F476626
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 355 | 1416 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300049578|Ga0501042_0644272|Ga0501042_0644272_52_534 |
| Length | 160 |
| Sequence | LHGDGSLTWYHRKKMPRNLSDRLRQREWRLTAQRRIVAEVLEGEHVHLTADEVYRRAVARLPEISRATVYNTLKELTDLGEVLEVTIDARAKRFDPNAKDPHQHLVCERCGVIRDVHLEARPGPMLPAGERHGFVLTAADIVFRGVCPACAGKQDRRKRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 18 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 22 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 23 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 24 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 25 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 26 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 47 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 49 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 71 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 72 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 73 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 74 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 75 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 76 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 77 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 79 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 80 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 81 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 84 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 85 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 86 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 87 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 88 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 89 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 90 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 91 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 92 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 93 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 94 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 95 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 96 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 97 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 98 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 99 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 100 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 101 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 102 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 103 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 104 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 105 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 106 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 107 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 110 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 111 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 112 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 113 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 114 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 115 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 201 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 212 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 213 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 244 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 261 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 262 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 263 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 264 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 265 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 266 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 267 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 268 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 270 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 271 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 282 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 283 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 284 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 285 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 286 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 287 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 288 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 289 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 290 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 291 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 292 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 293 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 294 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 295 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 296 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 297 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 298 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 299 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 300 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 301 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 302 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 303 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 304 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 305 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 306 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 307 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 308 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 309 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 310 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 311 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 312 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 313 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 314 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 315 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 316 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 317 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 318 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 319 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 320 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 321 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 322 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 323 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 324 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 325 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 326 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 327 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 328 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 329 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 330 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 331 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 332 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 333 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 334 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 335 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 336 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 337 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 338 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 339 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 340 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 341 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 342 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 343 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 344 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 345 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 346 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 347 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 348 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 349 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 350 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 351 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 352 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 353 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 354 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 355 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.45 |
| Metatranscriptomes | 2.26 |
| Isolates | 12.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.53 |
| Nodule | 0.71 |
| Rhizoplane | 2.54 |
| Rhizosphere | 85.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501042_0644272 | 3300049578 | Unclassified | 770 |
| 2 | JGI24739J22299_10132641 | 3300001989 | Bacteria | 740 |
| 3 | JGI24737J22298_10067564 | 3300001990 | Bacteria | 1069 |
| 4 | rootH1_10019195 | 3300003316 | Bacteria | 3884 |
| 5 | rootH2_10060685 | 3300003320 | Bacteria | 2188 |
| 6 | rootH1_10091162 | 3300003323 | Bacteria | 1685 |
| 7 | JGI25160J50197_1009351 | 3300003354 | Bacteria | 3644 |
| 8 | JGI25160J50197_1009544 | 3300003354 | Bacteria | 3588 |
| 9 | JGI25160J50197_1091987 | 3300003354 | Bacteria | 549 |
| 10 | Ga0070690_101210393 | 3300005330 | Unclassified | 603 |
| 11 | Ga0070680_101183313 | 3300005336 | Bacteria | 661 |
| 12 | Ga0068868_101508957 | 3300005338 | Bacteria | 629 |
| 13 | Ga0070668_101799039 | 3300005347 | Bacteria | 563 |
