iso_pu_bacteria | 2871444079 | 2871446871 | 186 |
| 247 | iso_pu_bacteria | 2871495908 | 2871498899 | 186 |
| 248 | iso_pu_bacteria | 2874102143 | 2874103089 | 186 |
| 249 | iso_pu_bacteria | 2874146452 | 2874148771 | 186 |
| 250 | iso_pu_bacteria | 2874155637 | 2874160817 | 186 |
| 251 | iso_pu_bacteria | 2876369609 | 2876374733 | 186 |
| 252 | iso_pu_bacteria | 2876377896 | 2876385861 | 186 |
| 253 | iso_pu_bacteria | 2876392853 | 2876397357 | 186 |
| 254 | iso_pu_bacteria | 2876413966 | 2876418857 | 186 |
| 255 | iso_pu_bacteria | 2878745973 | 2878750900 | 186 |
| 256 | iso_pu_bacteria | 2878760144 | 2878763112 | 186 |
| 257 | iso_pu_bacteria | 2878767105 | 2878770087 | 186 |
| 258 | iso_pu_bacteria | 2881161766 | 2881164662 | 186 |
| 259 | iso_pu_bacteria | 2885305155 | 2885306502 | 186 |
| 260 | iso_pu_bacteria | 2885326080 | 2885328473 | 186 |
| 261 | iso_pu_bacteria | 2885334103 | 2885340578 | 186 |
| 262 | iso_pu_bacteria | 2888350351 | 2888352789 | 186 |
| 263 | iso_pu_bacteria | 2889010040 | 2889014564 | 186 |
| 264 | iso_pu_bacteria | 2889016732 | 2889020454 | 186 |
| 265 | iso_pu_bacteria | 2903492973 | 2903506244 | 186 |
| 266 | iso_pu_bacteria | 2903540706 | 2903543698 | 186 |
| 267 | iso_pu_bacteria | 2904659560 | 2904664111 | 186 |
| 268 | iso_pu_bacteria | 2906308376 | 2906313825 | 186 |
| 269 | iso_pu_bacteria | 2906321335 | 2906326534 | 186 |
| 270 | iso_pu_bacteria | 2906328253 | 2906334872 | 186 |
| 271 | iso_pu_bacteria | 2922158528 | 2922161022 | 186 |
| 272 | iso_pu_bacteria | 2924726620 | 2924727215 | 186 |
| 273 | iso_pu_bacteria | 2937813078 | 2937819870 | 186 |
| 274 | iso_pu_bacteria | 2937891427 | 2937897731 | 186 |
| 275 | iso_pu_bacteria | 2937994558 | 2937997547 | 186 |
| 276 | iso_pu_bacteria | 2938014810 | 2938018174 | 186 |
| 277 | iso_pu_bacteria | 2958041894 | 2958042056 | 186 |
| 278 | iso_pu_bacteria | 2958100919 | 2958101720 | 186 |
| 279 | iso_pu_bacteria | 2958115193 | 2958119435 | 186 |
| 280 | iso_pu_bacteria | 2958130278 | 2958135405 | 186 |
| 281 | iso_pu_bacteria | 2958165035 | 2958168020 | 186 |
| 282 | iso_pu_bacteria | 2958172287 | 2958177092 | 186 |
| 283 | iso_pu_bacteria | 2958179912 | 2958184434 | 186 |
| 284 | iso_pu_bacteria | 2961077736 | 2961082489 | 186 |
| 285 | iso_pu_bacteria | 2961114664 | 2961118749 | 186 |
| 286 | iso_pu_bacteria | 2961163497 | 2961166486 | 186 |
| 287 | iso_pu_bacteria | 2965018300 | 2965021306 | 186 |
| 288 | iso_pu_bacteria | 2965062239 | 2965065546 | 186 |
| 289 | iso_pu_bacteria | 2965119406 | 2965119782 | 186 |
| 290 | iso_pu_bacteria | 2968091066 | 2968093869 | 186 |
| 291 | iso_pu_bacteria | 2968097103 | 2968101348 | 186 |
| 292 | iso_pu_bacteria | 2968110612 | 2968115250 | 186 |
| 293 | iso_pu_bacteria | 2968117919 | 2968121950 | 186 |
| 294 | iso_pu_bacteria | 2968128360 | 2968134146 | 186 |
| 295 | iso_pu_bacteria | 2968171901 | 2968174890 | 186 |
| 296 | iso_pu_bacteria | 2970554993 | 2970557960 | 186 |
| 297 | iso_pu_bacteria | 2977843712 | 2977845502 | 186 |
| 298 | iso_pu_bacteria | 2977858184 | 2977864794 | 186 |
| 299 | iso_pu_bacteria | 2977942078 | 2977950683 | 186 |
| 300 | iso_pu_bacteria | 2979710463 | 2979717429 | 186 |
| 301 | iso_pu_bacteria | 2979742915 | 2979747415 | 186 |
| 302 | iso_pu_bacteria | 2979779861 | 2979781886 | 186 |
| 303 | iso_pu_bacteria | 2987636660 | 2987641197 | 186 |
| 304 | iso_pu_bacteria | 2987652177 | 2987656533 | 186 |
| 305 | iso_pu_bacteria | 2987659509 | 2987662496 | 186 |
| 306 | iso_pu_bacteria | 2996341866 | 2996342227 | 186 |
| 307 | iso_pu_bacteria | 3004188549 | 3004191546 | 186 |
| 308 | iso_pu_bacteria | 3004203850 | 3004210003 | 186 |
| 309 | iso_pu_bacteria | 8004387939 | 8004393294 | 186 |
| 310 | iso_pu_bacteria | 8004445564 | 8004446365 | 186 |
| 311 | iso_pu_bacteria | 8004640170 | 8004644258 | 186 |
| 312 | iso_pu_bacteria | 8004703790 | 8004707019 | 186 |
| 313 | iso_pu_bacteria | 8004714634 | 8004720081 | 186 |
| 314 | 3300003323 | rootH1_10160586 | rootH1_101605865 | 187 |
| 315 | 3300003771 | Ga0055526_1019219 | Ga0055526_10192192 | 187 |
| 316 | 3300003775 | Ga0055524_1000504 | Ga0055524_100050430 | 187 |
| 317 | 3300003790 | Ga0055528_1000035 | Ga0055528_100003530 | 187 |
| 318 | 3300005616 | Ga0068852_100058403 | Ga0068852_1000584035 | 187 |