| 14 | Ga0070678_101986934 | 3300005456 | Bacteria | 550 |
| 15 | Ga0070681_11476556 | 3300005458 | Bacteria | 604 |
| 16 | Ga0070686_100410756 | 3300005544 | Bacteria | 1032 |
| 17 | Ga0070704_100438118 | 3300005549 | Bacteria | 1122 |
| 18 | Ga0068855_100075048 | 3300005563 | Bacteria | 3926 |
| 19 | Ga0068855_100132732 | 3300005563 | Bacteria | 2843 |
| 20 | Ga0068854_101714125 | 3300005578 | Bacteria | 575 |
| 21 | Ga0068856_100484683 | 3300005614 | Bacteria | 1258 |
| 22 | Ga0068859_100303123 | 3300005617 | Bacteria | 1691 |
| 23 | Ga0068864_100134844 | 3300005618 | Bacteria | 2222 |
| 24 | Ga0068870_10353475 | 3300005840 | Bacteria | 944 |
| 25 | Ga0068858_101029214 | 3300005842 | Bacteria | 807 |
| 26 | Ga0068862_101813230 | 3300005844 | Unclassified | 619 |
| 27 | Ga0068865_100353000 | 3300006881 | Bacteria | 1192 |
| 28 | Ga0075436_100188405 | 3300006914 | Bacteria | 1459 |
| 29 | Ga0097620_100303129 | 3300006931 | Bacteria | 1691 |
| 30 | Ga0099826_10067827 | 3300006948 | Bacteria | 2281 |
| 31 | Ga0105240_10027872 | 3300009093 | Bacteria | 7390 |
| 32 | Ga0111539_10106652 | 3300009094 | Bacteria | 3287 |
| 33 | Ga0105245_10257993 | 3300009098 | Bacteria | 1695 |
| 34 | Ga0105245_12226492 | 3300009098 | Bacteria | 602 |
| 35 | Ga0105243_10398119 | 3300009148 | Bacteria | 1278 |
| 36 | Ga0105242_10998858 | 3300009176 | Bacteria | 844 |
| 37 | Ga0105242_11665724 | 3300009176 | Unclassified | 673 |
| 38 | Ga0105248_10642371 | 3300009177 | Bacteria | 1197 |
| 39 | Ga0105238_10522624 | 3300009551 | Bacteria | 1189 |
| 40 | Ga0105246_10249858 | 3300011119 | Bacteria | 1407 |
| 41 | Ga0157313_1027653 | 3300012503 | Bacteria | 623 |
| 42 | Ga0157369_10087579 | 3300013105 | Bacteria | 3325 |
| 43 | Ga0157374_10773822 | 3300013296 | Bacteria | 975 |
| 44 | Ga0157378_10975161 | 3300013297 | Bacteria | 881 |
| 45 | Ga0163162_10071458 | 3300013306 | Bacteria | 3523 |
| 46 | Ga0163162_12149436 | 3300013306 | Bacteria | 640 |
| 47 | Ga0157372_10208360 | 3300013307 | Bacteria | 2265 |
| 48 | Ga0157375_10605617 | 3300013308 | Bacteria | 1254 |
| 49 | Ga0157375_10725291 | 3300013308 | Bacteria | 1146 |
| 50 | Ga0157376_10263507 | 3300014969 | Bacteria | 1616 |
| 51 | Ga0182006_1017034 | 3300015261 | Bacteria | 3093 |
| 52 | Ga0182007_10002422 | 3300015262 | Bacteria | 9315 |
| 53 | Ga0206355_1208892 | 3300020076 | Bacteria | 1013 |
| 54 | Ga0206353_10306429 | 3300020082 | Bacteria | 507 |
| 55 | Ga0213875_10052410 | 3300021388 | Bacteria | 1911 |
| 56 | Ga0209758_1013617 | 3300025297 | Bacteria | 4413 |
| 57 | Ga0207426_1000396 | 3300025302 | Bacteria | 74072 |
| 58 | Ga0207426_1001513 | 3300025302 | Bacteria | 18969 |
| 59 | Ga0207426_1002187 | 3300025302 | Bacteria | 13196 |
| 60 | Ga0207426_1005153 | 3300025302 | Bacteria | 6084 |
| 61 | Ga0207426_1006361 | 3300025302 | Bacteria | 5153 |
| 62 | Ga0207426_1038653 | 3300025302 | Bacteria | 1501 |
| 63 | Ga0207426_1130571 | 3300025302 | Bacteria | 609 |
| 64 | Ga0207696_1040208 | 3300025711 | Bacteria | 1370 |
| 65 | Ga0207710_10220129 | 3300025900 | Bacteria | 942 |
| 66 | Ga0207688_10651880 | 3300025901 | Bacteria | 665 |
| 67 | Ga0207647_10005240 | 3300025904 | Bacteria | 9543 |
| 68 | Ga0207707_10550293 | 3300025912 | Bacteria | 980 |
| 69 | Ga0207695_10038526 | 3300025913 | Bacteria | 5145 |
| 70 | Ga0207686_10473785 | 3300025934 | Bacteria | 967 |
| 71 | Ga0207709_10306891 | 3300025935 | Bacteria | 1182 |
| 72 | Ga0207667_10075912 | 3300025949 | Bacteria | 3488 |
| 73 | Ga0207667_10408358 | 3300025949 | Bacteria | 1382 |
| 74 | Ga0207668_12059916 | 3300025972 | Bacteria | 514 |
| 75 | Ga0207640_10069392 | 3300025981 | Bacteria | 2366 |
| 76 | Ga0207703_11505356 | 3300026035 | Unclassified | 647 |
| 77 | Ga0207639_11632252 | 3300026041 | Bacteria | 605 |
| 78 | Ga0207648_10693005 | 3300026089 | Bacteria | 944 |
| 79 | Ga0207676_10640184 | 3300026095 | Bacteria | 1025 |
| 80 | Ga0209371_1067381 | 3300027312 | Bacteria | 643 |
| 81 | Ga0209282_1100910 | 3300027666 | Bacteria | 1486 |
| 82 | Ga0207428_11035629 | 3300027907 | Unclassified | 576 |
| 83 | Ga0268256_1018141 | 3300030500 | Bacteria | 1963 |
| 84 | Ga0307511_10074842 | 3300030521 | Bacteria | 2437 |
| 85 | Ga0307512_10004518 | 3300030522 | Bacteria | 15212 |
| 86 | Ga0307508_10006837 | 3300031616 | Bacteria | 10669 |
| 87 | Ga0307508_10063623 | 3300031616 | Bacteria | 3254 |
| 88 | Ga0307514_10059521 | 3300031649 | Bacteria | 2918 |
| 89 | Ga0307514_10079423 | 3300031649 | Bacteria | 2432 |
| 90 | Ga0316577_10807722 | 3300031733 | Unclassified | 532 |
| 91 | Ga0307518_10063769 | 3300031838 | Bacteria | 2674 |
| 92 | Ga0307518_10185994 | 3300031838 | Bacteria | 1398 |
| 93 | Ga0307416_101605613 | 3300032002 | Bacteria | 755 |
| 94 | Ga0307416_103035409 | 3300032002 | Bacteria | 562 |
| 95 | Ga0316593_10109099 | 3300032168 | Bacteria | 987 |
| 96 | Ga0316593_10167277 | 3300032168 | Bacteria | 805 |
| 97 | Ga0316593_10301246 | 3300032168 | Unclassified | 607 |
| 98 | Ga0307507_10045296 | 3300033179 | Bacteria | 4330 |
| 99 | Ga0307510_10230001 | 3300033180 | Bacteria | 1357 |
| 100 | Ga0307510_10406999 | 3300033180 | Bacteria | 803 |
| 101 | Ga0395898_0003092 | 3300037466 | Bacteria | 18832 |
| 102 | Ga0395898_0230829 | 3300037466 | Bacteria | 1765 |
| 103 | Ga0395898_0396822 | 3300037466 | Bacteria | 1315 |
| 104 | Ga0436364_1242868 | 3300037853 | Bacteria | 2666 |
| 105 | Ga0395901_0074271 | 3300038443 | Bacteria | 3547 |
| 106 | Ga0395901_0507829 | 3300038443 | Bacteria | 1227 |
| 107 | Ga0439436_0002729 | 3300041404 | Bacteria | 5333 |
| 108 | Ga0439436_0003166 | 3300041404 | Bacteria | 4989 |
| 109 | Ga0439439_0033271 | 3300041406 | Bacteria | 1319 |
| 110 | Ga0439453_0124307 | 3300041408 | Bacteria | 594 |
| 111 | Ga0451853_2009427 | 3300041512 | Bacteria | 2464 |
| 112 | Ga0439433_0002860 | 3300041999 | Bacteria | 3688 |
| 113 | Ga0439433_0036333 | 3300041999 | Bacteria | 1138 |
| 114 | Ga0439448_0004898 | 3300042005 | Bacteria | 3799 |
| 115 | Ga0439448_0024821 | 3300042005 | Bacteria | 1877 |
| 116 | Ga0439432_040878 | 3300042006 | Bacteria | 1470 |
| 117 | Ga0439449_0000358 | 3300042007 | Bacteria | 16753 |
| 118 | Ga0439449_0120838 | 3300042007 | Bacteria | 972 |
| 119 | Ga0439449_0264335 | 3300042007 | Bacteria | 647 |
| 120 | Ga0439450_044395 | 3300042008 | Bacteria | 1041 |
| 121 | Ga0439454_016112 | 3300042011 | Bacteria | 1053 |
| 122 | Ga0439455_0010286 | 3300042012 | Bacteria | 2055 |
| 123 | Ga0439457_002398 | 3300042014 | Bacteria | 5357 |
| 124 | Ga0439457_004233 | 3300042014 | Bacteria | 3778 |
| 125 | Ga0439462_0028590 | 3300042015 | Bacteria | 1474 |
| 126 | Ga0450920_114001 | 3300042122 | Bacteria | 565 |
| 127 | Ga0450897_009761 | 3300042128 | Bacteria | 913 |
| 128 | Ga0450894_000136 | 3300042131 | Bacteria | 12932 |
| 129 | Ga0450898_000424 | 3300042134 | Bacteria | 4906 |
| 130 | Ga0450898_025572 | 3300042134 | Bacteria | 1060 |
| 131 | Ga0450902_008532 | 3300042137 | Bacteria | 1602 |
| 132 | Ga0450903_000233 | 3300042138 | Bacteria | 12380 |
| 133 | Ga0450906_018467 | 3300042145 | Bacteria | 1251 |
| 134 | Ga0450907_013840 | 3300042146 | Bacteria | 1345 |
| 135 | Ga0439458_0018008 | 3300042157 | Bacteria | 1615 |
| 136 | Ga0450901_012411 | 3300042533 | Bacteria | 889 |
| 137 | Ga0466969_0012190 | 3300044656 | Bacteria | 4542 |
| 138 | Ga0466969_0083017 | 3300044656 | Bacteria | 1526 |
| 139 | Ga0466972_0004064 | 3300044658 | Bacteria | 7302 |
| 140 | Ga0466972_0004540 | 3300044658 | Bacteria | 6952 |
| 141 | Ga0466972_0023472 | 3300044658 | Bacteria | 3067 |
| 142 | Ga0466972_0067178 | 3300044658 | Bacteria | 1713 |
| 143 | Ga0466972_0109751 | 3300044658 | Bacteria | 1304 |
| 144 | Ga0466965_0031059 | 3300044683 | Bacteria | 2603 |
| 145 | Ga0466966_0003918 | 3300044684 | Bacteria | 9828 |
| 146 | Ga0466966_0008100 | 3300044684 | Bacteria | 6967 |
| 147 | Ga0466966_0027375 | 3300044684 | Bacteria | 3717 |
| 148 | Ga0466966_0354438 | 3300044684 | Bacteria | 882 |
| 149 | Ga0466961_0017066 | 3300044693 | Bacteria | 4662 |
| 150 | Ga0466961_0023342 | 3300044693 | Bacteria | 3980 |
| 151 | Ga0466961_0062455 | 3300044693 | Bacteria | 2367 |
| 152 | Ga0466961_0073046 | 3300044693 | Bacteria | 2175 |
| 153 | Ga0466961_0080676 | 3300044693 | Bacteria | 2059 |
| 154 | Ga0466963_0000213 | 3300044694 | Bacteria | 24764 |
| 155 | Ga0466963_0003003 | 3300044694 | Bacteria | 9546 |
| 156 | Ga0466963_0039151 | 3300044694 | Bacteria | 3104 |
| 157 | Ga0466964_0012547 | 3300044706 | Bacteria | 3207 |
| 158 | Ga0466964_0025974 | 3300044706 | Bacteria | 2290 |
| 159 | Ga0466971_0000575 | 3300044719 | Bacteria | 14492 |
| 160 | Ga0466971_0001207 | 3300044719 | Bacteria | 10748 |
| 161 | Ga0466971_0172792 | 3300044719 | Bacteria | 1014 |
| 162 | Ga0466970_0001274 | 3300044765 | Bacteria | 12183 |
| 163 | Ga0466970_0006583 | 3300044765 | Bacteria | 5810 |
| 164 | Ga0466970_0177661 | 3300044765 | Bacteria | 1181 |
| 165 | Ga0466970_0185410 | 3300044765 | Bacteria | 1155 |
| 166 | Ga0466970_0570321 | 3300044765 | Bacteria | 655 |
| 167 | Ga0466970_0860022 | 3300044765 | Bacteria | 532 |
| 168 | Ga0466957_0023199 | 3300044842 | Bacteria | 3666 |
| 169 | Ga0466957_0484362 | 3300044842 | Bacteria | 856 |
| 170 | Ga0466960_0102207 | 3300044901 | Bacteria | 1478 |