| 319 | 3300013102 | Ga0157371_10112424 | Ga0157371_101124242 | 187 |
| 320 | 3300013105 | Ga0157369_10397991 | Ga0157369_103979911 | 187 |
| 321 | 3300025273 | Ga0209673_1000220 | Ga0209673_100022086 | 187 |
| 322 | 3300025295 | Ga0209564_1000955 | Ga0209564_10009554 | 187 |
| 323 | 3300025299 | Ga0209256_1000341 | Ga0209256_100034155 | 187 |
| 324 | 3300025949 | Ga0207667_10423691 | Ga0207667_104236912 | 187 |
| 325 | 3300026142 | Ga0207698_10069452 | Ga0207698_100694525 | 187 |
| 326 | 3300046530 | Ga0495654_0000758 | Ga0495654_0000758_18319_18882 | 187 |
| 327 | 3300048919 | Ga0496116_0076191 | Ga0496116_0076191_1283_1846 | 187 |
| 328 | 3300048921 | Ga0496118_0015429 | Ga0496118_0015429_2237_2800 | 187 |
| 329 | 3300048924 | Ga0496121_0001349 | Ga0496121_0001349_16146_16709 | 187 |
| 330 | 3300048925 | Ga0496122_0009404 | Ga0496122_0009404_2703_3266 | 187 |
| 331 | 3300048926 | Ga0496123_0062761 | Ga0496123_0062761_918_1481 | 187 |
| 332 | 3300048927 | Ga0496124_0008227 | Ga0496124_0008227_2794_3357 | 187 |
| 333 | 3300048927 | Ga0496124_0013964 | Ga0496124_0013964_4395_4958 | 187 |
| 334 | 3300048929 | Ga0496126_0263675 | Ga0496126_0263675_48_626 | 187 |
| 335 | 3300053122 | Ga0500608_105415 | Ga0500608_105415_642_1214 | 187 |
| 336 | 3300053125 | Ga0500618_000056 | Ga0500618_000056_6080_6643 | 187 |
| 337 | 3300053125 | Ga0500618_000304 | Ga0500618_000304_7527_8090 | 187 |
| 338 | 3300053136 | Ga0500559_0073153 | Ga0500559_0073153_179_751 | 187 |
| 339 | 3300053136 | Ga0500559_0239748 | Ga0500559_0239748_102_665 | 187 |
| 340 | 3300003320 | rootH2_10092887 | rootH2_100928872 | 188 |
| 341 | 3300005329 | Ga0070683_100034345 | Ga0070683_1000343455 | 188 |
| 342 | 3300005335 | Ga0070666_10009665 | Ga0070666_100096654 | 188 |
| 343 | 3300005335 | Ga0070666_10084779 | Ga0070666_100847792 | 188 |
| 344 | 3300005344 | Ga0070661_100395270 | Ga0070661_1003952701 | 188 |
| 345 | 3300005367 | Ga0070667_100004911 | Ga0070667_1000049114 | 188 |
| 346 | 3300005367 | Ga0070667_100063380 | Ga0070667_1000633802 | 188 |
| 347 | 3300005435 | Ga0070714_100020316 | Ga0070714_1000203168 | 188 |
| 348 | 3300005455 | Ga0070663_100000968 | Ga0070663_10000096810 | 188 |
| 349 | 3300005458 | Ga0070681_10156799 | Ga0070681_101567992 | 188 |
| 350 | 3300005530 | Ga0070679_100024727 | Ga0070679_1000247274 | 188 |
| 351 | 3300005548 | Ga0070665_100089160 | Ga0070665_1000891602 | 188 |
| 352 | 3300005548 | Ga0070665_100355410 | Ga0070665_1003554103 | 188 |
| 353 | 3300009093 | Ga0105240_10909847 | Ga0105240_109098471 | 188 |
| 354 | 3300009101 | Ga0105247_10198525 | Ga0105247_101985252 | 188 |
| 355 | 3300013306 | Ga0163162_10015754 | Ga0163162_100157549 | 188 |
| 356 | 3300013308 | Ga0157375_10061972 | Ga0157375_100619723 | 188 |
| 357 | 3300014325 | Ga0163163_10684450 | Ga0163163_106844502 | 188 |
| 358 | 3300014968 | Ga0157379_11440688 | Ga0157379_114406881 | 188 |
| 359 | 3300017792 | Ga0163161_10669882 | Ga0163161_106698822 | 188 |
| 360 | 3300025242 | Ga0209258_106168 | Ga0209258_1061682 | 188 |
| 361 | 3300025284 | Ga0209130_1039409 | Ga0209130_10394091 | 188 |
| 362 | 3300025903 | Ga0207680_10001621 | Ga0207680_100016217 | 188 |
| 363 | 3300025903 | Ga0207680_10069794 | Ga0207680_100697942 | 188 |
| 364 | 3300025912 | Ga0207707_10164350 | Ga0207707_101643502 | 188 |
| 365 | 3300025917 | Ga0207660_10149038 | Ga0207660_101490382 | 188 |
| 366 | 3300025920 | Ga0207649_10930565 | Ga0207649_109305651 | 188 |
| 367 | 3300025921 | Ga0207652_10001986 | Ga0207652_1000198613 | 188 |
| 368 | 3300025929 | Ga0207664_10082472 | Ga0207664_100824722 | 188 |
| 369 | 3300025944 | Ga0207661_10006966 | Ga0207661_100069665 | 188 |
| 370 | 3300025986 | Ga0207658_10006509 | Ga0207658_100065092 | 188 |
| 371 | 3300026067 | Ga0207678_10002188 | Ga0207678_1000218813 | 188 |
| 372 | 3300028379 | Ga0268266_10000406 | Ga0268266_100004069 | 188 |
| 373 | 3300028577 | Ga0265318_10061041 | Ga0265318_100610411 | 188 |
| 374 | 3300031238 | Ga0265332_10009365 | Ga0265332_100093653 | 188 |
| 375 | 3300031240 | Ga0265320_10011465 | Ga0265320_100114654 | 188 |
| 376 | 3300031247 | Ga0265340_10162669 | Ga0265340_101626692 | 188 |
| 377 | 3300031250 | Ga0265331_10009923 | Ga0265331_100099231 | 188 |
| 378 | 3300031344 | Ga0265316_10019847 | Ga0265316_100198477 | 188 |
| 379 | 3300031711 | Ga0265314_10128814 | Ga0265314_101288142 | 188 |