| 171 | Ga0466960_0236237 | 3300044901 | Bacteria | 1010 |
| 172 | Ga0466959_0002515 | 3300045049 | Bacteria | 11755 |
| 173 | Ga0466959_0003363 | 3300045049 | Bacteria | 10451 |
| 174 | Ga0466959_0029667 | 3300045049 | Bacteria | 4053 |
| 175 | Ga0466959_0728170 | 3300045049 | Bacteria | 664 |
| 176 | Ga0466958_0082986 | 3300045836 | Bacteria | 1974 |
| 177 | Ga0466958_0323776 | 3300045836 | Bacteria | 991 |
| 178 | Ga0466958_0877133 | 3300045836 | Bacteria | 585 |
| 179 | Ga0466967_0052759 | 3300045976 | Bacteria | 3571 |
| 180 | Ga0466967_0192631 | 3300045976 | Bacteria | 1927 |
| 181 | Ga0466967_0212446 | 3300045976 | Bacteria | 1835 |
| 182 | Ga0466967_1401693 | 3300045976 | Bacteria | 696 |
| 183 | Ga0495617_082112 | 3300046452 | Bacteria | 1055 |
| 184 | Ga0495627_064266 | 3300046453 | Bacteria | 1080 |
| 185 | Ga0495592_0000574 | 3300046454 | Bacteria | 26037 |
| 186 | Ga0495592_0028509 | 3300046454 | Bacteria | 4228 |
| 187 | Ga0495592_0210741 | 3300046454 | Bacteria | 1305 |
| 188 | Ga0495603_0028210 | 3300046455 | Bacteria | 3385 |
| 189 | Ga0495603_0234590 | 3300046455 | Bacteria | 1057 |
| 190 | Ga0495603_0272480 | 3300046455 | Bacteria | 973 |
| 191 | Ga0495603_0341877 | 3300046455 | Bacteria | 858 |
| 192 | Ga0495629_0000405 | 3300046459 | Bacteria | 36057 |
| 193 | Ga0495629_0002819 | 3300046459 | Bacteria | 13265 |
| 194 | Ga0495629_0009074 | 3300046459 | Bacteria | 7287 |
| 195 | Ga0495629_0013612 | 3300046459 | Bacteria | 5869 |
| 196 | Ga0495629_0078601 | 3300046459 | Bacteria | 2303 |
| 197 | Ga0495629_0121152 | 3300046459 | Bacteria | 1822 |
| 198 | Ga0495629_0384081 | 3300046459 | Bacteria | 955 |
| 199 | Ga0495638_0101286 | 3300046460 | Bacteria | 1722 |
| 200 | Ga0495638_0626291 | 3300046460 | Bacteria | 525 |
| 201 | Ga0495651_0056038 | 3300046462 | Bacteria | 3028 |
| 202 | Ga0495651_0102999 | 3300046462 | Bacteria | 2121 |
| 203 | Ga0495651_0259698 | 3300046462 | Bacteria | 1182 |
| 204 | Ga0495653_0061599 | 3300046463 | Bacteria | 2838 |
| 205 | Ga0495580_0098754 | 3300046472 | Bacteria | 2031 |
| 206 | Ga0495582_0100885 | 3300046473 | Bacteria | 1616 |
| 207 | Ga0495582_0181594 | 3300046473 | Bacteria | 1199 |
| 208 | Ga0495582_0647639 | 3300046473 | Bacteria | 611 |
| 209 | Ga0495605_0004096 | 3300046474 | Bacteria | 8602 |
| 210 | Ga0495639_0018492 | 3300046475 | Bacteria | 3035 |
| 211 | Ga0495639_0092804 | 3300046475 | Bacteria | 1418 |
| 212 | Ga0495662_0000154 | 3300046476 | Bacteria | 27091 |
| 213 | Ga0495662_0012526 | 3300046476 | Bacteria | 4137 |
| 214 | Ga0495662_0013250 | 3300046476 | Bacteria | 4013 |
| 215 | Ga0495662_0018848 | 3300046476 | Bacteria | 3339 |
| 216 | Ga0495662_0026659 | 3300046476 | Bacteria | 2790 |
| 217 | Ga0495662_0035348 | 3300046476 | Bacteria | 2411 |
| 218 | Ga0495662_0039446 | 3300046476 | Bacteria | 2281 |
| 219 | Ga0495662_0101601 | 3300046476 | Bacteria | 1406 |
| 220 | Ga0495664_0004639 | 3300046477 | Bacteria | 7514 |
| 221 | Ga0495664_0031093 | 3300046477 | Bacteria | 3128 |
| 222 | Ga0495664_0202095 | 3300046477 | Bacteria | 1204 |
| 223 | Ga0495664_0554005 | 3300046477 | Bacteria | 685 |
| 224 | Ga0495584_0393895 | 3300046491 | Bacteria | 704 |
| 225 | Ga0495585_0019750 | 3300046492 | Bacteria | 3882 |
| 226 | Ga0495585_0118469 | 3300046492 | Bacteria | 1402 |
| 227 | Ga0495585_0147331 | 3300046492 | Bacteria | 1229 |
| 228 | Ga0495594_0005107 | 3300046499 | Bacteria | 6755 |
| 229 | Ga0495594_0026114 | 3300046499 | Bacteria | 3140 |
| 230 | Ga0495594_0078134 | 3300046499 | Bacteria | 1846 |
| 231 | Ga0495594_0861964 | 3300046499 | Bacteria | 509 |
| 232 | Ga0495607_0170128 | 3300046501 | Bacteria | 1101 |
| 233 | Ga0495583_0061262 | 3300046506 | Bacteria | 1679 |
| 234 | Ga0495583_0180048 | 3300046506 | Bacteria | 866 |
| 235 | Ga0495608_0005526 | 3300046511 | Bacteria | 9028 |
| 236 | Ga0495608_0129963 | 3300046511 | Bacteria | 1612 |
| 237 | Ga0495610_0074964 | 3300046512 | Bacteria | 1568 |
| 238 | Ga0495616_0061904 | 3300046513 | Bacteria | 1834 |
| 239 | Ga0495618_0022418 | 3300046514 | Bacteria | 3900 |
| 240 | Ga0495618_0886815 | 3300046514 | Bacteria | 515 |
| 241 | Ga0495620_0016425 | 3300046515 | Bacteria | 3714 |
| 242 | Ga0495628_0005810 | 3300046516 | Bacteria | 10806 |
| 243 | Ga0495628_0158132 | 3300046516 | Bacteria | 1723 |
| 244 | Ga0495628_0178311 | 3300046516 | Bacteria | 1608 |
| 245 | Ga0495630_0033011 | 3300046517 | Bacteria | 3860 |
| 246 | Ga0495630_0033921 | 3300046517 | Bacteria | 3807 |
| 247 | Ga0495631_0018548 | 3300046518 | Bacteria | 3273 |
| 248 | Ga0495631_0047678 | 3300046518 | Bacteria | 1880 |
| 249 | Ga0495637_0047011 | 3300046520 | Bacteria | 1824 |
| 250 | Ga0495637_0370716 | 3300046520 | Bacteria | 500 |
| 251 | Ga0495644_0410340 | 3300046523 | Bacteria | 537 |
| 252 | Ga0495648_0030330 | 3300046524 | Bacteria | 3577 |
| 253 | Ga0495666_0007896 | 3300046526 | Bacteria | 5329 |
| 254 | Ga0495652_0030071 | 3300046529 | Bacteria | 4766 |
| 255 | Ga0495652_0037557 | 3300046529 | Bacteria | 4201 |
| 256 | Ga0495652_0111389 | 3300046529 | Bacteria | 2201 |
| 257 | Ga0495652_0175580 | 3300046529 | Bacteria | 1649 |
| 258 | Ga0495665_0013928 | 3300046531 | Bacteria | 4343 |
| 259 | Ga0495665_0046977 | 3300046531 | Bacteria | 2291 |
| 260 | Ga0495665_0457515 | 3300046531 | Bacteria | 645 |
| 261 | Ga0495640_0010190 | 3300046533 | Bacteria | 7274 |
| 262 | Ga0495640_0035770 | 3300046533 | Bacteria | 3513 |
| 263 | Ga0495640_0083077 | 3300046533 | Bacteria | 2126 |
| 264 | Ga0495640_0536599 | 3300046533 | Bacteria | 710 |
| 265 | Ga0495586_0027327 | 3300046535 | Bacteria | 3053 |
| 266 | Ga0495586_0092894 | 3300046535 | Bacteria | 1668 |
| 267 | Ga0495587_0003221 | 3300046536 | Bacteria | 10913 |
| 268 | Ga0495587_0018256 | 3300046536 | Bacteria | 4351 |
| 269 | Ga0495609_0074505 | 3300046538 | Bacteria | 1488 |
| 270 | Ga0495609_0147933 | 3300046538 | Bacteria | 1000 |
| 271 | Ga0495609_0159745 | 3300046538 | Bacteria | 956 |
| 272 | Ga0495597_0032768 | 3300046542 | Bacteria | 2356 |
| 273 | Ga0495645_0032240 | 3300046543 | Bacteria | 3821 |
| 274 | Ga0495645_0050882 | 3300046543 | Bacteria | 3014 |
| 275 | Ga0495622_0022237 | 3300046557 | Bacteria | 2954 |
| 276 | Ga0495622_0024901 | 3300046557 | Bacteria | 2794 |
| 277 | Ga0495622_0045253 | 3300046557 | Bacteria | 2045 |
| 278 | Ga0495622_0334794 | 3300046557 | Bacteria | 656 |
| 279 | Ga0495633_0032976 | 3300046558 | Bacteria | 2499 |
| 280 | Ga0495667_0009330 | 3300046559 | Bacteria | 6648 |
| 281 | Ga0495667_0320136 | 3300046559 | Bacteria | 981 |
| 282 | Ga0495668_0079355 | 3300046616 | Bacteria | 1801 |
| 283 | Ga0495634_0005531 | 3300046642 | Bacteria | 9699 |
| 284 | Ga0495634_0015826 | 3300046642 | Bacteria | 5405 |
| 285 | Ga0495634_0054603 | 3300046642 | Bacteria | 2673 |
| 286 | Ga0495634_0067825 | 3300046642 | Bacteria | 2358 |
| 287 | Ga0495634_0161036 | 3300046642 | Bacteria | 1415 |
| 288 | Ga0495611_0023607 | 3300046648 | Bacteria | 2670 |
| 289 | Ga0495611_0100820 | 3300046648 | Bacteria | 1341 |
| 290 | Ga0495611_0117844 | 3300046648 | Bacteria | 1237 |
| 291 | Ga0495625_0097561 | 3300046660 | Bacteria | 2022 |
| 292 | Ga0495625_0469010 | 3300046660 | Bacteria | 775 |
| 293 | Ga0495635_0098428 | 3300046663 | Bacteria | 1999 |
| 294 | Ga0495635_0201024 | 3300046663 | Bacteria | 1351 |
| 295 | Ga0495661_0027671 | 3300046665 | Bacteria | 3637 |
| 296 | Ga0495588_0001268 | 3300046674 | Bacteria | 10834 |
| 297 | Ga0495588_0115384 | 3300046674 | Bacteria | 1415 |
| 298 | Ga0495588_0299011 | 3300046674 | Bacteria | 847 |
| 299 | Ga0495588_0516029 | 3300046674 | Bacteria | 626 |
| 300 | Ga0495657_0001214 | 3300046675 | Bacteria | 22612 |
| 301 | Ga0495657_0013555 | 3300046675 | Bacteria | 6009 |
| 302 | Ga0495657_0020442 | 3300046675 | Bacteria | 4757 |
| 303 | Ga0495657_0100978 | 3300046675 | Bacteria | 1838 |
| 304 | Ga0495657_0124798 | 3300046675 | Bacteria | 1618 |
| 305 | Ga0495657_0282724 | 3300046675 | Bacteria | 992 |
| 306 | Ga0495599_0194168 | 3300046678 | Bacteria | 1248 |
| 307 | Ga0495599_0202379 | 3300046678 | Bacteria | 1219 |
| 308 | Ga0495599_0559247 | 3300046678 | Bacteria | 669 |
| 309 | Ga0495623_0042876 | 3300046679 | Bacteria | 2880 |
| 310 | Ga0495623_0062226 | 3300046679 | Bacteria | 2339 |
| 311 | Ga0495623_0171290 | 3300046679 | Bacteria | 1268 |
| 312 | Ga0495646_0004598 | 3300046680 | Bacteria | 8699 |
| 313 | Ga0495646_0014451 | 3300046680 | Bacteria | 5020 |
| 314 | Ga0495646_0222262 | 3300046680 | Bacteria | 1021 |
| 315 | Ga0495646_0235315 | 3300046680 | Bacteria | 986 |
| 316 | Ga0495658_0144361 | 3300046683 | Bacteria | 1457 |
| 317 | Ga0495658_0762414 | 3300046683 | Bacteria | 620 |
| 318 | Ga0495613_0003424 | 3300046689 | Bacteria | 11856 |
| 319 | Ga0495613_0010395 | 3300046689 | Bacteria | 6912 |
| 320 | Ga0495613_0012117 | 3300046689 | Bacteria | 6408 |
| 321 | Ga0495613_0021841 | 3300046689 | Bacteria | 4770 |
| 322 | Ga0495613_0043428 | 3300046689 | Bacteria | 3326 |
| 323 | Ga0495613_0109870 | 3300046689 | Bacteria | 1987 |
| 324 | Ga0495613_0135378 | 3300046689 | Bacteria | 1763 |
| 325 | Ga0495613_0186143 | 3300046689 | Bacteria | 1469 |
| 326 | Ga0495613_0326395 | 3300046689 | Bacteria | 1058 |
| 327 | Ga0495613_0424172 | 3300046689 | Bacteria | 904 |
| 328 | Ga0495613_0568552 | 3300046689 | Bacteria | 757 |
| 329 | Ga0495624_0057743 | 3300046690 | Bacteria | 2439 |
| 330 | Ga0495624_0076696 | 3300046690 | Bacteria | 2074 |
| 331 | Ga0495624_0164911 | 3300046690 | Bacteria | 1352 |
| 332 | Ga0495624_0271689 | 3300046690 | Bacteria | 1024 |
| 333 | Ga0495670_0087594 | 3300046691 | Bacteria | 1591 |
| 334 | Ga0495670_0419425 | 3300046691 | Bacteria | 724 |
| 335 | Ga0495671_0022519 | 3300046692 | Bacteria | 3300 |
| 336 | Ga0495649_0012890 | 3300046694 | Bacteria | 4843 |
| 337 | Ga0495649_0401384 | 3300046694 | Bacteria | 688 |
| 338 | Ga0495589_0042124 | 3300046794 | Bacteria | 2276 |
| 339 | Ga0495589_0099476 | 3300046794 | Bacteria | 1408 |
| 340 | Ga0495589_0116807 | 3300046794 | Bacteria | 1285 |
| 341 | Ga0495589_0166580 | 3300046794 | Bacteria | 1049 |
| 342 | Ga0495589_0320315 | 3300046794 | Bacteria | 716 |
| 343 | Ga0495600_0007018 | 3300046809 | Bacteria | 6879 |
| 344 | Ga0495600_0041460 | 3300046809 | Bacteria | 3000 |
| 345 | Ga0495600_0198955 | 3300046809 | Bacteria | 1287 |
| 346 | Ga0495600_0523215 | 3300046809 | Bacteria | 727 |
| 347 | Ga0495660_0091248 | 3300046810 | Bacteria | 1582 |
| 348 | Ga0495581_0005237 | 3300047315 | Bacteria | 7500 |
| 349 | Ga0495581_0007377 | 3300047315 | Bacteria | 6356 |
| 350 | Ga0495581_0023311 | 3300047315 | Bacteria | 3587 |
| 351 | Ga0495604_0003060 | 3300047317 | Bacteria | 13364 |
| 352 | Ga0495604_0026542 | 3300047317 | Bacteria | 4610 |
| 353 | Ga0495604_0113627 | 3300047317 | Bacteria | 1970 |
| 354 | Ga0495604_0118749 | 3300047317 | Bacteria | 1916 |
| 355 | Ga0495604_0256408 | 3300047317 | Bacteria | 1190 |
| 356 | Ga0495604_0773860 | 3300047317 | Bacteria | 606 |
| 357 | Ga0495636_0015865 | 3300047318 | Bacteria | 3004 |
| 358 | Ga0495636_0049522 | 3300047318 | Bacteria | 1757 |
| 359 | Ga0495636_0078232 | 3300047318 | Bacteria | 1420 |
| 360 | Ga0495636_0137913 | 3300047318 | Bacteria | 1088 |
| 361 | Ga0495674_0031505 | 3300047319 | Bacteria | 4817 |
| 362 | Ga0495674_0333377 | 3300047319 | Bacteria | 1234 |
| 363 | Ga0495674_0808390 | 3300047319 | Bacteria | 729 |
| 364 | Ga0495676_0005451 | 3300047321 | Bacteria | 11667 |
| 365 | Ga0495676_0005856 | 3300047321 | Bacteria | 11286 |
| 366 | Ga0495676_0009055 | 3300047321 | Bacteria | 9082 |
| 367 | Ga0495676_0019746 | 3300047321 | Bacteria | 5924 |
| 368 | Ga0495676_0028024 | 3300047321 | Bacteria | 4819 |
| 369 | Ga0495676_0123941 | 3300047321 | Bacteria | 1875 |
| 370 | Ga0495676_0810392 | 3300047321 | Bacteria | 602 |
| 371 | Ga0495680_0010275 | 3300047322 | Bacteria | 8350 |
| 372 | Ga0495683_0241670 | 3300047323 | Bacteria | 796 |
| 373 | Ga0495687_006392 | 3300047443 | Bacteria | 7232 |
| 374 | Ga0495687_042471 | 3300047443 | Bacteria | 1986 |
| 375 | Ga0495687_043028 | 3300047443 | Bacteria | 1970 |
| 376 | Ga0495687_070283 | 3300047443 | Bacteria | 1406 |
| 377 | Ga0495675_0008068 | 3300047444 | Bacteria | 6518 |
| 378 | Ga0495675_0106977 | 3300047444 | Bacteria | 1748 |
| 379 | Ga0495675_0139685 | 3300047444 | Bacteria | 1502 |
| 380 | Ga0495675_0142712 | 3300047444 | Bacteria | 1483 |
| 381 | Ga0495675_0231928 | 3300047444 | Bacteria | 1114 |
| 382 | Ga0495675_0374988 | 3300047444 | Bacteria | 833 |
| 383 | Ga0495675_0419713 | 3300047444 | Bacteria | 777 |
| 384 | Ga0495675_0471872 | 3300047444 | Bacteria | 723 |
| 385 | Ga0495685_005303 | 3300047447 | Bacteria | 4203 |
| 386 | Ga0495685_018741 | 3300047447 | Bacteria | 2376 |
| 387 | Ga0495685_109819 | 3300047447 | Bacteria | 908 |
| 388 | Ga0495673_0163867 | 3300047469 | Bacteria | 852 |
| 389 | Ga0495681_0000567 | 3300047470 | Bacteria | 28271 |
| 390 | Ga0495681_0032151 | 3300047470 | Bacteria | 2645 |
| 391 | Ga0495681_0077806 | 3300047470 | Bacteria | 1488 |
| 392 | Ga0495684_0077790 | 3300047471 | Bacteria | 2517 |
| 393 | Ga0495684_0095811 | 3300047471 | Bacteria | 2246 |
| 394 | Ga0495686_0015791 | 3300047472 | Bacteria | 5140 |
| 395 | Ga0495686_0084897 | 3300047472 | Bacteria | 1929 |
| 396 | Ga0495593_0000488 | 3300047673 | Bacteria | 22326 |
| 397 | Ga0495593_0126278 | 3300047673 | Bacteria | 1300 |
| 398 | Ga0495593_0144866 | 3300047673 | Bacteria | 1202 |
| 399 | Ga0495602_0077375 | 3300048088 | Bacteria | 2815 |
| 400 | Ga0495602_0112376 | 3300048088 | Bacteria | 2210 |
| 401 | Ga0495614_0003426 | 3300048089 | Bacteria | 7096 |
| 402 | Ga0495614_0041644 | 3300048089 | Bacteria | 1970 |
| 403 | Ga0495626_0015565 | 3300048091 | Bacteria | 3890 |
| 404 | Ga0496102_0200450 | 3300048905 | Bacteria | 1881 |
| 405 | Ga0496103_0096870 | 3300048906 | Bacteria | 1865 |
| 406 | Ga0496104_0001987 | 3300048907 | Bacteria | 17732 |
| 407 | Ga0496106_0155525 | 3300048909 | Bacteria | 1805 |
| 408 | Ga0496108_0010274 | 3300048911 | Bacteria | 7599 |
| 409 | Ga0496109_0005561 | 3300048912 | Bacteria | 10552 |
| 410 | Ga0496109_0681273 | 3300048912 | Bacteria | 965 |
| 411 | Ga0496109_1532922 | 3300048912 | Bacteria | 601 |
| 412 | Ga0496110_0125508 | 3300048913 | Bacteria | 2315 |
| 413 | Ga0496110_0802593 | 3300048913 | Bacteria | 846 |
| 414 | Ga0496111_0000176 | 3300048914 | Bacteria | 28843 |
| 415 | Ga0496111_0894031 | 3300048914 | Bacteria | 640 |
| 416 | Ga0496113_0529357 | 3300048916 | Bacteria | 946 |
| 417 | Ga0496114_0369476 | 3300048917 | Bacteria | 1269 |
| 418 | Ga0496114_1217354 | 3300048917 | Bacteria | 639 |
| 419 | Ga0496114_1592032 | 3300048917 | Bacteria | 541 |
| 420 | Ga0496115_0338177 | 3300048918 | Bacteria | 1229 |
| 421 | Ga0496125_0318190 | 3300048928 | Bacteria | 945 |
| 422 | Ga0496126_0857791 | 3300048929 | Bacteria | 692 |
| 423 | Ga0501306_081757 | 3300049127 | Bacteria | 558 |
| 424 | Ga0501310_083203 | 3300049130 | Bacteria | 505 |
| 425 | Ga0495678_172916 | 3300049459 | Bacteria | 682 |
| 426 | Ga0495682_0047000 | 3300049460 | Bacteria | 1575 |
| 427 | Ga0501317_043709 | 3300049533 | Bacteria | 692 |
| 428 | Ga0501322_019967 | 3300049538 | Bacteria | 582 |
| 429 | Ga0501031_0002467 | 3300049568 | Bacteria | 11802 |
| 430 | Ga0501031_0033763 | 3300049568 | Bacteria | 3340 |
| 431 | Ga0501031_0039348 | 3300049568 | Bacteria | 3085 |
| 432 | Ga0501031_0091296 | 3300049568 | Bacteria | 1986 |
| 433 | Ga0501031_0170939 | 3300049568 | Bacteria | 1420 |
| 434 | Ga0501031_0171880 | 3300049568 | Bacteria | 1416 |
| 435 | Ga0501031_0174821 | 3300049568 | Bacteria | 1403 |
| 436 | Ga0501032_0008641 | 3300049569 | Bacteria | 7422 |
| 437 | Ga0501032_0041778 | 3300049569 | Bacteria | 3112 |
| 438 | Ga0501032_0073062 | 3300049569 | Bacteria | 2285 |
| 439 | Ga0501032_0110060 | 3300049569 | Bacteria | 1823 |
| 440 | Ga0501032_0161676 | 3300049569 | Bacteria | 1470 |
| 441 | Ga0501032_0163717 | 3300049569 | Bacteria | 1460 |
| 442 | Ga0501032_0164040 | 3300049569 | Bacteria | 1458 |
| 443 | Ga0501033_0003519 | 3300049570 | Bacteria | 12825 |
| 444 | Ga0501033_0011502 | 3300049570 | Bacteria | 6774 |
| 445 | Ga0501033_0014547 | 3300049570 | Bacteria | 5973 |
| 446 | Ga0501033_0026616 | 3300049570 | Bacteria | 4351 |
| 447 | Ga0501033_0038081 | 3300049570 | Bacteria | 3597 |
| 448 | Ga0501033_0053149 | 3300049570 | Bacteria | 3000 |
| 449 | Ga0501033_0109891 | 3300049570 | Bacteria | 2007 |
| 450 | Ga0501033_0116704 | 3300049570 | Bacteria | 1939 |
| 451 | Ga0501033_0128487 | 3300049570 | Bacteria | 1837 |
| 452 | Ga0501034_0007425 | 3300049571 | Bacteria | 11667 |
| 453 | Ga0501034_0011443 | 3300049571 | Bacteria | 9191 |
| 454 | Ga0501034_0015656 | 3300049571 | Bacteria | 7788 |
| 455 | Ga0501034_0023142 | 3300049571 | Bacteria | 6332 |
| 456 | Ga0501034_0035254 | 3300049571 | Bacteria | 5073 |
| 457 | Ga0501034_0514398 | 3300049571 | Bacteria | 1109 |
| 458 | Ga0501034_1065384 | 3300049571 | Bacteria | 690 |
| 459 | Ga0501034_1283275 | 3300049571 | Bacteria | 609 |
| 460 | Ga0501034_1577707 | 3300049571 | Bacteria | 530 |
| 461 | Ga0501036_0006643 | 3300049572 | Bacteria | 9401 |
| 462 | Ga0501036_0017596 | 3300049572 | Bacteria | 5978 |
| 463 | Ga0501036_0031200 | 3300049572 | Bacteria | 4503 |
| 464 | Ga0501036_0031599 | 3300049572 | Bacteria | 4474 |
| 465 | Ga0501036_0064257 | 3300049572 | Bacteria | 3106 |
| 466 | Ga0501036_0225088 | 3300049572 | Bacteria | 1574 |
| 467 | Ga0501036_0246677 | 3300049572 | Bacteria | 1497 |
| 468 | Ga0501036_0302546 | 3300049572 | Bacteria | 1337 |
| 469 | Ga0501037_0001324 | 3300049573 | Bacteria | 18177 |
| 470 | Ga0501037_0019328 | 3300049573 | Bacteria | 5024 |
| 471 | Ga0501037_0040582 | 3300049573 | Bacteria | 3425 |
| 472 | Ga0501037_0075086 | 3300049573 | Bacteria | 2456 |
| 473 | Ga0501037_0101845 | 3300049573 | Bacteria | 2072 |
| 474 | Ga0501037_0194265 | 3300049573 | Bacteria | 1436 |
| 475 | Ga0501037_0325636 | 3300049573 | Bacteria | 1063 |
| 476 | Ga0501037_0546395 | 3300049573 | Unclassified | 782 |
| 477 | Ga0501038_0001194 | 3300049574 | Bacteria | 23626 |
| 478 | Ga0501038_0005372 | 3300049574 | Bacteria | 11900 |
| 479 | Ga0501038_0024208 | 3300049574 | Bacteria | 5417 |
| 480 | Ga0501038_0049375 | 3300049574 | Bacteria | 3638 |
| 481 | Ga0501038_0061563 | 3300049574 | Bacteria | 3209 |
| 482 | Ga0501038_0064244 | 3300049574 | Bacteria | 3130 |
| 483 | Ga0501038_0096954 | 3300049574 | Bacteria | 2460 |
| 484 | Ga0501038_0231676 | 3300049574 | Bacteria | 1470 |
| 485 | Ga0501038_1368772 | 3300049574 | Bacteria | 509 |