| 380 | 3300031712 | Ga0265342_10022458 | Ga0265342_100224585 | 188 |
| 381 | 3300032004 | Ga0307414_10028478 | Ga0307414_100284784 | 188 |
| 382 | 3300041486 | Ga0451807_0244631 | Ga0451807_0244631_132_704 | 188 |
| 383 | 3300048919 | Ga0496116_0002552 | Ga0496116_0002552_12963_13529 | 188 |
| 384 | 3300048920 | Ga0496117_0000657 | Ga0496117_0000657_31769_32335 | 188 |
| 385 | 3300048924 | Ga0496121_0030943 | Ga0496121_0030943_3727_4293 | 188 |
| 386 | 3300048927 | Ga0496124_0004660 | Ga0496124_0004660_5890_6456 | 188 |
| 387 | 3300048927 | Ga0496124_0169885 | Ga0496124_0169885_381_956 | 188 |
| 388 | 3300048927 | Ga0496124_0280947 | Ga0496124_0280947_204_779 | 188 |
| 389 | 3300048928 | Ga0496125_0062096 | Ga0496125_0062096_316_882 | 188 |
| 390 | 3300048928 | Ga0496125_0148717 | Ga0496125_0148717_482_1057 | 188 |
| 391 | 3300049130 | Ga0501310_003256 | Ga0501310_003256_159_725 | 188 |
| 392 | 3300049523 | Ga0501300_008000 | Ga0501300_008000_891_1457 | 188 |
| 393 | 3300049571 | Ga0501034_0746850 | Ga0501034_0746850_24_590 | 188 |
| 394 | 3300049579 | Ga0501043_0145614 | Ga0501043_0145614_692_1267 | 188 |
| 395 | 3300049579 | Ga0501043_0486826 | Ga0501043_0486826_260_835 | 188 |
| 396 | 3300049581 | Ga0501047_0236549 | Ga0501047_0236549_737_1312 | 188 |
| 397 | 3300049581 | Ga0501047_0479536 | Ga0501047_0479536_335_910 | 188 |
| 398 | 3300049582 | Ga0501048_0471770 | Ga0501048_0471770_174_749 | 188 |
| 399 | 3300049583 | Ga0501067_0295755 | Ga0501067_0295755_294_869 | 188 |
| 400 | 3300049584 | Ga0501068_0050921 | Ga0501068_0050921_1464_2045 | 188 |
| 401 | 3300049584 | Ga0501068_0320457 | Ga0501068_0320457_61_627 | 188 |
| 402 | 3300049584 | Ga0501068_0408890 | Ga0501068_0408890_44_619 | 188 |
| 403 | 3300049585 | Ga0501069_0052577 | Ga0501069_0052577_340_906 | 188 |
| 404 | 3300049586 | Ga0501070_0000029 | Ga0501070_0000029_85309_85881 | 188 |
| 405 | 3300049586 | Ga0501070_0049552 | Ga0501070_0049552_2480_3055 | 188 |
| 406 | 3300049586 | Ga0501070_0051906 | Ga0501070_0051906_1137_1718 | 188 |
| 407 | 3300049587 | Ga0501071_0177277 | Ga0501071_0177277_770_1345 | 188 |
| 408 | 3300049587 | Ga0501071_1029949 | Ga0501071_1029949_18_599 | 188 |
| 409 | 3300049589 | Ga0501073_0002398 | Ga0501073_0002398_12999_13571 | 188 |
| 410 | 3300049589 | Ga0501073_0025790 | Ga0501073_0025790_624_1205 | 188 |
| 411 | 3300049590 | Ga0501074_0009980 | Ga0501074_0009980_1567_2148 | 188 |
| 412 | 3300049590 | Ga0501074_0094971 | Ga0501074_0094971_1119_1691 | 188 |
| 413 | 3300049661 | Ga0501217_011439 | Ga0501217_011439_1249_1815 | 188 |
| 414 | 3300049671 | Ga0501238_003936 | Ga0501238_003936_1031_1597 | 188 |
| 415 | 3300049741 | Ga0501079_0052653 | Ga0501079_0052653_1194_1769 | 188 |
| 416 | 3300049741 | Ga0501079_0238291 | Ga0501079_0238291_663_1235 | 188 |
| 417 | 3300049741 | Ga0501079_0249639 | Ga0501079_0249639_409_990 | 188 |
| 418 | 3300049742 | Ga0501080_0006875 | Ga0501080_0006875_6108_6683 | 188 |
| 419 | 3300049742 | Ga0501080_0007826 | Ga0501080_0007826_3211_3792 | 188 |
| 420 | 3300049742 | Ga0501080_0126439 | Ga0501080_0126439_569_1135 | 188 |
| 421 | 3300049742 | Ga0501080_0194530 | Ga0501080_0194530_433_1008 | 188 |
| 422 | 3300049742 | Ga0501080_0953880 | Ga0501080_0953880_146_718 | 188 |
| 423 | 3300049744 | Ga0501083_0001714 | Ga0501083_0001714_11279_11851 | 188 |
| 424 | 3300049744 | Ga0501083_0006953 | Ga0501083_0006953_1933_2514 | 188 |
| 425 | 3300049744 | Ga0501083_0060531 | Ga0501083_0060531_1472_2047 | 188 |
| 426 | 3300049853 | Ga0501226_004919 | Ga0501226_004919_847_1413 | 188 |
| 427 | 3300053139 | Ga0500568_0000436 | Ga0500568_0000436_23530_24096 | 188 |
| 428 | 3300053139 | Ga0500568_0123550 | Ga0500568_0123550_166_732 | 188 |
| 429 | 3300054114 | Ga0501084_0180482 | Ga0501084_0180482_540_1121 | 188 |
| 430 | 3300054114 | Ga0501084_0663404 | Ga0501084_0663404_214_789 | 188 |
| 431 | 3300060353 | Ga0501082_0005048 | Ga0501082_0005048_6746_7327 | 188 |
| 432 | 3300060353 | Ga0501082_0020207 | Ga0501082_0020207_3483_4055 | 188 |
| 433 | 3300003763 | Ga0055529_1001765 | Ga0055529_10017653 | 189 |
| 434 | 3300005262 | Ga0065165_1002490 | Ga0065165_100249014 | 189 |
| 435 | 3300005327 | Ga0070658_10134475 | Ga0070658_101344752 | 189 |
| 436 | 3300005327 | Ga0070658_10534785 | Ga0070658_105347852 | 189 |
| 437 | 3300005336 | Ga0070680_100000084 | Ga0070680_10000008429 | 189 |
| 438 | 3300005341 | Ga0070691_10002328 | Ga0070691_100023285 | 189 |
| 439 | 3300005344 | Ga0070661_100692719 | Ga0070661_1006927191 | 189 |
| 440 | 3300005345 | Ga0070692_10217600 | Ga0070692_102176002 | 189 |
| 441 | 3300005356 | Ga0070674_100297715 | Ga0070674_1002977152 | 189 |
| 442 | 3300005367 | Ga0070667_100522837 | Ga0070667_1005228371 | 189 |
| 443 | 3300005434 | Ga0070709_10007167 | Ga0070709_100071675 | 189 |
| 444 | 3300005435 | Ga0070714_100023481 | Ga0070714_1000234816 | 189 |
| 445 | 3300005436 | Ga0070713_100000121 | Ga0070713_10000012149 | 189 |
| 446 | 3300005440 | Ga0070705_100294385 | Ga0070705_1002943852 | 189 |
| 447 | 3300005455 | Ga0070663_100706325 | Ga0070663_1007063251 | 189 |
| 448 | 3300005458 | Ga0070681_10000001 | Ga0070681_10000001555 | 189 |
| 449 | 3300005530 | Ga0070679_100000211 | Ga0070679_1000002114 | 189 |
| 450 | 3300005535 | Ga0070684_100337959 | Ga0070684_1003379592 | 189 |
| 451 | 3300005539 | Ga0068853_100005255 | Ga0068853_10000525511 | 189 |
| 452 | 3300005539 | Ga0068853_100350248 | Ga0068853_1003502482 | 189 |
| 453 | 3300005545 | Ga0070695_100006141 | Ga0070695_1000061419 | 189 |
| 454 | 3300005546 | Ga0070696_100822551 | Ga0070696_1008225511 | 189 |
| 455 | 3300005547 | Ga0070693_100041131 | Ga0070693_1000411315 | 189 |
| 456 | 3300005548 | Ga0070665_100029417 | Ga0070665_1000294175 | 189 |
| 457 | 3300005548 | Ga0070665_100445071 | Ga0070665_1004450712 | 189 |
| 458 | 3300005563 | Ga0068855_100336119 | Ga0068855_1003361192 | 189 |
| 459 | 3300005563 | Ga0068855_100415225 | Ga0068855_1004152252 | 189 |
| 460 | 3300005577 | Ga0068857_100050176 | Ga0068857_1000501763 | 189 |
| 461 | 3300005577 | Ga0068857_100597731 | Ga0068857_1005977312 | 189 |
| 462 | 3300005578 | Ga0068854_100045814 | Ga0068854_1000458142 | 189 |
| 463 | 3300005578 | Ga0068854_100393096 | Ga0068854_1003930962 | 189 |
| 464 | 3300005614 | Ga0068856_100000497 | Ga0068856_10000049710 | 189 |
| 465 | 3300005614 | Ga0068856_100001104 | Ga0068856_10000110426 | 189 |
| 466 | 3300005614 | Ga0068856_100103190 | Ga0068856_1001031904 | 189 |
| 467 | 3300005614 | Ga0068856_100457618 | Ga0068856_1004576182 | 189 |
| 468 | 3300005842 | Ga0068858_100022763 | Ga0068858_1000227635 | 189 |
| 469 | 3300005842 | Ga0068858_100395669 | Ga0068858_1003956692 | 189 |
| 470 | 3300005843 | Ga0068860_100069966 | Ga0068860_1000699664 | 189 |
| 471 | 3300006038 | Ga0075365_10008092 | Ga0075365_100080923 | 189 |
| 472 | 3300006038 | Ga0075365_10022752 | Ga0075365_100227522 | 189 |
| 473 | 3300006038 | Ga0075365_10133630 | Ga0075365_101336302 | 189 |
| 474 | 3300006038 | Ga0075365_10228554 | Ga0075365_102285542 | 189 |
| 475 | 3300006038 | Ga0075365_10552867 | Ga0075365_105528671 | 189 |
| 476 | 3300006051 | Ga0075364_10135445 | Ga0075364_101354452 | 189 |
| 477 | 3300006051 | Ga0075364_10153855 | Ga0075364_101538551 | 189 |
| 478 | 3300006173 | Ga0070716_100034675 | Ga0070716_1000346752 | 189 |
| 479 | 3300006175 | Ga0070712_100001870 | Ga0070712_1000018709 | 189 |
| 480 | 3300006175 | Ga0070712_100007861 | Ga0070712_1000078615 | 189 |
| 481 | 3300006177 | Ga0075362_10371273 | Ga0075362_103712731 | 189 |
| 482 | 3300006178 | Ga0075367_10111931 | Ga0075367_101119312 | 189 |
| 483 | 3300006178 | Ga0075367_10362619 | Ga0075367_103626191 | 189 |
| 484 | 3300006237 | Ga0097621_101452061 | Ga0097621_1014520611 | 189 |
| 485 | 3300006353 | Ga0075370_10134098 | Ga0075370_101340982 | 189 |
| 486 | 3300006871 | Ga0075434_100061761 | Ga0075434_1000617613 | 189 |
| 487 | 3300006881 | Ga0068865_100236011 | Ga0068865_1002360112 | 189 |
| 488 | 3300006914 | Ga0075436_100000720 | Ga0075436_10000072010 | 189 |
| 489 | 3300006914 | Ga0075436_100005085 | Ga0075436_1000050859 | 189 |
| 490 | 3300006946 | Ga0079104_1000015 | Ga0079104_100001596 | 189 |
| 491 | 3300007076 | Ga0075435_100288332 | Ga0075435_1002883322 | 189 |
| 492 | 3300009093 | Ga0105240_10331478 | Ga0105240_103314782 | 189 |
| 493 | 3300009098 | Ga0105245_10738282 | Ga0105245_107382822 | 189 |
| 494 | 3300009148 | Ga0105243_10522164 | Ga0105243_105221642 | 189 |
| 495 | 3300009174 | Ga0105241_10277567 | Ga0105241_102775672 | 189 |
| 496 | 3300009545 | Ga0105237_10006681 | Ga0105237_100066817 | 189 |