| 486 | Ga0501039_0047992 | 3300049575 | Bacteria | 3300 |
| 487 | Ga0501039_0055212 | 3300049575 | Bacteria | 3075 |
| 488 | Ga0501039_0431080 | 3300049575 | Bacteria | 1035 |
| 489 | Ga0501040_0047457 | 3300049576 | Bacteria | 2932 |
| 490 | Ga0501041_0006009 | 3300049577 | Bacteria | 7103 |
| 491 | Ga0501042_0041545 | 3300049578 | Bacteria | 3271 |
| 492 | Ga0501043_0001624 | 3300049579 | Bacteria | 19569 |
| 493 | Ga0501043_0003998 | 3300049579 | Bacteria | 12066 |
| 494 | Ga0501043_0017888 | 3300049579 | Bacteria | 5558 |
| 495 | Ga0501043_0019731 | 3300049579 | Bacteria | 5294 |
| 496 | Ga0501043_0027296 | 3300049579 | Bacteria | 4483 |
| 497 | Ga0501043_0031845 | 3300049579 | Bacteria | 4145 |
| 498 | Ga0501043_0058599 | 3300049579 | Bacteria | 3023 |
| 499 | Ga0501043_0064550 | 3300049579 | Bacteria | 2875 |
| 500 | Ga0501043_0108548 | 3300049579 | Bacteria | 2179 |
| 501 | Ga0501043_0114459 | 3300049579 | Bacteria | 2117 |
| 502 | Ga0501043_0271293 | 3300049579 | Bacteria | 1302 |
| 503 | Ga0501046_0261205 | 3300049580 | Bacteria | 1272 |
| 504 | Ga0501046_0946219 | 3300049580 | Bacteria | 599 |
| 505 | Ga0501047_0000110 | 3300049581 | Bacteria | 99745 |
| 506 | Ga0501047_0008078 | 3300049581 | Bacteria | 9927 |
| 507 | Ga0501047_0008535 | 3300049581 | Bacteria | 9665 |
| 508 | Ga0501047_0009843 | 3300049581 | Bacteria | 9033 |
| 509 | Ga0501047_0039504 | 3300049581 | Bacteria | 4564 |
| 510 | Ga0501047_0098154 | 3300049581 | Bacteria | 2808 |
| 511 | Ga0501047_0145397 | 3300049581 | Bacteria | 2248 |
| 512 | Ga0501047_0189423 | 3300049581 | Bacteria | 1921 |
| 513 | Ga0501047_0375671 | 3300049581 | Bacteria | 1256 |
| 514 | Ga0501047_0376423 | 3300049581 | Bacteria | 1254 |
| 515 | Ga0501048_0014635 | 3300049582 | Bacteria | 5806 |
| 516 | Ga0501048_0492130 | 3300049582 | Bacteria | 879 |
| 517 | Ga0501048_0855050 | 3300049582 | Unclassified | 654 |
| 518 | Ga0501067_0010923 | 3300049583 | Bacteria | 5026 |
| 519 | Ga0501067_0584739 | 3300049583 | Bacteria | 626 |
| 520 | Ga0501067_0766847 | 3300049583 | Bacteria | 543 |
| 521 | Ga0501068_0006918 | 3300049584 | Bacteria | 6274 |
| 522 | Ga0501068_1032717 | 3300049584 | Bacteria | 543 |
| 523 | Ga0501069_0034082 | 3300049585 | Bacteria | 2804 |
| 524 | Ga0501070_0022161 | 3300049586 | Bacteria | 5320 |
| 525 | Ga0501070_0023294 | 3300049586 | Bacteria | 5186 |
| 526 | Ga0501070_0194908 | 3300049586 | Bacteria | 1664 |
| 527 | Ga0501070_0260232 | 3300049586 | Bacteria | 1418 |
| 528 | Ga0501070_0307236 | 3300049586 | Bacteria | 1291 |
| 529 | Ga0501070_0335980 | 3300049586 | Bacteria | 1227 |
| 530 | Ga0501070_0404195 | 3300049586 | Bacteria | 1104 |
| 531 | Ga0501070_0446150 | 3300049586 | Bacteria | 1043 |
| 532 | Ga0501070_0544014 | 3300049586 | Bacteria | 930 |
| 533 | Ga0501070_1118244 | 3300049586 | Bacteria | 607 |
| 534 | Ga0501072_0012542 | 3300049588 | Bacteria | 6480 |
| 535 | Ga0501072_1551483 | 3300049588 | Bacteria | 511 |
| 536 | Ga0501073_0013259 | 3300049589 | Bacteria | 6005 |
| 537 | Ga0501073_0058150 | 3300049589 | Bacteria | 2703 |
| 538 | Ga0501074_0013997 | 3300049590 | Bacteria | 5831 |
| 539 | Ga0501074_0034649 | 3300049590 | Bacteria | 3659 |
| 540 | Ga0501075_0096472 | 3300049591 | Bacteria | 2244 |
| 541 | Ga0501076_0150934 | 3300049592 | Bacteria | 1890 |
| 542 | Ga0501076_0483159 | 3300049592 | Unclassified | 1021 |
| 543 | Ga0501076_0489873 | 3300049592 | Bacteria | 1013 |
| 544 | Ga0501077_0024633 | 3300049593 | Bacteria | 3821 |
| 545 | Ga0501202_170215 | 3300049652 | Bacteria | 582 |
| 546 | Ga0501227_195581 | 3300049665 | Bacteria | 572 |
| 547 | Ga0501221_180118 | 3300049704 | Bacteria | 577 |
| 548 | Ga0501079_0003173 | 3300049741 | Bacteria | 12041 |
| 549 | Ga0501079_1039583 | 3300049741 | Unclassified | 645 |
| 550 | Ga0501079_1541738 | 3300049741 | Bacteria | 523 |
| 551 | Ga0501080_0025292 | 3300049742 | Bacteria | 5509 |
| 552 | Ga0501080_0068525 | 3300049742 | Bacteria | 3300 |
| 553 | Ga0501083_0004750 | 3300049744 | Bacteria | 9597 |
| 554 | Ga0501035_0004388 | 3300049822 | Bacteria | 13387 |
| 555 | Ga0501035_0005215 | 3300049822 | Bacteria | 12298 |
| 556 | Ga0501035_0011367 | 3300049822 | Bacteria | 8251 |
| 557 | Ga0501035_0014839 | 3300049822 | Bacteria | 7192 |
| 558 | Ga0501035_0026105 | 3300049822 | Bacteria | 5349 |
| 559 | Ga0501035_0101021 | 3300049822 | Bacteria | 2531 |
| 560 | Ga0501035_0129751 | 3300049822 | Bacteria | 2198 |
| 561 | Ga0501035_0150580 | 3300049822 | Bacteria | 2019 |
| 562 | Ga0501035_0281893 | 3300049822 | Bacteria | 1404 |
| 563 | Ga0501035_0368964 | 3300049822 | Bacteria | 1198 |
| 564 | Ga0501035_0494612 | 3300049822 | Bacteria | 1007 |
| 565 | Ga0501044_0004261 | 3300049823 | Bacteria | 16048 |
| 566 | Ga0501044_0004420 | 3300049823 | Bacteria | 15724 |
| 567 | Ga0501044_0020637 | 3300049823 | Bacteria | 7035 |
| 568 | Ga0501044_0033712 | 3300049823 | Bacteria | 5377 |
| 569 | Ga0501044_0108696 | 3300049823 | Bacteria | 2783 |
| 570 | Ga0501044_0128367 | 3300049823 | Bacteria | 2531 |
| 571 | Ga0501044_0142631 | 3300049823 | Bacteria | 2383 |
| 572 | Ga0501044_0166315 | 3300049823 | Bacteria | 2179 |
| 573 | Ga0501044_0237321 | 3300049823 | Bacteria | 1768 |
| 574 | Ga0501044_0464529 | 3300049823 | Bacteria | 1170 |
| 575 | Ga0501044_0859545 | 3300049823 | Bacteria | 784 |
| 576 | Ga0501045_0016414 | 3300049824 | Bacteria | 5259 |
| 577 | Ga0501045_0216308 | 3300049824 | Bacteria | 1427 |
| 578 | Ga0501045_0231417 | 3300049824 | Bacteria | 1376 |
| 579 | Ga0501045_0270622 | 3300049824 | Bacteria | 1265 |
| 580 | Ga0501045_0348481 | 3300049824 | Bacteria | 1102 |
| 581 | Ga0501045_0402128 | 3300049824 | Bacteria | 1019 |
| 582 | Ga0501045_0889401 | 3300049824 | Bacteria | 654 |
| 583 | nmdc:mga03n38_235664_c1 | 3300050490 | Bacteria | 961 |
| 584 | nmdc:mga0yw44_519596_c1 | 3300050492 | Bacteria | 808 |
| 585 | nmdc:mga08y16_174273_c1 | 3300050511 | Bacteria | 2233 |
| 586 | nmdc:mga08x19_170982_c1 | 3300050514 | Bacteria | 1480 |
| 587 | Ga0495601_0040509 | 3300053077 | Bacteria | 2917 |
| 588 | Ga0495655_0027063 | 3300053083 | Bacteria | 1357 |
| 589 | Ga0495595_0319577 | 3300053084 | Bacteria | 782 |
| 590 | Ga0495619_0009410 | 3300053085 | Bacteria | 6164 |
| 591 | Ga0495619_0184798 | 3300053085 | Bacteria | 1442 |
| 592 | Ga0495619_0544015 | 3300053085 | Bacteria | 797 |
| 593 | Ga0500578_0512382 | 3300053086 | Bacteria | 673 |
| 594 | Ga0500644_0028242 | 3300053088 | Bacteria | 1753 |
| 595 | Ga0500583_0111776 | 3300053092 | Bacteria | 1346 |
| 596 | Ga0500566_0175054 | 3300053094 | Bacteria | 1106 |
| 597 | Ga0500640_015759 | 3300053095 | Bacteria | 3174 |
| 598 | Ga0500560_002253 | 3300053107 | Bacteria | 3636 |
| 599 | Ga0500560_044395 | 3300053107 | Bacteria | 1406 |
| 600 | Ga0500572_013583 | 3300053111 | Bacteria | 2018 |
| 601 | Ga0500608_281954 | 3300053122 | Bacteria | 628 |
| 602 | Ga0500642_0173840 | 3300053130 | Bacteria | 1008 |
| 603 | Ga0500573_0455130 | 3300053140 | Bacteria | 590 |
| 604 | Ga0500600_0037488 | 3300053149 | Bacteria | 2810 |
| 605 | Ga0501084_0022822 | 3300054114 | Bacteria | 5221 |
| 606 | Ga0501084_0685764 | 3300054114 | Bacteria | 864 |
| 607 | Ga0587084_020241 | 3300059477 | Bacteria | 988 |
| 608 | Ga0587070_032381 | 3300059491 | Bacteria | 955 |
| 609 | Ga0587090_025852 | 3300059510 | Bacteria | 951 |
| 610 | Ga0587106_068807 | 3300059605 | Bacteria | 666 |
| 611 | Ga0587125_051234 | 3300059607 | Bacteria | 583 |
| 612 | Ga0587107_075264 | 3300059652 | Bacteria | 624 |
| 613 | Ga0587071_033775 | 3300060344 | Bacteria | 997 |
| 614 | Ga0501082_0008454 | 3300060353 | Bacteria | 8877 |
| 615 | Ga0501082_1301438 | 3300060353 | Unclassified | 635 |
| 616 | Ga0466962_0000234 | 3300061719 | Bacteria | 23125 |
| 617 | Ga0466962_0004079 | 3300061719 | Bacteria | 6994 |
| 618 | Ga0466962_0040152 | 3300061719 | Bacteria | 2241 |
| 619 | Ga0530510_0026751 | 3300061734 | Bacteria | 4131 |
| 620 | Ga0530510_0053563 | 3300061734 | Bacteria | 2916 |
| 621 | Ga0530510_0710404 | 3300061734 | Bacteria | 766 |
| 622 | 2554256367 | 2554235005 | Bacteria | 6457341 |
| 623 | 2585296439 | 2582581312 | Bacteria | 7308206 |
| 624 | 2585299498 | 2582581312 | Bacteria | 7308206 |
| 625 | 2585306965 | 2582581313 | Bacteria | 10042643 |
| 626 | 2585318640 | 2582581314 | Bacteria | 11452267 |
| 627 | 2616900071 | 2616644941 | Bacteria | 8510691 |
| 628 | 2643763846 | 2643221548 | Bacteria | 8053412 |
| 629 | 2643764161 | 2643221548 | Bacteria | 8053412 |
| 630 | 2643902431 | 2643221578 | Bacteria | 9213798 |
| 631 | 2643905006 | 2643221578 | Bacteria | 9213798 |
| 632 | 2643945503 | 2643221587 | Bacteria | 7586415 |
| 633 | 2644265972 | 2643221647 | Bacteria | 10741251 |
| 634 | 2644386741 | 2643221670 | Bacteria | 6497041 |
| 635 | 2644403065 | 2643221673 | Bacteria | 9196637 |
| 636 | 2644404002 | 2643221673 | Bacteria | 9196637 |
| 637 | 2644431166 | 2643221677 | Bacteria | 7584031 |
| 638 | 2644439868 | 2643221678 | Bacteria | 9540101 |
| 639 | 2644461406 | 2643221682 | Bacteria | 6743283 |
| 640 | 2644461720 | 2643221682 | Bacteria | 6743283 |
| 641 | 2644632801 | 2643221714 | Bacteria | 9015452 |
| 642 | 2768646945 | 2767802112 | Bacteria | 6465194 |
| 643 | 2785371317 | 2784746768 | Bacteria | 10036182 |