| 497 | 3300009545 | Ga0105237_10094540 | Ga0105237_100945401 | 189 |
| 498 | 3300009551 | Ga0105238_10009161 | Ga0105238_100091617 | 189 |
| 499 | 3300010375 | Ga0105239_10196692 | Ga0105239_101966922 | 189 |
| 500 | 3300010375 | Ga0105239_10877570 | Ga0105239_108775702 | 189 |
| 501 | 3300013100 | Ga0157373_10004706 | Ga0157373_100047069 | 189 |
| 502 | 3300013104 | Ga0157370_10000726 | Ga0157370_100007261 | 189 |
| 503 | 3300013105 | Ga0157369_10003048 | Ga0157369_100030486 | 189 |
| 504 | 3300013105 | Ga0157369_10088602 | Ga0157369_100886022 | 189 |
| 505 | 3300013296 | Ga0157374_10537397 | Ga0157374_105373971 | 189 |
| 506 | 3300013297 | Ga0157378_11180109 | Ga0157378_111801092 | 189 |
| 507 | 3300013306 | Ga0163162_10124212 | Ga0163162_101242123 | 189 |
| 508 | 3300013306 | Ga0163162_10677947 | Ga0163162_106779472 | 189 |
| 509 | 3300013308 | Ga0157375_11286390 | Ga0157375_112863901 | 189 |
| 510 | 3300014325 | Ga0163163_10536821 | Ga0163163_105368212 | 189 |
| 511 | 3300014497 | Ga0182008_10019963 | Ga0182008_100199632 | 189 |
| 512 | 3300014497 | Ga0182008_10170103 | Ga0182008_101701031 | 189 |
| 513 | 3300014968 | Ga0157379_10006090 | Ga0157379_100060908 | 189 |
| 514 | 3300014968 | Ga0157379_10009377 | Ga0157379_1000937710 | 189 |
| 515 | 3300014968 | Ga0157379_10019447 | Ga0157379_100194478 | 189 |
| 516 | 3300014969 | Ga0157376_10356367 | Ga0157376_103563671 | 189 |
| 517 | 3300015261 | Ga0182006_1088117 | Ga0182006_10881172 | 189 |
| 518 | 3300022467 | Ga0224712_10069545 | Ga0224712_100695452 | 189 |
| 519 | 3300025254 | Ga0209148_1000032 | Ga0209148_1000032324 | 189 |
| 520 | 3300025254 | Ga0209148_1006034 | Ga0209148_10060341 | 189 |
| 521 | 3300025272 | Ga0209455_1000235 | Ga0209455_100023559 | 189 |
| 522 | 3300025906 | Ga0207699_10005327 | Ga0207699_100053276 | 189 |
| 523 | 3300025906 | Ga0207699_10132920 | Ga0207699_101329201 | 189 |
| 524 | 3300025907 | Ga0207645_10081036 | Ga0207645_100810361 | 189 |
| 525 | 3300025909 | Ga0207705_10125703 | Ga0207705_101257032 | 189 |
| 526 | 3300025911 | Ga0207654_10363649 | Ga0207654_103636492 | 189 |
| 527 | 3300025912 | Ga0207707_10000001 | Ga0207707_10000001239 | 189 |
| 528 | 3300025913 | Ga0207695_10140718 | Ga0207695_101407183 | 189 |
| 529 | 3300025913 | Ga0207695_10210451 | Ga0207695_102104512 | 189 |
| 530 | 3300025913 | Ga0207695_10786428 | Ga0207695_107864282 | 189 |
| 531 | 3300025914 | Ga0207671_10128703 | Ga0207671_101287032 | 189 |
| 532 | 3300025914 | Ga0207671_10246164 | Ga0207671_102461642 | 189 |
| 533 | 3300025915 | Ga0207693_10002910 | Ga0207693_100029109 | 189 |
| 534 | 3300025915 | Ga0207693_10006853 | Ga0207693_100068535 | 189 |
| 535 | 3300025916 | Ga0207663_10103240 | Ga0207663_101032402 | 189 |
| 536 | 3300025917 | Ga0207660_10000665 | Ga0207660_1000066524 | 189 |
| 537 | 3300025919 | Ga0207657_10298426 | Ga0207657_102984261 | 189 |
| 538 | 3300025921 | Ga0207652_10000363 | Ga0207652_100003632 | 189 |
| 539 | 3300025921 | Ga0207652_10283382 | Ga0207652_102833822 | 189 |
| 540 | 3300025924 | Ga0207694_10013789 | Ga0207694_100137897 | 189 |
| 541 | 3300025924 | Ga0207694_10548451 | Ga0207694_105484511 | 189 |
| 542 | 3300025928 | Ga0207700_10000972 | Ga0207700_1000097217 | 189 |
| 543 | 3300025929 | Ga0207664_10146300 | Ga0207664_101463002 | 189 |
| 544 | 3300025933 | Ga0207706_10561918 | Ga0207706_105619182 | 189 |
| 545 | 3300025935 | Ga0207709_10202432 | Ga0207709_102024322 | 189 |
| 546 | 3300025937 | Ga0207669_10066733 | Ga0207669_100667332 | 189 |
| 547 | 3300025937 | Ga0207669_10558116 | Ga0207669_105581161 | 189 |
| 548 | 3300025938 | Ga0207704_10110643 | Ga0207704_101106432 | 189 |
| 549 | 3300025939 | Ga0207665_10024569 | Ga0207665_100245696 | 189 |
| 550 | 3300025942 | Ga0207689_10023487 | Ga0207689_100234872 | 189 |
| 551 | 3300025945 | Ga0207679_10114199 | Ga0207679_101141992 | 189 |
| 552 | 3300025949 | Ga0207667_10003097 | Ga0207667_1000309717 | 189 |
| 553 | 3300025960 | Ga0207651_10413690 | Ga0207651_104136902 | 189 |
| 554 | 3300025972 | Ga0207668_10576174 | Ga0207668_105761742 | 189 |
| 555 | 3300025981 | Ga0207640_10294523 | Ga0207640_102945232 | 189 |
| 556 | 3300025986 | Ga0207658_10263590 | Ga0207658_102635902 | 189 |
| 557 | 3300026035 | Ga0207703_10283135 | Ga0207703_102831352 | 189 |
| 558 | 3300026041 | Ga0207639_10499416 | Ga0207639_104994162 | 189 |
| 559 | 3300026067 | Ga0207678_10545841 | Ga0207678_105458412 | 189 |
| 560 | 3300026078 | Ga0207702_10000182 | Ga0207702_1000018214 | 189 |
| 561 | 3300026078 | Ga0207702_10109063 | Ga0207702_101090632 | 189 |
| 562 | 3300026078 | Ga0207702_10308478 | Ga0207702_103084782 | 189 |
| 563 | 3300026089 | Ga0207648_10038561 | Ga0207648_100385613 | 189 |
| 564 | 3300026116 | Ga0207674_10000003 | Ga0207674_1000000391 | 189 |
| 565 | 3300026116 | Ga0207674_10293323 | Ga0207674_102933232 | 189 |
| 566 | 3300026118 | Ga0207675_101154430 | Ga0207675_1011544301 | 189 |
| 567 | 3300026142 | Ga0207698_10247023 | Ga0207698_102470232 | 189 |
| 568 | 3300027111 | Ga0209281_1000034 | Ga0209281_1000034371 | 189 |
| 569 | 3300028794 | Ga0307515_10000135 | Ga0307515_1000013543 | 189 |
| 570 | 3300028794 | Ga0307515_10607983 | Ga0307515_106079832 | 189 |
| 571 | 3300028800 | Ga0265338_10077160 | Ga0265338_100771604 | 189 |
| 572 | 3300028800 | Ga0265338_10734726 | Ga0265338_107347261 | 189 |
| 573 | 3300029957 | Ga0265324_10120647 | Ga0265324_101206471 | 189 |
| 574 | 3300031250 | Ga0265331_10032315 | Ga0265331_100323154 | 189 |
| 575 | 3300031344 | Ga0265316_10142424 | Ga0265316_101424242 | 189 |
| 576 | 3300031595 | Ga0265313_10043077 | Ga0265313_100430772 | 189 |
| 577 | 3300031649 | Ga0307514_10032680 | Ga0307514_100326802 | 189 |
| 578 | 3300031711 | Ga0265314_10088148 | Ga0265314_100881483 | 189 |
| 579 | 3300035111 | Ga0373923_0318477 | Ga0373923_0318477_23_604 | 189 |
| 580 | 3300035692 | Ga0373935_0116171 | Ga0373935_0116171_143_724 | 189 |
| 581 | 3300036401 | Ga0373937_0115038 | Ga0373937_0115038_1394_1975 | 189 |
| 582 | 3300036401 | Ga0373937_0142087 | Ga0373937_0142087_1615_2196 | 189 |
| 583 | 3300037068 | Ga0373925_0083414 | Ga0373925_0083414_27_608 | 189 |
| 584 | 3300046460 | Ga0495638_0055367 | Ga0495638_0055367_1070_1639 | 189 |
| 585 | 3300046472 | Ga0495580_0203140 | Ga0495580_0203140_726_1307 | 189 |
| 586 | 3300046500 | Ga0495596_0117712 | Ga0495596_0117712_52_621 | 189 |
| 587 | 3300046501 | Ga0495607_0112652 | Ga0495607_0112652_466_1035 | 189 |
| 588 | 3300046512 | Ga0495610_0097193 | Ga0495610_0097193_677_1246 | 189 |
| 589 | 3300046515 | Ga0495620_0061259 | Ga0495620_0061259_12_581 | 189 |
| 590 | 3300046519 | Ga0495632_0060453 | Ga0495632_0060453_437_1006 | 189 |
| 591 | 3300046522 | Ga0495643_0021764 | Ga0495643_0021764_1383_1952 | 189 |
| 592 | 3300046522 | Ga0495643_0079222 | Ga0495643_0079222_934_1503 | 189 |
| 593 | 3300046616 | Ga0495668_0016973 | Ga0495668_0016973_1659_2228 | 189 |
| 594 | 3300046679 | Ga0495623_0173937 | Ga0495623_0173937_115_696 | 189 |
| 595 | 3300047444 | Ga0495675_0081926 | Ga0495675_0081926_751_1329 | 189 |
| 596 | 3300047472 | Ga0495686_0264890 | Ga0495686_0264890_274_843 | 189 |
| 597 | 3300047472 | Ga0495686_0349062 | Ga0495686_0349062_35_646 | 189 |
| 598 | 3300048091 | Ga0495626_0104020 | Ga0495626_0104020_653_1222 | 189 |
| 599 | 3300048914 | Ga0496111_0382284 | Ga0496111_0382284_256_837 | 189 |
| 600 | 3300048915 | Ga0496112_0071701 | Ga0496112_0071701_1365_1934 | 189 |
| 601 | 3300048916 | Ga0496113_0485546 | Ga0496113_0485546_380_949 | 189 |
| 602 | 3300048922 | Ga0496119_0083930 | Ga0496119_0083930_185_754 | 189 |
| 603 | 3300048923 | Ga0496120_0047499 | Ga0496120_0047499_217_828 | 189 |
| 604 | 3300048924 | Ga0496121_0028932 | Ga0496121_0028932_4304_4873 | 189 |
| 605 | 3300048925 | Ga0496122_0000462 | Ga0496122_0000462_43367_43936 | 189 |
| 606 | 3300048926 | Ga0496123_0000048 | Ga0496123_0000048_40611_41180 | 189 |
| 607 | 3300048927 | Ga0496124_0129217 | Ga0496124_0129217_1279_1848 | 189 |
| 608 | 3300048929 | Ga0496126_0001325 | Ga0496126_0001325_36488_37075 | 189 |
| 609 | 3300049568 | Ga0501031_0283423 | Ga0501031_0283423_74_643 | 189 |
| 610 | 3300049571 | Ga0501034_0089094 | Ga0501034_0089094_472_1047 | 189 |
| 611 | 3300049571 | Ga0501034_0164635 | Ga0501034_0164635_1538_2119 | 189 |
| 612 | 3300049573 | Ga0501037_0286873 | Ga0501037_0286873_432_1013 | 189 |
| 613 | 3300049579 | Ga0501043_0082976 | Ga0501043_0082976_1384_1965 | 189 |
| 614 | 3300049581 | Ga0501047_0007507 | Ga0501047_0007507_8222_8803 | 189 |
| 615 | 3300049582 | Ga0501048_0121656 | Ga0501048_0121656_1182_1763 | 189 |
| 616 | 3300049583 | Ga0501067_0004466 | Ga0501067_0004466_3384_3965 | 189 |