| 644 | 2786672504 | 2786546132 | Bacteria | 10419719 |
| 645 | 2793984655 | 2791355406 | Bacteria | 11364898 |
| 646 | 2808843876 | 2808606359 | Bacteria | 9866990 |
| 647 | 2808913416 | 2808606375 | Bacteria | 9466072 |
| 648 | 2809236326 | 2808606448 | Bacteria | 8656184 |
| 649 | 2811844589 | 2808606982 | Bacteria | 7791042 |
| 650 | 2819746569 | 2818991472 | Bacteria | 10089953 |
| 651 | 2852642109 | 2852635781 | Bacteria | 8251373 |
| 652 | 2862179130 | 2862178590 | Bacteria | 8583590 |
| 653 | 2862180280 | 2862178590 | Bacteria | 8583590 |
| 654 | 2862284926 | 2862281513 | Bacteria | 9621493 |
| 655 | 2862293021 | 2862290372 | Bacteria | 7471434 |
| 656 | 2862388621 | 2862382967 | Bacteria | 10317375 |
| 657 | 2862509483 | 2862507626 | Bacteria | 9425308 |
| 658 | 2862513321 | 2862507626 | Bacteria | 9425308 |
| 659 | 2862577684 | 2862574272 | Bacteria | 10567477 |
| 660 | 2867370822 | 2867369537 | Bacteria | 6501581 |
| 661 | 2867373704 | 2867369537 | Bacteria | 6501581 |
| 662 | 2867434540 | 2867428634 | Bacteria | 9590268 |
| 663 | 2867475436 | 2867475112 | Bacteria | 6909112 |
| 664 | 2867477659 | 2867475112 | Bacteria | 6909112 |
| 665 | 2875392422 | 2875391855 | Bacteria | 7600475 |
| 666 | 2875396524 | 2875391855 | Bacteria | 7600475 |
| 667 | 2877679288 | 2877676314 | Bacteria | 9512378 |
| 668 | 2912717886 | 2912715099 | Bacteria | 9460473 |
| 669 | 2912730311 | 2912723979 | Bacteria | 8557534 |
| 670 | 2912761123 | 2912757875 | Bacteria | 7940295 |
| 671 | 2912762589 | 2912757875 | Bacteria | 7940295 |
| 672 | 2918506325 | 2918501144 | Bacteria | 8668083 |
| 673 | 2919471556 | 2919468124 | Bacteria | 9133025 |
| 674 | 2935394517 | 2935390628 | Bacteria | 7043367 |
| 675 | 2946048030 | 2946045630 | Bacteria | 8527308 |
| 676 | 2946052389 | 2946045630 | Bacteria | 8527308 |
| 677 | 2946077582 | 2946072368 | Bacteria | 8999607 |
| 678 | 2954384173 | 2954380949 | Bacteria | 10050426 |
| 679 | 2954678776 | 2954673503 | Bacteria | 9685905 |
| 680 | 2954685377 | 2954682443 | Bacteria | 9862841 |
| 681 | 2954694995 | 2954691527 | Bacteria | 10720516 |
| 682 | 2954710169 | 2954701450 | Bacteria | 10834262 |
| 683 | 2954714488 | 2954711539 | Bacteria | 10867210 |
| 684 | 2954724434 | 2954721474 | Bacteria | 10456478 |
| 685 | 2954737384 | 2954731030 | Bacteria | 10243860 |
| 686 | 2954743356 | 2954740390 | Bacteria | 10229294 |
| 687 | 2954756237 | 2954749733 | Bacteria | 10366972 |
| 688 | 2954762313 | 2954759201 | Bacteria | 9358192 |
| 689 | 2966601008 | 2966598605 | Bacteria | 7676064 |
| 690 | 2997453231 | 2997451912 | Bacteria | 8492419 |
| 691 | 2997455567 | 2997451912 | Bacteria | 8492419 |
| 692 | 3006397089 | 3006393351 | Bacteria | 6615579 |
| 693 | 3006430041 | 3006425503 | Bacteria | 6491253 |
| 694 | 3006489035 | 3006486233 | Bacteria | 8157040 |
| 695 | 3006498092 | 3006493962 | Bacteria | 8825450 |
| 696 | 8008562612 | 8008558824 | Bacteria | 10610750 |
| 697 | 8008577323 | 8008574985 | Bacteria | 7815457 |
| 698 | 8023627965 | 8023623736 | Bacteria | 8593882 |
| 699 | 8025537064 | 8025530807 | Bacteria | 8495698 |
| 700 | 8047896305 | 8047893842 | Bacteria | 11723082 |
| 701 | 8048128081 | 8048127548 | Bacteria | 11053136 |
| 702 | 8048362631 | 8048356638 | Bacteria | 11044339 |
| 703 | 8048373314 | 8048369669 | Bacteria | 11666822 |
| 704 | 8048384928 | 8048379754 | Bacteria | 11877923 |
| 705 | 8048406625 | 8048406513 | Bacteria | 8936924 |
| 706 | 8054161162 | 8054160619 | Bacteria | 7783213 |
| 707 | 8056671487 | 8056667051 | Bacteria | 6953971 |
| 708 | 8056831988 | 8056829672 | Bacteria | 9045328 |
| 709 | Ga0501042_0644272 | |||
| 710 | JGI24739J22299_10132641 | |||
| 711 | JGI24737J22298_10067564 | |||
| 712 | rootH1_10019195 | |||
| 713 | rootH2_10060685 | |||
| 714 | rootH1_10091162 | |||
| 715 | JGI25160J50197_1009351 | |||
| 716 | JGI25160J50197_1009544 | |||
| 717 | JGI25160J50197_1091987 | |||
| 718 | Ga0070690_101210393 | |||
| 719 | Ga0070680_101183313 | |||
| 720 | Ga0068868_101508957 | |||
| 721 | Ga0070668_101799039 | |||
| 722 | Ga0070678_101986934 | |||
| 723 | Ga0070681_11476556 | |||
| 724 | Ga0070686_100410756 | |||
| 725 | Ga0070704_100438118 | |||
| 726 | Ga0068855_100075048 | |||
| 727 | Ga0068855_100132732 | |||
| 728 | Ga0068854_101714125 | |||
| 729 | Ga0068856_100484683 | |||
| 730 | Ga0068859_100303123 | |||
| 731 | Ga0068864_100134844 | |||
| 732 | Ga0068870_10353475 | |||
| 733 | Ga0068858_101029214 | |||
| 734 | Ga0068862_101813230 | |||
| 735 | Ga0068865_100353000 | |||
| 736 | Ga0075436_100188405 | |||
| 737 | Ga0097620_100303129 | |||
| 738 | Ga0099826_10067827 | |||
| 739 | Ga0105240_10027872 | |||
| 740 | Ga0111539_10106652 | |||
| 741 | Ga0105245_10257993 | |||
| 742 | Ga0105245_12226492 | |||
| 743 | Ga0105243_10398119 | |||
| 744 | Ga0105242_10998858 | |||
| 745 | Ga0105242_11665724 | |||
| 746 | Ga0105248_10642371 | |||
| 747 | Ga0105238_10522624 | |||
| 748 | Ga0105246_10249858 | |||
| 749 | Ga0157313_1027653 | |||
| 750 | Ga0157369_10087579 | |||
| 751 | Ga0157374_10773822 | |||
| 752 | Ga0157378_10975161 | |||
| 753 | Ga0163162_10071458 | |||
| 754 | Ga0163162_12149436 | |||
| 755 | Ga0157372_10208360 | |||
| 756 | Ga0157375_10605617 | |||
| 757 | Ga0157375_10725291 | |||
| 758 | Ga0157376_10263507 | |||
| 759 | Ga0182006_1017034 | |||
| 760 | Ga0182007_10002422 | |||
| 761 | Ga0206355_1208892 | |||
| 762 | Ga0206353_10306429 | |||
| 763 | Ga0213875_10052410 | |||
| 764 | Ga0209758_1013617 | |||
| 765 | Ga0207426_1000396 | |||
| 766 | Ga0207426_1001513 | |||
| 767 | Ga0207426_1002187 | |||
| 768 | Ga0207426_1005153 | |||
| 769 | Ga0207426_1006361 | |||
| 770 | Ga0207426_1038653 | |||
| 771 | Ga0207426_1130571 | |||
| 772 | Ga0207696_1040208 | |||
| 773 | Ga0207710_10220129 | |||
| 774 | Ga0207688_10651880 | |||
| 775 | Ga0207647_10005240 | |||
| 776 | Ga0207707_10550293 | |||
| 777 | Ga0207695_10038526 | |||
| 778 | Ga0207686_10473785 | |||
| 779 | Ga0207709_10306891 | |||
| 780 | Ga0207667_10075912 | |||
| 781 | Ga0207667_10408358 | |||
| 782 | Ga0207668_12059916 | |||
| 783 | Ga0207640_10069392 | |||
| 784 | Ga0207703_11505356 | |||
| 785 | Ga0207639_11632252 | |||
| 786 | Ga0207648_10693005 | |||
| 787 | Ga0207676_10640184 | |||
| 788 | Ga0209371_1067381 | |||
| 789 | Ga0209282_1100910 | |||
| 790 | Ga0207428_11035629 | |||
| 791 | Ga0268256_1018141 | |||
| 792 | Ga0307511_10074842 | |||
| 793 | Ga0307512_10004518 | |||
| 794 | Ga0307508_10006837 | |||
| 795 | Ga0307508_10063623 | |||
| 796 | Ga0307514_10059521 | |||
| 797 | Ga0307514_10079423 | |||
| 798 | Ga0316577_10807722 | |||
| 799 | Ga0307518_10063769 | |||
| 800 | Ga0307518_10185994 | |||
| 801 | Ga0307416_101605613 | |||
| 802 | Ga0307416_103035409 | |||
| 803 | Ga0316593_10109099 | |||
| 804 | Ga0316593_10167277 | |||
| 805 | Ga0316593_10301246 | |||
| 806 | Ga0307507_10045296 | |||
| 807 | Ga0307510_10230001 | |||
| 808 | Ga0307510_10406999 | |||
| 809 | Ga0395898_0003092 | |||
| 810 | Ga0395898_0230829 | |||
| 811 | Ga0395898_0396822 | |||
| 812 | Ga0436364_1242868 | |||
| 813 | Ga0395901_0074271 | |||
| 814 | Ga0395901_0507829 | |||
| 815 | Ga0439436_0002729 | |||
| 816 | Ga0439436_0003166 | |||
| 817 | Ga0439439_0033271 | |||
| 818 | Ga0439453_0124307 | |||
| 819 | Ga0451853_2009427 | |||
| 820 | Ga0439433_0002860 | |||
| 821 | Ga0439433_0036333 | |||
| 822 | Ga0439448_0004898 | |||
| 823 | Ga0439448_0024821 | |||
| 824 | Ga0439432_040878 | |||
| 825 | Ga0439449_0000358 | |||
| 826 | Ga0439449_0120838 | |||
| 827 | Ga0439449_0264335 | |||
| 828 | Ga0439450_044395 | |||
| 829 | Ga0439454_016112 | |||
| 830 | Ga0439455_0010286 | |||
| 831 | Ga0439457_002398 | |||
| 832 | Ga0439457_004233 | |||
| 833 | Ga0439462_0028590 | |||
| 834 | Ga0450920_114001 | |||
| 835 | Ga0450897_009761 | |||
| 836 | Ga0450894_000136 | |||
| 837 | Ga0450898_000424 | |||
| 838 | Ga0450898_025572 | |||
| 839 | Ga0450902_008532 | |||
| 840 | Ga0450903_000233 | |||
| 841 | Ga0450906_018467 | |||
| 842 | Ga0450907_013840 | |||
| 843 | Ga0439458_0018008 | |||
| 844 | Ga0450901_012411 | |||
| 845 | Ga0466969_0012190 | |||
| 846 | Ga0466969_0083017 | |||
| 847 | Ga0466972_0004064 | |||
| 848 | Ga0466972_0004540 | |||
| 849 | Ga0466972_0023472 | |||
| 850 | Ga0466972_0067178 | |||
| 851 | Ga0466972_0109751 | |||
| 852 | Ga0466965_0031059 | |||
| 853 | Ga0466966_0003918 | |||
| 854 | Ga0466966_0008100 | |||
| 855 | Ga0466966_0027375 | |||
| 856 | Ga0466966_0354438 | |||
| 857 | Ga0466961_0017066 | |||
| 858 | Ga0466961_0023342 | |||
| 859 | Ga0466961_0062455 | |||
| 860 | Ga0466961_0073046 | |||
| 861 | Ga0466961_0080676 | |||
| 862 | Ga0466963_0000213 | |||
| 863 | Ga0466963_0003003 | |||
| 864 | Ga0466963_0039151 | |||
| 865 | Ga0466964_0012547 | |||
| 866 | Ga0466964_0025974 | |||
| 867 | Ga0466971_0000575 | |||
| 868 | Ga0466971_0001207 | |||
| 869 | Ga0466971_0172792 | |||
| 870 | Ga0466970_0001274 | |||
| 871 | Ga0466970_0006583 | |||
| 872 | Ga0466970_0177661 | |||
| 873 | Ga0466970_0185410 | |||
| 874 | Ga0466970_0570321 | |||
| 875 | Ga0466970_0860022 | |||
| 876 | Ga0466957_0023199 | |||
| 877 | Ga0466957_0484362 | |||
| 878 | Ga0466960_0102207 | |||
| 879 | Ga0466960_0236237 | |||
| 880 | Ga0466959_0002515 | |||
| 881 | Ga0466959_0003363 | |||
| 882 | Ga0466959_0029667 | |||
| 883 | Ga0466959_0728170 | |||
| 884 | Ga0466958_0082986 | |||
| 885 | Ga0466958_0323776 | |||
| 886 | Ga0466958_0877133 | |||
| 887 | Ga0466967_0052759 | |||
| 888 | Ga0466967_0192631 | |||
| 889 | Ga0466967_0212446 | |||
| 890 | Ga0466967_1401693 | |||
| 891 | Ga0495617_082112 | |||
| 892 | Ga0495627_064266 | |||
| 893 | Ga0495592_0000574 | |||
| 894 | Ga0495592_0028509 | |||
| 895 | Ga0495592_0210741 | |||
| 896 | Ga0495603_0028210 | |||
| 897 | Ga0495603_0234590 | |||
| 898 | Ga0495603_0272480 | |||
| 899 | Ga0495603_0341877 | |||
| 900 | Ga0495629_0000405 | |||
| 901 | Ga0495629_0002819 | |||
| 902 | Ga0495629_0009074 | |||
| 903 | Ga0495629_0013612 | |||
| 904 | Ga0495629_0078601 | |||
| 905 | Ga0495629_0121152 | |||
| 906 | Ga0495629_0384081 | |||
| 907 | Ga0495638_0101286 | |||
| 908 | Ga0495638_0626291 | |||
| 909 | Ga0495651_0056038 | |||
| 910 | Ga0495651_0102999 | |||
| 911 | Ga0495651_0259698 | |||
| 912 | Ga0495653_0061599 | |||
| 913 | Ga0495580_0098754 | |||
| 914 | Ga0495582_0100885 | |||
| 915 | Ga0495582_0181594 | |||
| 916 | Ga0495582_0647639 | |||
| 917 | Ga0495605_0004096 | |||
| 918 | Ga0495639_0018492 | |||
| 919 | Ga0495639_0092804 | |||
| 920 | Ga0495662_0000154 | |||
| 921 | Ga0495662_0012526 | |||
| 922 | Ga0495662_0013250 | |||
| 923 | Ga0495662_0018848 | |||
| 924 | Ga0495662_0026659 | |||
| 925 | Ga0495662_0035348 | |||
| 926 | Ga0495662_0039446 | |||
| 927 | Ga0495662_0101601 | |||
| 928 | Ga0495664_0004639 | |||
| 929 | Ga0495664_0031093 | |||
| 930 | Ga0495664_0202095 | |||
| 931 | Ga0495664_0554005 | |||
| 932 | Ga0495584_0393895 | |||
| 933 | Ga0495585_0019750 | |||
| 934 | Ga0495585_0118469 | |||
| 935 | Ga0495585_0147331 | |||
| 936 | Ga0495594_0005107 | |||
| 937 | Ga0495594_0026114 | |||
| 938 | Ga0495594_0078134 | |||
| 939 | Ga0495594_0861964 | |||
| 940 | Ga0495607_0170128 | |||
| 941 | Ga0495583_0061262 | |||
| 942 | Ga0495583_0180048 | |||
| 943 | Ga0495608_0005526 | |||
| 944 | Ga0495608_0129963 | |||
| 945 | Ga0495610_0074964 | |||
| 946 | Ga0495616_0061904 | |||
| 947 | Ga0495618_0022418 | |||
| 948 | Ga0495618_0886815 | |||
| 949 | Ga0495620_0016425 | |||
| 950 | Ga0495628_0005810 | |||
| 951 | Ga0495628_0158132 | |||
| 952 | Ga0495628_0178311 | |||
| 953 | Ga0495630_0033011 | |||
| 954 | Ga0495630_0033921 | |||
| 955 | Ga0495631_0018548 | |||
| 956 | Ga0495631_0047678 | |||
| 957 | Ga0495637_0047011 | |||
| 958 | Ga0495637_0370716 | |||
| 959 | Ga0495644_0410340 | |||
| 960 | Ga0495648_0030330 | |||
| 961 | Ga0495666_0007896 | |||
| 962 | Ga0495652_0030071 | |||
| 963 | Ga0495652_0037557 | |||
| 964 | Ga0495652_0111389 | |||
| 965 | Ga0495652_0175580 | |||
| 966 | Ga0495665_0013928 | |||
| 967 | Ga0495665_0046977 | |||
| 968 | Ga0495665_0457515 | |||
| 969 | Ga0495640_0010190 | |||
| 970 | Ga0495640_0035770 | |||
| 971 | Ga0495640_0083077 | |||
| 972 | Ga0495640_0536599 | |||
| 973 | Ga0495586_0027327 | |||
| 974 | Ga0495586_0092894 | |||
| 975 | Ga0495587_0003221 | |||
| 976 | Ga0495587_0018256 | |||
| 977 | Ga0495609_0074505 | |||
| 978 | Ga0495609_0147933 | |||
| 979 | Ga0495609_0159745 | |||
| 980 | Ga0495597_0032768 | |||
| 981 | Ga0495645_0032240 | |||
| 982 | Ga0495645_0050882 | |||
| 983 | Ga0495622_0022237 | |||
| 984 | Ga0495622_0024901 | |||
| 985 | Ga0495622_0045253 | |||
| 986 | Ga0495622_0334794 | |||
| 987 | Ga0495633_0032976 | |||
| 988 | Ga0495667_0009330 | |||
| 989 | Ga0495667_0320136 | |||
| 990 | Ga0495668_0079355 | |||
| 991 | Ga0495634_0005531 | |||
| 992 | Ga0495634_0015826 | |||
| 993 | Ga0495634_0054603 | |||
| 994 | Ga0495634_0067825 | |||
| 995 | Ga0495634_0161036 | |||
| 996 | Ga0495611_0023607 | |||
| 997 | Ga0495611_0100820 | |||
| 998 | Ga0495611_0117844 | |||
| 999 | Ga0495625_0097561 | |||
| 1000 | Ga0495625_0469010 | |||
| 1001 | Ga0495635_0098428 | |||
| 1002 | Ga0495635_0201024 | |||
| 1003 | Ga0495661_0027671 | |||
| 1004 | Ga0495588_0001268 | |||
| 1005 | Ga0495588_0115384 | |||
| 1006 | Ga0495588_0299011 | |||
| 1007 | Ga0495588_0516029 | |||
| 1008 | Ga0495657_0001214 | |||
| 1009 | Ga0495657_0013555 | |||
| 1010 | Ga0495657_0020442 | |||
| 1011 | Ga0495657_0100978 | |||
| 1012 | Ga0495657_0124798 | |||
| 1013 | Ga0495657_0282724 | |||
| 1014 | Ga0495599_0194168 | |||
| 1015 | Ga0495599_0202379 | |||
| 1016 | Ga0495599_0559247 | |||
| 1017 | Ga0495623_0042876 | |||
| 1018 | Ga0495623_0062226 | |||
| 1019 | Ga0495623_0171290 | |||
| 1020 | Ga0495646_0004598 | |||
| 1021 | Ga0495646_0014451 | |||
| 1022 | Ga0495646_0222262 | |||
| 1023 | Ga0495646_0235315 | |||
| 1024 | Ga0495658_0144361 | |||
| 1025 | Ga0495658_0762414 | |||
| 1026 | Ga0495613_0003424 | |||
| 1027 | Ga0495613_0010395 | |||
| 1028 | Ga0495613_0012117 | |||
| 1029 | Ga0495613_0021841 | |||
| 1030 | Ga0495613_0043428 | |||
| 1031 | Ga0495613_0109870 | |||
| 1032 | Ga0495613_0135378 | |||
| 1033 | Ga0495613_0186143 | |||
| 1034 | Ga0495613_0326395 | |||
| 1035 | Ga0495613_0424172 | |||
| 1036 | Ga0495613_0568552 | |||
| 1037 | Ga0495624_0057743 | |||
| 1038 | Ga0495624_0076696 | |||
| 1039 | Ga0495624_0164911 | |||
| 1040 | Ga0495624_0271689 | |||
| 1041 | Ga0495670_0087594 | |||
| 1042 | Ga0495670_0419425 | |||
| 1043 | Ga0495671_0022519 | |||
| 1044 | Ga0495649_0012890 | |||
| 1045 | Ga0495649_0401384 | |||
| 1046 | Ga0495589_0042124 | |||
| 1047 | Ga0495589_0099476 | |||
| 1048 | Ga0495589_0116807 | |||
| 1049 | Ga0495589_0166580 | |||
| 1050 | Ga0495589_0320315 | |||
| 1051 | Ga0495600_0007018 | |||
| 1052 | Ga0495600_0041460 | |||
| 1053 | Ga0495600_0198955 | |||
| 1054 | Ga0495600_0523215 | |||
| 1055 | Ga0495660_0091248 | |||
| 1056 | Ga0495581_0005237 | |||
| 1057 | Ga0495581_0007377 | |||
| 1058 | Ga0495581_0023311 | |||
| 1059 | Ga0495604_0003060 | |||
| 1060 | Ga0495604_0026542 | |||
| 1061 | Ga0495604_0113627 | |||
| 1062 | Ga0495604_0118749 | |||
| 1063 | Ga0495604_0256408 | |||
| 1064 | Ga0495604_0773860 | |||
| 1065 | Ga0495636_0015865 | |||
| 1066 | Ga0495636_0049522 | |||
| 1067 | Ga0495636_0078232 | |||
| 1068 | Ga0495636_0137913 | |||
| 1069 | Ga0495674_0031505 | |||
| 1070 | Ga0495674_0333377 | |||
| 1071 | Ga0495674_0808390 | |||
| 1072 | Ga0495676_0005451 | |||
| 1073 | Ga0495676_0005856 | |||
| 1074 | Ga0495676_0009055 | |||
| 1075 | Ga0495676_0019746 | |||
| 1076 | Ga0495676_0028024 | |||
| 1077 | Ga0495676_0123941 | |||
| 1078 | Ga0495676_0810392 | |||
| 1079 | Ga0495680_0010275 | |||
| 1080 | Ga0495683_0241670 | |||
| 1081 | Ga0495687_006392 | |||
| 1082 | Ga0495687_042471 | |||
| 1083 | Ga0495687_043028 | |||
| 1084 | Ga0495687_070283 | |||
| 1085 | Ga0495675_0008068 | |||
| 1086 | Ga0495675_0106977 | |||
| 1087 | Ga0495675_0139685 | |||
| 1088 | Ga0495675_0142712 | |||
| 1089 | Ga0495675_0231928 | |||
| 1090 | Ga0495675_0374988 | |||
| 1091 | Ga0495675_0419713 | |||
| 1092 | Ga0495675_0471872 | |||
| 1093 | Ga0495685_005303 | |||
| 1094 | Ga0495685_018741 | |||
| 1095 | Ga0495685_109819 | |||
| 1096 | Ga0495673_0163867 | |||
| 1097 | Ga0495681_0000567 | |||
| 1098 | Ga0495681_0032151 | |||
| 1099 | Ga0495681_0077806 | |||
| 1100 | Ga0495684_0077790 | |||
| 1101 | Ga0495684_0095811 | |||
| 1102 | Ga0495686_0015791 | |||
| 1103 | Ga0495686_0084897 | |||
| 1104 | Ga0495593_0000488 | |||
| 1105 | Ga0495593_0126278 | |||
| 1106 | Ga0495593_0144866 | |||
| 1107 | Ga0495602_0077375 | |||
| 1108 | Ga0495602_0112376 | |||
| 1109 | Ga0495614_0003426 | |||
| 1110 | Ga0495614_0041644 | |||
| 1111 | Ga0495626_0015565 | |||
| 1112 | Ga0496102_0200450 | |||
| 1113 | Ga0496103_0096870 | |||
| 1114 | Ga0496104_0001987 | |||
| 1115 | Ga0496106_0155525 | |||
| 1116 | Ga0496108_0010274 | |||
| 1117 | Ga0496109_0005561 | |||
| 1118 | Ga0496109_0681273 | |||
| 1119 | Ga0496109_1532922 | |||
| 1120 | Ga0496110_0125508 | |||
| 1121 | Ga0496110_0802593 | |||
| 1122 | Ga0496111_0000176 | |||
| 1123 | Ga0496111_0894031 | |||
| 1124 | Ga0496113_0529357 | |||
| 1125 | Ga0496114_0369476 | |||
| 1126 | Ga0496114_1217354 | |||
| 1127 | Ga0496114_1592032 | |||
| 1128 | Ga0496115_0338177 | |||
| 1129 | Ga0496125_0318190 | |||
| 1130 | Ga0496126_0857791 | |||
| 1131 | Ga0501306_081757 | |||
| 1132 | Ga0501310_083203 | |||
| 1133 | Ga0495678_172916 | |||
| 1134 | Ga0495682_0047000 | |||
| 1135 | Ga0501317_043709 | |||
| 1136 | Ga0501322_019967 | |||
| 1137 | Ga0501031_0002467 | |||
| 1138 | Ga0501031_0033763 | |||
| 1139 | Ga0501031_0039348 | |||
| 1140 | Ga0501031_0091296 | |||
| 1141 | Ga0501031_0170939 | |||
| 1142 | Ga0501031_0171880 | |||
| 1143 | Ga0501031_0174821 | |||
| 1144 | Ga0501032_0008641 | |||
| 1145 | Ga0501032_0041778 | |||
| 1146 | Ga0501032_0073062 | |||
| 1147 | Ga0501032_0110060 | |||
| 1148 | Ga0501032_0161676 | |||
| 1149 | Ga0501032_0163717 | |||
| 1150 | Ga0501032_0164040 | |||
| 1151 | Ga0501033_0003519 | |||
| 1152 | Ga0501033_0011502 | |||
| 1153 | Ga0501033_0014547 | |||
| 1154 | Ga0501033_0026616 | |||
| 1155 | Ga0501033_0038081 | |||
| 1156 | Ga0501033_0053149 | |||
| 1157 | Ga0501033_0109891 | |||
| 1158 | Ga0501033_0116704 | |||
| 1159 | Ga0501033_0128487 | |||
| 1160 | Ga0501034_0007425 | |||
| 1161 | Ga0501034_0011443 | |||
| 1162 | Ga0501034_0015656 | |||
| 1163 | Ga0501034_0023142 | |||
| 1164 | Ga0501034_0035254 | |||
| 1165 | Ga0501034_0514398 | |||
| 1166 | Ga0501034_1065384 | |||
| 1167 | Ga0501034_1283275 | |||
| 1168 | Ga0501034_1577707 | |||
| 1169 | Ga0501036_0006643 | |||
| 1170 | Ga0501036_0017596 | |||
| 1171 | Ga0501036_0031200 | |||
| 1172 | Ga0501036_0031599 | |||
| 1173 | Ga0501036_0064257 | |||
| 1174 | Ga0501036_0225088 | |||
| 1175 | Ga0501036_0246677 | |||
| 1176 | Ga0501036_0302546 | |||
| 1177 | Ga0501037_0001324 | |||
| 1178 | Ga0501037_0019328 | |||
| 1179 | Ga0501037_0040582 | |||
| 1180 | Ga0501037_0075086 | |||
| 1181 | Ga0501037_0101845 | |||
| 1182 | Ga0501037_0194265 | |||
| 1183 | Ga0501037_0325636 | |||
| 1184 | Ga0501037_0546395 | |||
| 1185 | Ga0501038_0001194 | |||
| 1186 | Ga0501038_0005372 | |||
| 1187 | Ga0501038_0024208 | |||
| 1188 | Ga0501038_0049375 | |||
| 1189 | Ga0501038_0061563 | |||
| 1190 | Ga0501038_0064244 | |||
| 1191 | Ga0501038_0096954 | |||
| 1192 | Ga0501038_0231676 | |||
| 1193 | Ga0501038_1368772 | |||
| 1194 | Ga0501039_0047992 | |||
| 1195 | Ga0501039_0055212 | |||
| 1196 | Ga0501039_0431080 | |||
| 1197 | Ga0501040_0047457 | |||
| 1198 | Ga0501041_0006009 | |||
| 1199 | Ga0501042_0041545 | |||
| 1200 | Ga0501043_0001624 | |||
| 1201 | Ga0501043_0003998 | |||
| 1202 | Ga0501043_0017888 | |||
| 1203 | Ga0501043_0019731 | |||
| 1204 | Ga0501043_0027296 | |||
| 1205 | Ga0501043_0031845 | |||
| 1206 | Ga0501043_0058599 | |||
| 1207 | Ga0501043_0064550 | |||
| 1208 | Ga0501043_0108548 | |||
| 1209 | Ga0501043_0114459 | |||
| 1210 | Ga0501043_0271293 | |||
| 1211 | Ga0501046_0261205 | |||
| 1212 | Ga0501046_0946219 | |||
| 1213 | Ga0501047_0000110 | |||
| 1214 | Ga0501047_0008078 | |||
| 1215 | Ga0501047_0008535 | |||
| 1216 | Ga0501047_0009843 | |||
| 1217 | Ga0501047_0039504 | |||
| 1218 | Ga0501047_0098154 | |||
| 1219 | Ga0501047_0145397 | |||
| 1220 | Ga0501047_0189423 | |||
| 1221 | Ga0501047_0375671 | |||
| 1222 | Ga0501047_0376423 | |||
| 1223 | Ga0501048_0014635 | |||
| 1224 | Ga0501048_0492130 | |||
| 1225 | Ga0501048_0855050 | |||
| 1226 | Ga0501067_0010923 | |||
| 1227 | Ga0501067_0584739 | |||
| 1228 | Ga0501067_0766847 | |||
| 1229 | Ga0501068_0006918 | |||
| 1230 | Ga0501068_1032717 | |||
| 1231 | Ga0501069_0034082 | |||
| 1232 | Ga0501070_0022161 | |||
| 1233 | Ga0501070_0023294 | |||
| 1234 | Ga0501070_0194908 | |||
| 1235 | Ga0501070_0260232 | |||
| 1236 | Ga0501070_0307236 | |||
| 1237 | Ga0501070_0335980 | |||
| 1238 | Ga0501070_0404195 | |||
| 1239 | Ga0501070_0446150 | |||
| 1240 | Ga0501070_0544014 | |||
| 1241 | Ga0501070_1118244 | |||
| 1242 | Ga0501072_0012542 | |||
| 1243 | Ga0501072_1551483 | |||
| 1244 | Ga0501073_0013259 | |||
| 1245 | Ga0501073_0058150 | |||
| 1246 | Ga0501074_0013997 | |||
| 1247 | Ga0501074_0034649 | |||
| 1248 | Ga0501075_0096472 | |||
| 1249 | Ga0501076_0150934 | |||
| 1250 | Ga0501076_0483159 | |||
| 1251 | Ga0501076_0489873 | |||
| 1252 | Ga0501077_0024633 | |||
| 1253 | Ga0501202_170215 | |||
| 1254 | Ga0501227_195581 | |||
| 1255 | Ga0501221_180118 | |||
| 1256 | Ga0501079_0003173 | |||
| 1257 | Ga0501079_1039583 | |||
| 1258 | Ga0501079_1541738 | |||
| 1259 | Ga0501080_0025292 | |||
| 1260 | Ga0501080_0068525 | |||
| 1261 | Ga0501083_0004750 | |||
| 1262 | Ga0501035_0004388 | |||
| 1263 | Ga0501035_0005215 | |||
| 1264 | Ga0501035_0011367 | |||
| 1265 | Ga0501035_0014839 | |||
| 1266 | Ga0501035_0026105 | |||
| 1267 | Ga0501035_0101021 | |||
| 1268 | Ga0501035_0129751 | |||
| 1269 | Ga0501035_0150580 | |||
| 1270 | Ga0501035_0281893 | |||
| 1271 | Ga0501035_0368964 | |||
| 1272 | Ga0501035_0494612 | |||
| 1273 | Ga0501044_0004261 | |||
| 1274 | Ga0501044_0004420 | |||
| 1275 | Ga0501044_0020637 | |||
| 1276 | Ga0501044_0033712 | |||
| 1277 | Ga0501044_0108696 | |||
| 1278 | Ga0501044_0128367 | |||
| 1279 | Ga0501044_0142631 | |||
| 1280 | Ga0501044_0166315 | |||
| 1281 | Ga0501044_0237321 | |||
| 1282 | Ga0501044_0464529 | |||
| 1283 | Ga0501044_0859545 | |||
| 1284 | Ga0501045_0016414 | |||
| 1285 | Ga0501045_0216308 | |||
| 1286 | Ga0501045_0231417 | |||
| 1287 | Ga0501045_0270622 | |||
| 1288 | Ga0501045_0348481 | |||
| 1289 | Ga0501045_0402128 | |||
| 1290 | Ga0501045_0889401 | |||
| 1291 | nmdc:mga03n38_235664_c1 | |||
| 1292 | nmdc:mga0yw44_519596_c1 | |||
| 1293 | nmdc:mga08y16_174273_c1 | |||
| 1294 | nmdc:mga08x19_170982_c1 | |||
| 1295 | Ga0495601_0040509 | |||
| 1296 | Ga0495655_0027063 | |||
| 1297 | Ga0495595_0319577 | |||
| 1298 | Ga0495619_0009410 | |||
| 1299 | Ga0495619_0184798 | |||
| 1300 | Ga0495619_0544015 | |||
| 1301 | Ga0500578_0512382 | |||
| 1302 | Ga0500644_0028242 | |||
| 1303 | Ga0500583_0111776 | |||
| 1304 | Ga0500566_0175054 | |||
| 1305 | Ga0500640_015759 | |||
| 1306 | Ga0500560_002253 | |||
| 1307 | Ga0500560_044395 | |||
| 1308 | Ga0500572_013583 | |||
| 1309 | Ga0500608_281954 | |||
| 1310 | Ga0500642_0173840 | |||
| 1311 | Ga0500573_0455130 | |||
| 1312 | Ga0500600_0037488 | |||
| 1313 | Ga0501084_0022822 | |||
| 1314 | Ga0501084_0685764 | |||
| 1315 | Ga0587084_020241 | |||
| 1316 | Ga0587070_032381 | |||
| 1317 | Ga0587090_025852 | |||
| 1318 | Ga0587106_068807 | |||
| 1319 | Ga0587125_051234 | |||
| 1320 | Ga0587107_075264 | |||
| 1321 | Ga0587071_033775 | |||
| 1322 | Ga0501082_0008454 | |||
| 1323 | Ga0501082_1301438 | |||
| 1324 | Ga0466962_0000234 | |||
| 1325 | Ga0466962_0004079 | |||
| 1326 | Ga0466962_0040152 | |||
| 1327 | Ga0530510_0026751 | |||
| 1328 | Ga0530510_0053563 | |||
| 1329 | Ga0530510_0710404 | |||
| 1330 | 2554256367 | |||
| 1331 | 2585296439 | |||
| 1332 | 2585299498 | |||
| 1333 | 2585306965 | |||
| 1334 | 2585318640 | |||
| 1335 | 2616900071 | |||
| 1336 | 2643763846 | |||
| 1337 | 2643764161 | |||
| 1338 | 2643902431 | |||
| 1339 | 2643905006 | |||
| 1340 | 2643945503 | |||
| 1341 | 2644265972 | |||
| 1342 | 2644386741 | |||
| 1343 | 2644403065 | |||
| 1344 | 2644404002 | |||
| 1345 | 2644431166 | |||
| 1346 | 2644439868 | |||
| 1347 | 2644461406 | |||
| 1348 | 2644461720 | |||
| 1349 | 2644632801 | |||
| 1350 | 2768646945 | |||
| 1351 | 2785371317 | |||
| 1352 | 2786672504 | |||
| 1353 | 2793984655 | |||
| 1354 | 2808843876 | |||
| 1355 | 2808913416 | |||
| 1356 | 2809236326 | |||
| 1357 | 2811844589 | |||
| 1358 | 2819746569 | |||
| 1359 | 2852642109 | |||
| 1360 | 2862179130 | |||
| 1361 | 2862180280 | |||
| 1362 | 2862284926 | |||
| 1363 | 2862293021 | |||
| 1364 | 2862388621 | |||
| 1365 | 2862509483 | |||
| 1366 | 2862513321 | |||
| 1367 | 2862577684 | |||
| 1368 | 2867370822 | |||
| 1369 | 2867373704 | |||
| 1370 | 2867434540 | |||
| 1371 | 2867475436 | |||
| 1372 | 2867477659 | |||
| 1373 | 2875392422 | |||
| 1374 | 2875396524 | |||
| 1375 | 2877679288 | |||
| 1376 | 2912717886 | |||
| 1377 | 2912730311 | |||
| 1378 | 2912761123 | |||
| 1379 | 2912762589 | |||
| 1380 | 2918506325 | |||
| 1381 | 2919471556 | |||
| 1382 | 2935394517 | |||
| 1383 | 2946048030 | |||
| 1384 | 2946052389 | |||
| 1385 | 2946077582 | |||
| 1386 | 2954384173 | |||
| 1387 | 2954678776 | |||
| 1388 | 2954685377 | |||
| 1389 | 2954694995 | |||
| 1390 | 2954710169 | |||
| 1391 | 2954714488 | |||
| 1392 | 2954724434 | |||
| 1393 | 2954737384 | |||
| 1394 | 2954743356 | |||
| 1395 | 2954756237 | |||
| 1396 | 2954762313 | |||
| 1397 | 2966601008 | |||
| 1398 | 2997453231 | |||
| 1399 | 2997455567 | |||
| 1400 | 3006397089 | |||
| 1401 | 3006430041 | |||
| 1402 | 3006489035 | |||
| 1403 | 3006498092 | |||
| 1404 | 8008562612 | |||
| 1405 | 8008577323 | |||
| 1406 | 8023627965 | |||
| 1407 | 8025537064 | |||
| 1408 | 8047896305 | |||
| 1409 | 8048128081 | |||
| 1410 | 8048362631 | |||
| 1411 | 8048373314 | |||
| 1412 | 8048384928 | |||
| 1413 | 8048406625 | |||
| 1414 | 8054161162 | |||
| 1415 | 8056671487 | |||
| 1416 | 8056831988 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nbc-assembly1.cif.gz_C | structure of prokaryotic transcription factors | 0.8574 | 14 | 136 |
| 5nbc-assembly1.cif.gz_D | structure of prokaryotic transcription factors | 0.8561 | 15 | 135 |
| 2fu4-assembly1.cif.gz_A | crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) | 0.8521 | 3 | 82 |
| 4rb2-assembly1.cif.gz_D | crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur-mn2+-feoab1 operator | 0.8518 | 1 | 132 |
| 3f8n-assembly1.cif.gz_B | crystal structure of perr-zn-mn | 0.8505 | 3 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4razB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9495 | 3 | 81 | 1.10.10.10 |
| 5fd6D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9276 | 4 | 81 | 1.10.10.10 |
| 4rb3C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9243 | 3 | 81 | 1.10.10.10 |
| 4rb3D01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9143 | 1 | 81 | 1.10.10.10 |
| 4rb2C01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9039 | 1 | 81 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H1QI34-F1-model_v4 | deleted | 0.9916 | 15 | 138 |
|
| AF-A0A3S8W3J1-F1-model_v4 | Transcriptional repressor | 0.9874 | 1 | 138 |
GO:0000976
GO:0003700 GO:0008270 GO:0045892 GO:1900376 |
| AF-H1QI34-F1-model_v4 | deleted | 0.9837 | 15 | 138 |
|
| AF-A0A6N2HQP0-F1-model_v4 | Transcriptional repressor | 0.9782 | 1 | 137 |
GO:0000976
GO:0003700 GO:0008270 GO:0045892 GO:1900376 |
| AF-A0A1G9AJN5-F1-model_v4 | Fur family transcriptional regulator, ferric uptake regulator | 0.9758 | 1 | 136 |
GO:0000976
GO:0003700 GO:0008270 GO:0045892 GO:1900376 |