| 617 | 3300049583 | Ga0501067_0017381 | Ga0501067_0017381_2847_3461 | 189 |
| 618 | 3300049585 | Ga0501069_0072901 | Ga0501069_0072901_1302_1883 | 189 |
| 619 | 3300049586 | Ga0501070_0007754 | Ga0501070_0007754_7129_7710 | 189 |
| 620 | 3300049586 | Ga0501070_0085394 | Ga0501070_0085394_494_1063 | 189 |
| 621 | 3300049588 | Ga0501072_0026799 | Ga0501072_0026799_1057_1671 | 189 |
| 622 | 3300049589 | Ga0501073_0007762 | Ga0501073_0007762_3288_3869 | 189 |
| 623 | 3300049590 | Ga0501074_0054892 | Ga0501074_0054892_1415_1996 | 189 |
| 624 | 3300049590 | Ga0501074_0329389 | Ga0501074_0329389_146_760 | 189 |
| 625 | 3300049741 | Ga0501079_0001199 | Ga0501079_0001199_8284_8865 | 189 |
| 626 | 3300049742 | Ga0501080_0164827 | Ga0501080_0164827_50_631 | 189 |
| 627 | 3300049742 | Ga0501080_0497348 | Ga0501080_0497348_110_679 | 189 |
| 628 | 3300049767 | Ga0501270_033293 | Ga0501270_033293_51_620 | 189 |
| 629 | 3300049822 | Ga0501035_0000859 | Ga0501035_0000859_9469_10038 | 189 |
| 630 | 3300049822 | Ga0501035_0007925 | Ga0501035_0007925_8091_8672 | 189 |
| 631 | 3300049822 | Ga0501035_0099079 | Ga0501035_0099079_341_919 | 189 |
| 632 | 3300049823 | Ga0501044_0012882 | Ga0501044_0012882_7001_7582 | 189 |
| 633 | 3300049823 | Ga0501044_0164723 | Ga0501044_0164723_785_1354 | 189 |
| 634 | 3300050491 | nmdc:mga00v17_374632_c1 | nmdc:mga00v17_374632_c1_167_736 | 189 |
| 635 | 3300050491 | nmdc:mga00v17_55880_c1 | nmdc:mga00v17_55880_c1_854_1423 | 189 |
| 636 | 3300050492 | nmdc:mga0yw44_512173_c1 | nmdc:mga0yw44_512173_c1_149_718 | 189 |
| 637 | 3300050493 | nmdc:mga0k408_470064_c1 | nmdc:mga0k408_470064_c1_49_618 | 189 |
| 638 | 3300050512 | nmdc:mga0n895_22304_c1 | nmdc:mga0n895_22304_c1_4495_5076 | 189 |
| 639 | 3300050513 | nmdc:mga0rr50_277539_c1 | nmdc:mga0rr50_277539_c1_580_1161 | 189 |
| 640 | 3300050514 | nmdc:mga08x19_89_c1 | nmdc:mga08x19_89_c1_74520_75101 | 189 |
| 641 | 3300053079 | Ga0500610_0023027 | Ga0500610_0023027_1289_1858 | 189 |
| 642 | 3300053083 | Ga0495655_0011775 | Ga0495655_0011775_493_1062 | 189 |
| 643 | 3300053086 | Ga0500578_0595362 | Ga0500578_0595362_18_587 | 189 |
| 644 | 3300053125 | Ga0500618_035559 | Ga0500618_035559_266_835 | 189 |
| 645 | 3300053133 | Ga0500655_007157 | Ga0500655_007157_552_1121 | 189 |
| 646 | 3300053151 | Ga0500604_0045268 | Ga0500604_0045268_348_917 | 189 |
| 647 | 3300053727 | Ga0500611_020812 | Ga0500611_020812_324_893 | 189 |
| 648 | 3300054114 | Ga0501084_0105471 | Ga0501084_0105471_864_1445 | 189 |
| 649 | 3300060353 | Ga0501082_0156508 | Ga0501082_0156508_1294_1908 | 189 |
| 650 | 3300060353 | Ga0501082_0876877 | Ga0501082_0876877_177_758 | 189 |
| 651 | iso_pu_bacteria | 2503198000 | 2503198310 | 189 |
| 652 | iso_pu_bacteria | 637000159 | 637077366 | 189 |
| 653 | 3300003214 | JGI25165J46597_1000147 | JGI25165J46597_1000147100 | 190 |
| 654 | 3300003214 | JGI25165J46597_1000206 | JGI25165J46597_100020680 | 190 |
| 655 | 3300003322 | rootL2_10117744 | rootL2_101177442 | 190 |
| 656 | 3300005367 | Ga0070667_100393315 | Ga0070667_1003933153 | 190 |
| 657 | 3300005458 | Ga0070681_10221711 | Ga0070681_102217113 | 190 |
| 658 | 3300005535 | Ga0070684_100284844 | Ga0070684_1002848442 | 190 |
| 659 | 3300005539 | Ga0068853_100022594 | Ga0068853_1000225942 | 190 |
| 660 | 3300005614 | Ga0068856_100092115 | Ga0068856_1000921153 | 190 |
| 661 | 3300005616 | Ga0068852_101063193 | Ga0068852_1010631931 | 190 |
| 662 | 3300009093 | Ga0105240_10096531 | Ga0105240_100965312 | 190 |
| 663 | 3300009174 | Ga0105241_10585030 | Ga0105241_105850302 | 190 |
| 664 | 3300009545 | Ga0105237_10064036 | Ga0105237_100640362 | 190 |
| 665 | 3300009545 | Ga0105237_10461265 | Ga0105237_104612652 | 190 |
| 666 | 3300009551 | Ga0105238_10009675 | Ga0105238_100096753 | 190 |
| 667 | 3300010375 | Ga0105239_10076398 | Ga0105239_100763983 | 190 |
| 668 | 3300010375 | Ga0105239_10236593 | Ga0105239_102365932 | 190 |
| 669 | 3300010375 | Ga0105239_10764425 | Ga0105239_107644251 | 190 |
| 670 | 3300013105 | Ga0157369_10306827 | Ga0157369_103068272 | 190 |
| 671 | 3300025261 | Ga0209233_1000034 | Ga0209233_1000034100 | 190 |
| 672 | 3300025294 | Ga0209025_1085908 | Ga0209025_10859081 | 190 |
| 673 | 3300025904 | Ga0207647_10019675 | Ga0207647_100196752 | 190 |
| 674 | 3300025911 | Ga0207654_10460724 | Ga0207654_104607242 | 190 |
| 675 | 3300025912 | Ga0207707_10384779 | Ga0207707_103847792 | 190 |
| 676 | 3300025913 | Ga0207695_10216764 | Ga0207695_102167642 | 190 |
| 677 | 3300025914 | Ga0207671_10022974 | Ga0207671_100229742 | 190 |
| 678 | 3300025914 | Ga0207671_10292990 | Ga0207671_102929901 | 190 |
| 679 | 3300025924 | Ga0207694_10003257 | Ga0207694_100032576 | 190 |
| 680 | 3300025944 | Ga0207661_10736880 | Ga0207661_107368802 | 190 |
| 681 | 3300026041 | Ga0207639_10003680 | Ga0207639_1000368010 | 190 |
| 682 | 3300026078 | Ga0207702_10899645 | Ga0207702_108996451 | 190 |
| 683 | 3300026116 | Ga0207674_10322230 | Ga0207674_103222302 | 190 |
| 684 | 3300026142 | Ga0207698_10082986 | Ga0207698_100829862 | 190 |
| 685 | 3300028800 | Ga0265338_10012850 | Ga0265338_100128509 | 190 |
| 686 | 3300029957 | Ga0265324_10034856 | Ga0265324_100348561 | 190 |
| 687 | 3300031238 | Ga0265332_10019146 | Ga0265332_100191463 | 190 |
| 688 | 3300031241 | Ga0265325_10066570 | Ga0265325_100665702 | 190 |
| 689 | 3300031242 | Ga0265329_10163114 | Ga0265329_101631141 | 190 |
| 690 | 3300031249 | Ga0265339_10002104 | Ga0265339_1000210415 | 190 |
| 691 | 3300031344 | Ga0265316_10091967 | Ga0265316_100919671 | 190 |
| 692 | 3300031595 | Ga0265313_10005068 | Ga0265313_100050682 | 190 |
| 693 | 3300037418 | Ga0395900_0161871 | Ga0395900_0161871_153_725 | 190 |
| 694 | 3300037471 | Ga0395905_0103611 | Ga0395905_0103611_1994_2566 | 190 |
| 695 | 3300037471 | Ga0395905_0285902 | Ga0395905_0285902_379_960 | 190 |
| 696 | 3300037471 | Ga0395905_0310119 | Ga0395905_0310119_425_997 | 190 |
| 697 | 3300038443 | Ga0395901_0046061 | Ga0395901_0046061_313_885 | 190 |
| 698 | 3300044658 | Ga0466972_0148224 | Ga0466972_0148224_254_826 | 190 |
| 699 | 3300044683 | Ga0466965_0082735 | Ga0466965_0082735_727_1299 | 190 |
| 700 | 3300044765 | Ga0466970_0225636 | Ga0466970_0225636_288_860 | 190 |
| 701 | 3300044901 | Ga0466960_0365316 | Ga0466960_0365316_138_710 | 190 |
| 702 | 3300048905 | Ga0496102_0400423 | Ga0496102_0400423_709_1281 | 190 |
| 703 | 3300048906 | Ga0496103_0288867 | Ga0496103_0288867_331_903 | 190 |
| 704 | 3300048915 | Ga0496112_0121106 | Ga0496112_0121106_1255_1827 | 190 |
| 705 | 3300048922 | Ga0496119_0199566 | Ga0496119_0199566_280_852 | 190 |
| 706 | 3300048923 | Ga0496120_0005277 | Ga0496120_0005277_6519_7091 | 190 |
| 707 | 3300048927 | Ga0496124_0391585 | Ga0496124_0391585_222_794 | 190 |
| 708 | 3300048928 | Ga0496125_0028346 | Ga0496125_0028346_1130_1702 | 190 |
| 709 | 3300050494 | nmdc:mga06z11_98647_c1 | nmdc:mga06z11_98647_c1_630_1202 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gsw-assembly2.cif.gz_D | crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 | 0.8745 | 6 | 182 |
| 2q62-assembly1.cif.gz_D | crystal structure of arsh from sinorhizobium meliloti | 0.8634 | 2 | 180 |
| 3gfs-assembly1.cif.gz_A | structure of yhda, k109d/d137k variant | 0.8629 | 6 | 181 |
| 3gfq-assembly1.cif.gz_A | structure of yhda, k109l variant | 0.8619 | 6 | 182 |
| 2gsw-assembly2.cif.gz_D | crystal structure of the putative nadph-dependent azobenzene fmn-reductase yhda from bacillus subtilis, northeast structural genomics target sr135 | 0.8601 | 6 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gswD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8654 | 7 | 182 | 3.40.50.360 |
| af_Q54QT4_9_187_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.864 | 5 | 173 | 3.40.50.360 |
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8538 | 4 | 168 | 3.40.50.360 |
| af_Q2G135_1_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8519 | 3 | 184 | 3.40.50.360 |
| 2fzvC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8509 | 3 | 189 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F7Y0G5-F1-model_v4 | NADPH-dependent FMN reductase | 0.9943 | 2 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A6M7V943-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9938 | 1 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-V7HJH4-F1-model_v4 | NADPH-dependent FMN reductase | 0.9938 | 1 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A4R9Z2D4-F1-model_v4 | deleted | 0.9936 | 1 | 188 |
|
| AF-A0A4S0SGF3-F1-model_v4 | NAD(P)H-dependent oxidoreductase | 0.9935 | 1 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar