F476626

General Info

Members Datasets Scaffolds Average Seq Length
708 355 1416 138

Family's Representative Sequence

Representative Sequence 3300049578|Ga0501042_0644272|Ga0501042_0644272_52_534
Length 160
Sequence LHGDGSLTWYHRKKMPRNLSDRLRQREWRLTAQRRIVAEVLEGEHVHLTADEVYRRAVARLPEISRATVYNTLKELTDLGEVLEVTIDARAKRFDPNAKDPHQHLVCERCGVIRDVHLEARPGPMLPAGERHGFVLTAADIVFRGVCPACAGKQDRRKRR

Samples

Sample ID Description Type Environment
1 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
51 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
73 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
74 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
75 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
79 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
84 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
85 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
89 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
92 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
95 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
96 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
97 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
98 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
99 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
100 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
101 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
102 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
103 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
104 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
105 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
121 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
189 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
244 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
245 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
257 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
264 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
265 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
266 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
267 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
268 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
269 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
270 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
283 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
284 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
285 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
286 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
287 2643221548 Streptomyces sp. Root55 Isolate Unclassified
288 2643221578 Streptomyces sp. Root63 Isolate Unclassified
289 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
290 2643221647 Streptomyces sp. Root369 Isolate Unclassified
291 2643221670 Streptomyces sp. Root431 Isolate Unclassified
292 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
293 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
294 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
295 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
296 2643221714 Streptomyces sp. Root264 Isolate Unclassified
297 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
298 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
299 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
300 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
301 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
302 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
303 2808606448 Streptomyces sp. 193411 Isolate Unclassified
304 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
305 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
306 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
307 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
308 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
309 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
310 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
311 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
312 2862574272 Streptomyces sp. AcE210 Isolate Nodule
313 2867369537 Streptomyces sp. Z26 Isolate Unclassified
314 2867428634 Streptomyces sp. RP5T Isolate Unclassified
315 2867475112 Streptomyces sp. TM32 Isolate Unclassified
316 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
317 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
318 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
319 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
320 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
321 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
322 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
323 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
324 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
325 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
326 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
327 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
328 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
329 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
330 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
331 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
332 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
333 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
334 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
335 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
336 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
337 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
338 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
339 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
340 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
341 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
342 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
343 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
344 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
345 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
346 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
347 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
348 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
349 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
350 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
351 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
352 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
353 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
354 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
355 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.45
Metatranscriptomes 2.26
Isolates 12.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 0.71
Rhizoplane 2.54
Rhizosphere 85.73
Stem 0
Stem Tuber 0
Unclassified 1.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501042_0644272 3300049578 Unclassified 770
2 JGI24739J22299_10132641 3300001989 Bacteria 740
3 JGI24737J22298_10067564 3300001990 Bacteria 1069
4 rootH1_10019195 3300003316 Bacteria 3884
5 rootH2_10060685 3300003320 Bacteria 2188
6 rootH1_10091162 3300003323 Bacteria 1685
7 JGI25160J50197_1009351 3300003354 Bacteria 3644
8 JGI25160J50197_1009544 3300003354 Bacteria 3588
9 JGI25160J50197_1091987 3300003354 Bacteria 549
10 Ga0070690_101210393 3300005330 Unclassified 603
11 Ga0070680_101183313 3300005336 Bacteria 661
12 Ga0068868_101508957 3300005338 Bacteria 629
13 Ga0070668_101799039 3300005347 Bacteria 563
14 Ga0070678_101986934 3300005456 Bacteria 550
15 Ga0070681_11476556 3300005458 Bacteria 604
16 Ga0070686_100410756 3300005544 Bacteria 1032
17 Ga0070704_100438118 3300005549 Bacteria 1122
18 Ga0068855_100075048 3300005563 Bacteria 3926
19 Ga0068855_100132732 3300005563 Bacteria 2843
20 Ga0068854_101714125 3300005578 Bacteria 575
21 Ga0068856_100484683 3300005614 Bacteria 1258
22 Ga0068859_100303123 3300005617 Bacteria 1691
23 Ga0068864_100134844 3300005618 Bacteria 2222
24 Ga0068870_10353475 3300005840 Bacteria 944
25 Ga0068858_101029214 3300005842 Bacteria 807
26 Ga0068862_101813230 3300005844 Unclassified 619
27 Ga0068865_100353000 3300006881 Bacteria 1192
28 Ga0075436_100188405 3300006914 Bacteria 1459
29 Ga0097620_100303129 3300006931 Bacteria 1691
30 Ga0099826_10067827 3300006948 Bacteria 2281
31 Ga0105240_10027872 3300009093 Bacteria 7390
32 Ga0111539_10106652 3300009094 Bacteria 3287
33 Ga0105245_10257993 3300009098 Bacteria 1695
34 Ga0105245_12226492 3300009098 Bacteria 602
35 Ga0105243_10398119 3300009148 Bacteria 1278
36 Ga0105242_10998858 3300009176 Bacteria 844
37 Ga0105242_11665724 3300009176 Unclassified 673
38 Ga0105248_10642371 3300009177 Bacteria 1197
39 Ga0105238_10522624 3300009551 Bacteria 1189
40 Ga0105246_10249858 3300011119 Bacteria 1407
41 Ga0157313_1027653 3300012503 Bacteria 623
42 Ga0157369_10087579 3300013105 Bacteria 3325
43 Ga0157374_10773822 3300013296 Bacteria 975
44 Ga0157378_10975161 3300013297 Bacteria 881
45 Ga0163162_10071458 3300013306 Bacteria 3523
46 Ga0163162_12149436 3300013306 Bacteria 640
47 Ga0157372_10208360 3300013307 Bacteria 2265
48 Ga0157375_10605617 3300013308 Bacteria 1254
49 Ga0157375_10725291 3300013308 Bacteria 1146
50 Ga0157376_10263507 3300014969 Bacteria 1616
51 Ga0182006_1017034 3300015261 Bacteria 3093
52 Ga0182007_10002422 3300015262 Bacteria 9315
53 Ga0206355_1208892 3300020076 Bacteria 1013
54 Ga0206353_10306429 3300020082 Bacteria 507
55 Ga0213875_10052410 3300021388 Bacteria 1911
56 Ga0209758_1013617 3300025297 Bacteria 4413
57 Ga0207426_1000396 3300025302 Bacteria 74072
58 Ga0207426_1001513 3300025302 Bacteria 18969
59 Ga0207426_1002187 3300025302 Bacteria 13196
60 Ga0207426_1005153 3300025302 Bacteria 6084
61 Ga0207426_1006361 3300025302 Bacteria 5153
62 Ga0207426_1038653 3300025302 Bacteria 1501
63 Ga0207426_1130571 3300025302 Bacteria 609
64 Ga0207696_1040208 3300025711 Bacteria 1370
65 Ga0207710_10220129 3300025900 Bacteria 942
66 Ga0207688_10651880 3300025901 Bacteria 665
67 Ga0207647_10005240 3300025904 Bacteria 9543
68 Ga0207707_10550293 3300025912 Bacteria 980
69 Ga0207695_10038526 3300025913 Bacteria 5145
70 Ga0207686_10473785 3300025934 Bacteria 967
71 Ga0207709_10306891 3300025935 Bacteria 1182
72 Ga0207667_10075912 3300025949 Bacteria 3488
73 Ga0207667_10408358 3300025949 Bacteria 1382
74 Ga0207668_12059916 3300025972 Bacteria 514
75 Ga0207640_10069392 3300025981 Bacteria 2366
76 Ga0207703_11505356 3300026035 Unclassified 647
77 Ga0207639_11632252 3300026041 Bacteria 605
78 Ga0207648_10693005 3300026089 Bacteria 944
79 Ga0207676_10640184 3300026095 Bacteria 1025
80 Ga0209371_1067381 3300027312 Bacteria 643
81 Ga0209282_1100910 3300027666 Bacteria 1486
82 Ga0207428_11035629 3300027907 Unclassified 576
83 Ga0268256_1018141 3300030500 Bacteria 1963
84 Ga0307511_10074842 3300030521 Bacteria 2437
85 Ga0307512_10004518 3300030522 Bacteria 15212
86 Ga0307508_10006837 3300031616 Bacteria 10669
87 Ga0307508_10063623 3300031616 Bacteria 3254
88 Ga0307514_10059521 3300031649 Bacteria 2918
89 Ga0307514_10079423 3300031649 Bacteria 2432
90 Ga0316577_10807722 3300031733 Unclassified 532
91 Ga0307518_10063769 3300031838 Bacteria 2674
92 Ga0307518_10185994 3300031838 Bacteria 1398
93 Ga0307416_101605613 3300032002 Bacteria 755
94 Ga0307416_103035409 3300032002 Bacteria 562
95 Ga0316593_10109099 3300032168 Bacteria 987
96 Ga0316593_10167277 3300032168 Bacteria 805
97 Ga0316593_10301246 3300032168 Unclassified 607
98 Ga0307507_10045296 3300033179 Bacteria 4330
99 Ga0307510_10230001 3300033180 Bacteria 1357
100 Ga0307510_10406999 3300033180 Bacteria 803
101 Ga0395898_0003092 3300037466 Bacteria 18832
102 Ga0395898_0230829 3300037466 Bacteria 1765
103 Ga0395898_0396822 3300037466 Bacteria 1315
104 Ga0436364_1242868 3300037853 Bacteria 2666
105 Ga0395901_0074271 3300038443 Bacteria 3547
106 Ga0395901_0507829 3300038443 Bacteria 1227
107 Ga0439436_0002729 3300041404 Bacteria 5333
108 Ga0439436_0003166 3300041404 Bacteria 4989
109 Ga0439439_0033271 3300041406 Bacteria 1319
110 Ga0439453_0124307 3300041408 Bacteria 594
111 Ga0451853_2009427 3300041512 Bacteria 2464
112 Ga0439433_0002860 3300041999 Bacteria 3688
113 Ga0439433_0036333 3300041999 Bacteria 1138
114 Ga0439448_0004898 3300042005 Bacteria 3799
115 Ga0439448_0024821 3300042005 Bacteria 1877
116 Ga0439432_040878 3300042006 Bacteria 1470
117 Ga0439449_0000358 3300042007 Bacteria 16753
118 Ga0439449_0120838 3300042007 Bacteria 972
119 Ga0439449_0264335 3300042007 Bacteria 647
120 Ga0439450_044395 3300042008 Bacteria 1041
121 Ga0439454_016112 3300042011 Bacteria 1053
122 Ga0439455_0010286 3300042012 Bacteria 2055
123 Ga0439457_002398 3300042014 Bacteria 5357
124 Ga0439457_004233 3300042014 Bacteria 3778
125 Ga0439462_0028590 3300042015 Bacteria 1474
126 Ga0450920_114001 3300042122 Bacteria 565
127 Ga0450897_009761 3300042128 Bacteria 913
128 Ga0450894_000136 3300042131 Bacteria 12932
129 Ga0450898_000424 3300042134 Bacteria 4906
130 Ga0450898_025572 3300042134 Bacteria 1060
131 Ga0450902_008532 3300042137 Bacteria 1602
132 Ga0450903_000233 3300042138 Bacteria 12380
133 Ga0450906_018467 3300042145 Bacteria 1251
134 Ga0450907_013840 3300042146 Bacteria 1345
135 Ga0439458_0018008 3300042157 Bacteria 1615
136 Ga0450901_012411 3300042533 Bacteria 889
137 Ga0466969_0012190 3300044656 Bacteria 4542
138 Ga0466969_0083017 3300044656 Bacteria 1526
139 Ga0466972_0004064 3300044658 Bacteria 7302
140 Ga0466972_0004540 3300044658 Bacteria 6952
141 Ga0466972_0023472 3300044658 Bacteria 3067
142 Ga0466972_0067178 3300044658 Bacteria 1713
143 Ga0466972_0109751 3300044658 Bacteria 1304
144 Ga0466965_0031059 3300044683 Bacteria 2603
145 Ga0466966_0003918 3300044684 Bacteria 9828
146 Ga0466966_0008100 3300044684 Bacteria 6967
147 Ga0466966_0027375 3300044684 Bacteria 3717
148 Ga0466966_0354438 3300044684 Bacteria 882
149 Ga0466961_0017066 3300044693 Bacteria 4662
150 Ga0466961_0023342 3300044693 Bacteria 3980
151 Ga0466961_0062455 3300044693 Bacteria 2367
152 Ga0466961_0073046 3300044693 Bacteria 2175
153 Ga0466961_0080676 3300044693 Bacteria 2059
154 Ga0466963_0000213 3300044694 Bacteria 24764
155 Ga0466963_0003003 3300044694 Bacteria 9546
156 Ga0466963_0039151 3300044694 Bacteria 3104
157 Ga0466964_0012547 3300044706 Bacteria 3207
158 Ga0466964_0025974 3300044706 Bacteria 2290
159 Ga0466971_0000575 3300044719 Bacteria 14492
160 Ga0466971_0001207 3300044719 Bacteria 10748
161 Ga0466971_0172792 3300044719 Bacteria 1014
162 Ga0466970_0001274 3300044765 Bacteria 12183
163 Ga0466970_0006583 3300044765 Bacteria 5810
164 Ga0466970_0177661 3300044765 Bacteria 1181
165 Ga0466970_0185410 3300044765 Bacteria 1155
166 Ga0466970_0570321 3300044765 Bacteria 655
167 Ga0466970_0860022 3300044765 Bacteria 532
168 Ga0466957_0023199 3300044842 Bacteria 3666
169 Ga0466957_0484362 3300044842 Bacteria 856
170 Ga0466960_0102207 3300044901 Bacteria 1478
171 Ga0466960_0236237 3300044901 Bacteria 1010
172 Ga0466959_0002515 3300045049 Bacteria 11755
173 Ga0466959_0003363 3300045049 Bacteria 10451
174 Ga0466959_0029667 3300045049 Bacteria 4053
175 Ga0466959_0728170 3300045049 Bacteria 664
176 Ga0466958_0082986 3300045836 Bacteria 1974
177 Ga0466958_0323776 3300045836 Bacteria 991
178 Ga0466958_0877133 3300045836 Bacteria 585
179 Ga0466967_0052759 3300045976 Bacteria 3571
180 Ga0466967_0192631 3300045976 Bacteria 1927
181 Ga0466967_0212446 3300045976 Bacteria 1835
182 Ga0466967_1401693 3300045976 Bacteria 696
183 Ga0495617_082112 3300046452 Bacteria 1055
184 Ga0495627_064266 3300046453 Bacteria 1080
185 Ga0495592_0000574 3300046454 Bacteria 26037
186 Ga0495592_0028509 3300046454 Bacteria 4228
187 Ga0495592_0210741 3300046454 Bacteria 1305
188 Ga0495603_0028210 3300046455 Bacteria 3385
189 Ga0495603_0234590 3300046455 Bacteria 1057
190 Ga0495603_0272480 3300046455 Bacteria 973
191 Ga0495603_0341877 3300046455 Bacteria 858
192 Ga0495629_0000405 3300046459 Bacteria 36057
193 Ga0495629_0002819 3300046459 Bacteria 13265
194 Ga0495629_0009074 3300046459 Bacteria 7287
195 Ga0495629_0013612 3300046459 Bacteria 5869
196 Ga0495629_0078601 3300046459 Bacteria 2303
197 Ga0495629_0121152 3300046459 Bacteria 1822
198 Ga0495629_0384081 3300046459 Bacteria 955
199 Ga0495638_0101286 3300046460 Bacteria 1722
200 Ga0495638_0626291 3300046460 Bacteria 525
201 Ga0495651_0056038 3300046462 Bacteria 3028
202 Ga0495651_0102999 3300046462 Bacteria 2121
203 Ga0495651_0259698 3300046462 Bacteria 1182
204 Ga0495653_0061599 3300046463 Bacteria 2838
205 Ga0495580_0098754 3300046472 Bacteria 2031
206 Ga0495582_0100885 3300046473 Bacteria 1616
207 Ga0495582_0181594 3300046473 Bacteria 1199
208 Ga0495582_0647639 3300046473 Bacteria 611
209 Ga0495605_0004096 3300046474 Bacteria 8602
210 Ga0495639_0018492 3300046475 Bacteria 3035
211 Ga0495639_0092804 3300046475 Bacteria 1418
212 Ga0495662_0000154 3300046476 Bacteria 27091
213 Ga0495662_0012526 3300046476 Bacteria 4137
214 Ga0495662_0013250 3300046476 Bacteria 4013
215 Ga0495662_0018848 3300046476 Bacteria 3339
216 Ga0495662_0026659 3300046476 Bacteria 2790
217 Ga0495662_0035348 3300046476 Bacteria 2411
218 Ga0495662_0039446 3300046476 Bacteria 2281
219 Ga0495662_0101601 3300046476 Bacteria 1406
220 Ga0495664_0004639 3300046477 Bacteria 7514
221 Ga0495664_0031093 3300046477 Bacteria 3128
222 Ga0495664_0202095 3300046477 Bacteria 1204
223 Ga0495664_0554005 3300046477 Bacteria 685
224 Ga0495584_0393895 3300046491 Bacteria 704
225 Ga0495585_0019750 3300046492 Bacteria 3882
226 Ga0495585_0118469 3300046492 Bacteria 1402
227 Ga0495585_0147331 3300046492 Bacteria 1229
228 Ga0495594_0005107 3300046499 Bacteria 6755
229 Ga0495594_0026114 3300046499 Bacteria 3140
230 Ga0495594_0078134 3300046499 Bacteria 1846
231 Ga0495594_0861964 3300046499 Bacteria 509
232 Ga0495607_0170128 3300046501 Bacteria 1101
233 Ga0495583_0061262 3300046506 Bacteria 1679
234 Ga0495583_0180048 3300046506 Bacteria 866
235 Ga0495608_0005526 3300046511 Bacteria 9028
236 Ga0495608_0129963 3300046511 Bacteria 1612
237 Ga0495610_0074964 3300046512 Bacteria 1568
238 Ga0495616_0061904 3300046513 Bacteria 1834
239 Ga0495618_0022418 3300046514 Bacteria 3900
240 Ga0495618_0886815 3300046514 Bacteria 515
241 Ga0495620_0016425 3300046515 Bacteria 3714
242 Ga0495628_0005810 3300046516 Bacteria 10806
243 Ga0495628_0158132 3300046516 Bacteria 1723
244 Ga0495628_0178311 3300046516 Bacteria 1608
245 Ga0495630_0033011 3300046517 Bacteria 3860
246 Ga0495630_0033921 3300046517 Bacteria 3807
247 Ga0495631_0018548 3300046518 Bacteria 3273
248 Ga0495631_0047678 3300046518 Bacteria 1880
249 Ga0495637_0047011 3300046520 Bacteria 1824
250 Ga0495637_0370716 3300046520 Bacteria 500
251 Ga0495644_0410340 3300046523 Bacteria 537
252 Ga0495648_0030330 3300046524 Bacteria 3577
253 Ga0495666_0007896 3300046526 Bacteria 5329
254 Ga0495652_0030071 3300046529 Bacteria 4766
255 Ga0495652_0037557 3300046529 Bacteria 4201
256 Ga0495652_0111389 3300046529 Bacteria 2201
257 Ga0495652_0175580 3300046529 Bacteria 1649
258 Ga0495665_0013928 3300046531 Bacteria 4343
259 Ga0495665_0046977 3300046531 Bacteria 2291
260 Ga0495665_0457515 3300046531 Bacteria 645
261 Ga0495640_0010190 3300046533 Bacteria 7274
262 Ga0495640_0035770 3300046533 Bacteria 3513
263 Ga0495640_0083077 3300046533 Bacteria 2126
264 Ga0495640_0536599 3300046533 Bacteria 710
265 Ga0495586_0027327 3300046535 Bacteria 3053
266 Ga0495586_0092894 3300046535 Bacteria 1668
267 Ga0495587_0003221 3300046536 Bacteria 10913
268 Ga0495587_0018256 3300046536 Bacteria 4351
269 Ga0495609_0074505 3300046538 Bacteria 1488
270 Ga0495609_0147933 3300046538 Bacteria 1000
271 Ga0495609_0159745 3300046538 Bacteria 956
272 Ga0495597_0032768 3300046542 Bacteria 2356
273 Ga0495645_0032240 3300046543 Bacteria 3821
274 Ga0495645_0050882 3300046543 Bacteria 3014
275 Ga0495622_0022237 3300046557 Bacteria 2954
276 Ga0495622_0024901 3300046557 Bacteria 2794
277 Ga0495622_0045253 3300046557 Bacteria 2045
278 Ga0495622_0334794 3300046557 Bacteria 656
279 Ga0495633_0032976 3300046558 Bacteria 2499
280 Ga0495667_0009330 3300046559 Bacteria 6648
281 Ga0495667_0320136 3300046559 Bacteria 981
282 Ga0495668_0079355 3300046616 Bacteria 1801
283 Ga0495634_0005531 3300046642 Bacteria 9699
284 Ga0495634_0015826 3300046642 Bacteria 5405
285 Ga0495634_0054603 3300046642 Bacteria 2673
286 Ga0495634_0067825 3300046642 Bacteria 2358
287 Ga0495634_0161036 3300046642 Bacteria 1415
288 Ga0495611_0023607 3300046648 Bacteria 2670
289 Ga0495611_0100820 3300046648 Bacteria 1341
290 Ga0495611_0117844 3300046648 Bacteria 1237
291 Ga0495625_0097561 3300046660 Bacteria 2022
292 Ga0495625_0469010 3300046660 Bacteria 775
293 Ga0495635_0098428 3300046663 Bacteria 1999
294 Ga0495635_0201024 3300046663 Bacteria 1351
295 Ga0495661_0027671 3300046665 Bacteria 3637
296 Ga0495588_0001268 3300046674 Bacteria 10834
297 Ga0495588_0115384 3300046674 Bacteria 1415
298 Ga0495588_0299011 3300046674 Bacteria 847
299 Ga0495588_0516029 3300046674 Bacteria 626
300 Ga0495657_0001214 3300046675 Bacteria 22612
301 Ga0495657_0013555 3300046675 Bacteria 6009
302 Ga0495657_0020442 3300046675 Bacteria 4757
303 Ga0495657_0100978 3300046675 Bacteria 1838
304 Ga0495657_0124798 3300046675 Bacteria 1618
305 Ga0495657_0282724 3300046675 Bacteria 992
306 Ga0495599_0194168 3300046678 Bacteria 1248
307 Ga0495599_0202379 3300046678 Bacteria 1219
308 Ga0495599_0559247 3300046678 Bacteria 669
309 Ga0495623_0042876 3300046679 Bacteria 2880
310 Ga0495623_0062226 3300046679 Bacteria 2339
311 Ga0495623_0171290 3300046679 Bacteria 1268
312 Ga0495646_0004598 3300046680 Bacteria 8699
313 Ga0495646_0014451 3300046680 Bacteria 5020
314 Ga0495646_0222262 3300046680 Bacteria 1021
315 Ga0495646_0235315 3300046680 Bacteria 986
316 Ga0495658_0144361 3300046683 Bacteria 1457
317 Ga0495658_0762414 3300046683 Bacteria 620
318 Ga0495613_0003424 3300046689 Bacteria 11856
319 Ga0495613_0010395 3300046689 Bacteria 6912
320 Ga0495613_0012117 3300046689 Bacteria 6408
321 Ga0495613_0021841 3300046689 Bacteria 4770
322 Ga0495613_0043428 3300046689 Bacteria 3326
323 Ga0495613_0109870 3300046689 Bacteria 1987
324 Ga0495613_0135378 3300046689 Bacteria 1763
325 Ga0495613_0186143 3300046689 Bacteria 1469
326 Ga0495613_0326395 3300046689 Bacteria 1058
327 Ga0495613_0424172 3300046689 Bacteria 904
328 Ga0495613_0568552 3300046689 Bacteria 757
329 Ga0495624_0057743 3300046690 Bacteria 2439
330 Ga0495624_0076696 3300046690 Bacteria 2074
331 Ga0495624_0164911 3300046690 Bacteria 1352
332 Ga0495624_0271689 3300046690 Bacteria 1024
333 Ga0495670_0087594 3300046691 Bacteria 1591
334 Ga0495670_0419425 3300046691 Bacteria 724
335 Ga0495671_0022519 3300046692 Bacteria 3300
336 Ga0495649_0012890 3300046694 Bacteria 4843
337 Ga0495649_0401384 3300046694 Bacteria 688
338 Ga0495589_0042124 3300046794 Bacteria 2276
339 Ga0495589_0099476 3300046794 Bacteria 1408
340 Ga0495589_0116807 3300046794 Bacteria 1285
341 Ga0495589_0166580 3300046794 Bacteria 1049
342 Ga0495589_0320315 3300046794 Bacteria 716
343 Ga0495600_0007018 3300046809 Bacteria 6879
344 Ga0495600_0041460 3300046809 Bacteria 3000
345 Ga0495600_0198955 3300046809 Bacteria 1287
346 Ga0495600_0523215 3300046809 Bacteria 727
347 Ga0495660_0091248 3300046810 Bacteria 1582
348 Ga0495581_0005237 3300047315 Bacteria 7500
349 Ga0495581_0007377 3300047315 Bacteria 6356
350 Ga0495581_0023311 3300047315 Bacteria 3587
351 Ga0495604_0003060 3300047317 Bacteria 13364
352 Ga0495604_0026542 3300047317 Bacteria 4610
353 Ga0495604_0113627 3300047317 Bacteria 1970
354 Ga0495604_0118749 3300047317 Bacteria 1916
355 Ga0495604_0256408 3300047317 Bacteria 1190
356 Ga0495604_0773860 3300047317 Bacteria 606
357 Ga0495636_0015865 3300047318 Bacteria 3004
358 Ga0495636_0049522 3300047318 Bacteria 1757
359 Ga0495636_0078232 3300047318 Bacteria 1420
360 Ga0495636_0137913 3300047318 Bacteria 1088
361 Ga0495674_0031505 3300047319 Bacteria 4817
362 Ga0495674_0333377 3300047319 Bacteria 1234
363 Ga0495674_0808390 3300047319 Bacteria 729
364 Ga0495676_0005451 3300047321 Bacteria 11667
365 Ga0495676_0005856 3300047321 Bacteria 11286
366 Ga0495676_0009055 3300047321 Bacteria 9082
367 Ga0495676_0019746 3300047321 Bacteria 5924
368 Ga0495676_0028024 3300047321 Bacteria 4819
369 Ga0495676_0123941 3300047321 Bacteria 1875
370 Ga0495676_0810392 3300047321 Bacteria 602
371 Ga0495680_0010275 3300047322 Bacteria 8350
372 Ga0495683_0241670 3300047323 Bacteria 796
373 Ga0495687_006392 3300047443 Bacteria 7232
374 Ga0495687_042471 3300047443 Bacteria 1986
375 Ga0495687_043028 3300047443 Bacteria 1970
376 Ga0495687_070283 3300047443 Bacteria 1406
377 Ga0495675_0008068 3300047444 Bacteria 6518
378 Ga0495675_0106977 3300047444 Bacteria 1748
379 Ga0495675_0139685 3300047444 Bacteria 1502
380 Ga0495675_0142712 3300047444 Bacteria 1483
381 Ga0495675_0231928 3300047444 Bacteria 1114
382 Ga0495675_0374988 3300047444 Bacteria 833
383 Ga0495675_0419713 3300047444 Bacteria 777
384 Ga0495675_0471872 3300047444 Bacteria 723
385 Ga0495685_005303 3300047447 Bacteria 4203
386 Ga0495685_018741 3300047447 Bacteria 2376
387 Ga0495685_109819 3300047447 Bacteria 908
388 Ga0495673_0163867 3300047469 Bacteria 852
389 Ga0495681_0000567 3300047470 Bacteria 28271
390 Ga0495681_0032151 3300047470 Bacteria 2645
391 Ga0495681_0077806 3300047470 Bacteria 1488
392 Ga0495684_0077790 3300047471 Bacteria 2517
393 Ga0495684_0095811 3300047471 Bacteria 2246
394 Ga0495686_0015791 3300047472 Bacteria 5140
395 Ga0495686_0084897 3300047472 Bacteria 1929
396 Ga0495593_0000488 3300047673 Bacteria 22326
397 Ga0495593_0126278 3300047673 Bacteria 1300
398 Ga0495593_0144866 3300047673 Bacteria 1202
399 Ga0495602_0077375 3300048088 Bacteria 2815
400 Ga0495602_0112376 3300048088 Bacteria 2210
401 Ga0495614_0003426 3300048089 Bacteria 7096
402 Ga0495614_0041644 3300048089 Bacteria 1970
403 Ga0495626_0015565 3300048091 Bacteria 3890
404 Ga0496102_0200450 3300048905 Bacteria 1881
405 Ga0496103_0096870 3300048906 Bacteria 1865
406 Ga0496104_0001987 3300048907 Bacteria 17732
407 Ga0496106_0155525 3300048909 Bacteria 1805
408 Ga0496108_0010274 3300048911 Bacteria 7599
409 Ga0496109_0005561 3300048912 Bacteria 10552
410 Ga0496109_0681273 3300048912 Bacteria 965
411 Ga0496109_1532922 3300048912 Bacteria 601
412 Ga0496110_0125508 3300048913 Bacteria 2315
413 Ga0496110_0802593 3300048913 Bacteria 846
414 Ga0496111_0000176 3300048914 Bacteria 28843
415 Ga0496111_0894031 3300048914 Bacteria 640
416 Ga0496113_0529357 3300048916 Bacteria 946
417 Ga0496114_0369476 3300048917 Bacteria 1269
418 Ga0496114_1217354 3300048917 Bacteria 639
419 Ga0496114_1592032 3300048917 Bacteria 541
420 Ga0496115_0338177 3300048918 Bacteria 1229
421 Ga0496125_0318190 3300048928 Bacteria 945
422 Ga0496126_0857791 3300048929 Bacteria 692
423 Ga0501306_081757 3300049127 Bacteria 558
424 Ga0501310_083203 3300049130 Bacteria 505
425 Ga0495678_172916 3300049459 Bacteria 682
426 Ga0495682_0047000 3300049460 Bacteria 1575
427 Ga0501317_043709 3300049533 Bacteria 692
428 Ga0501322_019967 3300049538 Bacteria 582
429 Ga0501031_0002467 3300049568 Bacteria 11802
430 Ga0501031_0033763 3300049568 Bacteria 3340
431 Ga0501031_0039348 3300049568 Bacteria 3085
432 Ga0501031_0091296 3300049568 Bacteria 1986
433 Ga0501031_0170939 3300049568 Bacteria 1420
434 Ga0501031_0171880 3300049568 Bacteria 1416
435 Ga0501031_0174821 3300049568 Bacteria 1403
436 Ga0501032_0008641 3300049569 Bacteria 7422
437 Ga0501032_0041778 3300049569 Bacteria 3112
438 Ga0501032_0073062 3300049569 Bacteria 2285
439 Ga0501032_0110060 3300049569 Bacteria 1823
440 Ga0501032_0161676 3300049569 Bacteria 1470
441 Ga0501032_0163717 3300049569 Bacteria 1460
442 Ga0501032_0164040 3300049569 Bacteria 1458
443 Ga0501033_0003519 3300049570 Bacteria 12825
444 Ga0501033_0011502 3300049570 Bacteria 6774
445 Ga0501033_0014547 3300049570 Bacteria 5973
446 Ga0501033_0026616 3300049570 Bacteria 4351
447 Ga0501033_0038081 3300049570 Bacteria 3597
448 Ga0501033_0053149 3300049570 Bacteria 3000
449 Ga0501033_0109891 3300049570 Bacteria 2007
450 Ga0501033_0116704 3300049570 Bacteria 1939
451 Ga0501033_0128487 3300049570 Bacteria 1837
452 Ga0501034_0007425 3300049571 Bacteria 11667
453 Ga0501034_0011443 3300049571 Bacteria 9191
454 Ga0501034_0015656 3300049571 Bacteria 7788
455 Ga0501034_0023142 3300049571 Bacteria 6332
456 Ga0501034_0035254 3300049571 Bacteria 5073
457 Ga0501034_0514398 3300049571 Bacteria 1109
458 Ga0501034_1065384 3300049571 Bacteria 690
459 Ga0501034_1283275 3300049571 Bacteria 609
460 Ga0501034_1577707 3300049571 Bacteria 530
461 Ga0501036_0006643 3300049572 Bacteria 9401
462 Ga0501036_0017596 3300049572 Bacteria 5978
463 Ga0501036_0031200 3300049572 Bacteria 4503
464 Ga0501036_0031599 3300049572 Bacteria 4474
465 Ga0501036_0064257 3300049572 Bacteria 3106
466 Ga0501036_0225088 3300049572 Bacteria 1574
467 Ga0501036_0246677 3300049572 Bacteria 1497
468 Ga0501036_0302546 3300049572 Bacteria 1337
469 Ga0501037_0001324 3300049573 Bacteria 18177
470 Ga0501037_0019328 3300049573 Bacteria 5024
471 Ga0501037_0040582 3300049573 Bacteria 3425
472 Ga0501037_0075086 3300049573 Bacteria 2456
473 Ga0501037_0101845 3300049573 Bacteria 2072
474 Ga0501037_0194265 3300049573 Bacteria 1436
475 Ga0501037_0325636 3300049573 Bacteria 1063
476 Ga0501037_0546395 3300049573 Unclassified 782
477 Ga0501038_0001194 3300049574 Bacteria 23626
478 Ga0501038_0005372 3300049574 Bacteria 11900
479 Ga0501038_0024208 3300049574 Bacteria 5417
480 Ga0501038_0049375 3300049574 Bacteria 3638
481 Ga0501038_0061563 3300049574 Bacteria 3209
482 Ga0501038_0064244 3300049574 Bacteria 3130
483 Ga0501038_0096954 3300049574 Bacteria 2460
484 Ga0501038_0231676 3300049574 Bacteria 1470
485 Ga0501038_1368772 3300049574 Bacteria 509
486 Ga0501039_0047992 3300049575 Bacteria 3300
487 Ga0501039_0055212 3300049575 Bacteria 3075
488 Ga0501039_0431080 3300049575 Bacteria 1035
489 Ga0501040_0047457 3300049576 Bacteria 2932
490 Ga0501041_0006009 3300049577 Bacteria 7103
491 Ga0501042_0041545 3300049578 Bacteria 3271
492 Ga0501043_0001624 3300049579 Bacteria 19569
493 Ga0501043_0003998 3300049579 Bacteria 12066
494 Ga0501043_0017888 3300049579 Bacteria 5558
495 Ga0501043_0019731 3300049579 Bacteria 5294
496 Ga0501043_0027296 3300049579 Bacteria 4483
497 Ga0501043_0031845 3300049579 Bacteria 4145
498 Ga0501043_0058599 3300049579 Bacteria 3023
499 Ga0501043_0064550 3300049579 Bacteria 2875
500 Ga0501043_0108548 3300049579 Bacteria 2179
501 Ga0501043_0114459 3300049579 Bacteria 2117
502 Ga0501043_0271293 3300049579 Bacteria 1302
503 Ga0501046_0261205 3300049580 Bacteria 1272
504 Ga0501046_0946219 3300049580 Bacteria 599
505 Ga0501047_0000110 3300049581 Bacteria 99745
506 Ga0501047_0008078 3300049581 Bacteria 9927
507 Ga0501047_0008535 3300049581 Bacteria 9665
508 Ga0501047_0009843 3300049581 Bacteria 9033
509 Ga0501047_0039504 3300049581 Bacteria 4564
510 Ga0501047_0098154 3300049581 Bacteria 2808
511 Ga0501047_0145397 3300049581 Bacteria 2248
512 Ga0501047_0189423 3300049581 Bacteria 1921
513 Ga0501047_0375671 3300049581 Bacteria 1256
514 Ga0501047_0376423 3300049581 Bacteria 1254
515 Ga0501048_0014635 3300049582 Bacteria 5806
516 Ga0501048_0492130 3300049582 Bacteria 879
517 Ga0501048_0855050 3300049582 Unclassified 654
518 Ga0501067_0010923 3300049583 Bacteria 5026
519 Ga0501067_0584739 3300049583 Bacteria 626
520 Ga0501067_0766847 3300049583 Bacteria 543
521 Ga0501068_0006918 3300049584 Bacteria 6274
522 Ga0501068_1032717 3300049584 Bacteria 543
523 Ga0501069_0034082 3300049585 Bacteria 2804
524 Ga0501070_0022161 3300049586 Bacteria 5320
525 Ga0501070_0023294 3300049586 Bacteria 5186
526 Ga0501070_0194908 3300049586 Bacteria 1664
527 Ga0501070_0260232 3300049586 Bacteria 1418
528 Ga0501070_0307236 3300049586 Bacteria 1291
529 Ga0501070_0335980 3300049586 Bacteria 1227
530 Ga0501070_0404195 3300049586 Bacteria 1104
531 Ga0501070_0446150 3300049586 Bacteria 1043
532 Ga0501070_0544014 3300049586 Bacteria 930
533 Ga0501070_1118244 3300049586 Bacteria 607
534 Ga0501072_0012542 3300049588 Bacteria 6480
535 Ga0501072_1551483 3300049588 Bacteria 511
536 Ga0501073_0013259 3300049589 Bacteria 6005
537 Ga0501073_0058150 3300049589 Bacteria 2703
538 Ga0501074_0013997 3300049590 Bacteria 5831
539 Ga0501074_0034649 3300049590 Bacteria 3659
540 Ga0501075_0096472 3300049591 Bacteria 2244
541 Ga0501076_0150934 3300049592 Bacteria 1890
542 Ga0501076_0483159 3300049592 Unclassified 1021
543 Ga0501076_0489873 3300049592 Bacteria 1013
544 Ga0501077_0024633 3300049593 Bacteria 3821
545 Ga0501202_170215 3300049652 Bacteria 582
546 Ga0501227_195581 3300049665 Bacteria 572
547 Ga0501221_180118 3300049704 Bacteria 577
548 Ga0501079_0003173 3300049741 Bacteria 12041
549 Ga0501079_1039583 3300049741 Unclassified 645
550 Ga0501079_1541738 3300049741 Bacteria 523
551 Ga0501080_0025292 3300049742 Bacteria 5509
552 Ga0501080_0068525 3300049742 Bacteria 3300
553 Ga0501083_0004750 3300049744 Bacteria 9597
554 Ga0501035_0004388 3300049822 Bacteria 13387
555 Ga0501035_0005215 3300049822 Bacteria 12298
556 Ga0501035_0011367 3300049822 Bacteria 8251
557 Ga0501035_0014839 3300049822 Bacteria 7192
558 Ga0501035_0026105 3300049822 Bacteria 5349
559 Ga0501035_0101021 3300049822 Bacteria 2531
560 Ga0501035_0129751 3300049822 Bacteria 2198
561 Ga0501035_0150580 3300049822 Bacteria 2019
562 Ga0501035_0281893 3300049822 Bacteria 1404
563 Ga0501035_0368964 3300049822 Bacteria 1198
564 Ga0501035_0494612 3300049822 Bacteria 1007
565 Ga0501044_0004261 3300049823 Bacteria 16048
566 Ga0501044_0004420 3300049823 Bacteria 15724
567 Ga0501044_0020637 3300049823 Bacteria 7035
568 Ga0501044_0033712 3300049823 Bacteria 5377
569 Ga0501044_0108696 3300049823 Bacteria 2783
570 Ga0501044_0128367 3300049823 Bacteria 2531
571 Ga0501044_0142631 3300049823 Bacteria 2383
572 Ga0501044_0166315 3300049823 Bacteria 2179
573 Ga0501044_0237321 3300049823 Bacteria 1768
574 Ga0501044_0464529 3300049823 Bacteria 1170
575 Ga0501044_0859545 3300049823 Bacteria 784
576 Ga0501045_0016414 3300049824 Bacteria 5259
577 Ga0501045_0216308 3300049824 Bacteria 1427
578 Ga0501045_0231417 3300049824 Bacteria 1376
579 Ga0501045_0270622 3300049824 Bacteria 1265
580 Ga0501045_0348481 3300049824 Bacteria 1102
581 Ga0501045_0402128 3300049824 Bacteria 1019
582 Ga0501045_0889401 3300049824 Bacteria 654
583 nmdc:mga03n38_235664_c1 3300050490 Bacteria 961
584 nmdc:mga0yw44_519596_c1 3300050492 Bacteria 808
585 nmdc:mga08y16_174273_c1 3300050511 Bacteria 2233
586 nmdc:mga08x19_170982_c1 3300050514 Bacteria 1480
587 Ga0495601_0040509 3300053077 Bacteria 2917
588 Ga0495655_0027063 3300053083 Bacteria 1357
589 Ga0495595_0319577 3300053084 Bacteria 782
590 Ga0495619_0009410 3300053085 Bacteria 6164
591 Ga0495619_0184798 3300053085 Bacteria 1442
592 Ga0495619_0544015 3300053085 Bacteria 797
593 Ga0500578_0512382 3300053086 Bacteria 673
594 Ga0500644_0028242 3300053088 Bacteria 1753
595 Ga0500583_0111776 3300053092 Bacteria 1346
596 Ga0500566_0175054 3300053094 Bacteria 1106
597 Ga0500640_015759 3300053095 Bacteria 3174
598 Ga0500560_002253 3300053107 Bacteria 3636
599 Ga0500560_044395 3300053107 Bacteria 1406
600 Ga0500572_013583 3300053111 Bacteria 2018
601 Ga0500608_281954 3300053122 Bacteria 628
602 Ga0500642_0173840 3300053130 Bacteria 1008
603 Ga0500573_0455130 3300053140 Bacteria 590
604 Ga0500600_0037488 3300053149 Bacteria 2810
605 Ga0501084_0022822 3300054114 Bacteria 5221
606 Ga0501084_0685764 3300054114 Bacteria 864
607 Ga0587084_020241 3300059477 Bacteria 988
608 Ga0587070_032381 3300059491 Bacteria 955
609 Ga0587090_025852 3300059510 Bacteria 951
610 Ga0587106_068807 3300059605 Bacteria 666
611 Ga0587125_051234 3300059607 Bacteria 583
612 Ga0587107_075264 3300059652 Bacteria 624
613 Ga0587071_033775 3300060344 Bacteria 997
614 Ga0501082_0008454 3300060353 Bacteria 8877
615 Ga0501082_1301438 3300060353 Unclassified 635
616 Ga0466962_0000234 3300061719 Bacteria 23125
617 Ga0466962_0004079 3300061719 Bacteria 6994
618 Ga0466962_0040152 3300061719 Bacteria 2241
619 Ga0530510_0026751 3300061734 Bacteria 4131
620 Ga0530510_0053563 3300061734 Bacteria 2916
621 Ga0530510_0710404 3300061734 Bacteria 766
622 2554256367 2554235005 Bacteria 6457341
623 2585296439 2582581312 Bacteria 7308206
624 2585299498 2582581312 Bacteria 7308206
625 2585306965 2582581313 Bacteria 10042643
626 2585318640 2582581314 Bacteria 11452267
627 2616900071 2616644941 Bacteria 8510691
628 2643763846 2643221548 Bacteria 8053412
629 2643764161 2643221548 Bacteria 8053412
630 2643902431 2643221578 Bacteria 9213798
631 2643905006 2643221578 Bacteria 9213798
632 2643945503 2643221587 Bacteria 7586415
633 2644265972 2643221647 Bacteria 10741251
634 2644386741 2643221670 Bacteria 6497041
635 2644403065 2643221673 Bacteria 9196637
636 2644404002 2643221673 Bacteria 9196637
637 2644431166 2643221677 Bacteria 7584031
638 2644439868 2643221678 Bacteria 9540101
639 2644461406 2643221682 Bacteria 6743283
640 2644461720 2643221682 Bacteria 6743283
641 2644632801 2643221714 Bacteria 9015452
642 2768646945 2767802112 Bacteria 6465194
643 2785371317 2784746768 Bacteria 10036182
644 2786672504 2786546132 Bacteria 10419719
645 2793984655 2791355406 Bacteria 11364898
646 2808843876 2808606359 Bacteria 9866990
647 2808913416 2808606375 Bacteria 9466072
648 2809236326 2808606448 Bacteria 8656184
649 2811844589 2808606982 Bacteria 7791042
650 2819746569 2818991472 Bacteria 10089953
651 2852642109 2852635781 Bacteria 8251373
652 2862179130 2862178590 Bacteria 8583590
653 2862180280 2862178590 Bacteria 8583590
654 2862284926 2862281513 Bacteria 9621493
655 2862293021 2862290372 Bacteria 7471434
656 2862388621 2862382967 Bacteria 10317375
657 2862509483 2862507626 Bacteria 9425308
658 2862513321 2862507626 Bacteria 9425308
659 2862577684 2862574272 Bacteria 10567477
660 2867370822 2867369537 Bacteria 6501581
661 2867373704 2867369537 Bacteria 6501581
662 2867434540 2867428634 Bacteria 9590268
663 2867475436 2867475112 Bacteria 6909112
664 2867477659 2867475112 Bacteria 6909112
665 2875392422 2875391855 Bacteria 7600475
666 2875396524 2875391855 Bacteria 7600475
667 2877679288 2877676314 Bacteria 9512378
668 2912717886 2912715099 Bacteria 9460473
669 2912730311 2912723979 Bacteria 8557534
670 2912761123 2912757875 Bacteria 7940295
671 2912762589 2912757875 Bacteria 7940295
672 2918506325 2918501144 Bacteria 8668083
673 2919471556 2919468124 Bacteria 9133025
674 2935394517 2935390628 Bacteria 7043367
675 2946048030 2946045630 Bacteria 8527308
676 2946052389 2946045630 Bacteria 8527308
677 2946077582 2946072368 Bacteria 8999607
678 2954384173 2954380949 Bacteria 10050426
679 2954678776 2954673503 Bacteria 9685905
680 2954685377 2954682443 Bacteria 9862841
681 2954694995 2954691527 Bacteria 10720516
682 2954710169 2954701450 Bacteria 10834262
683 2954714488 2954711539 Bacteria 10867210
684 2954724434 2954721474 Bacteria 10456478
685 2954737384 2954731030 Bacteria 10243860
686 2954743356 2954740390 Bacteria 10229294
687 2954756237 2954749733 Bacteria 10366972
688 2954762313 2954759201 Bacteria 9358192
689 2966601008 2966598605 Bacteria 7676064
690 2997453231 2997451912 Bacteria 8492419
691 2997455567 2997451912 Bacteria 8492419
692 3006397089 3006393351 Bacteria 6615579
693 3006430041 3006425503 Bacteria 6491253
694 3006489035 3006486233 Bacteria 8157040
695 3006498092 3006493962 Bacteria 8825450
696 8008562612 8008558824 Bacteria 10610750
697 8008577323 8008574985 Bacteria 7815457
698 8023627965 8023623736 Bacteria 8593882
699 8025537064 8025530807 Bacteria 8495698
700 8047896305 8047893842 Bacteria 11723082
701 8048128081 8048127548 Bacteria 11053136
702 8048362631 8048356638 Bacteria 11044339
703 8048373314 8048369669 Bacteria 11666822
704 8048384928 8048379754 Bacteria 11877923
705 8048406625 8048406513 Bacteria 8936924
706 8054161162 8054160619 Bacteria 7783213
707 8056671487 8056667051 Bacteria 6953971
708 8056831988 8056829672 Bacteria 9045328
709 Ga0501042_0644272
710 JGI24739J22299_10132641
711 JGI24737J22298_10067564
712 rootH1_10019195
713 rootH2_10060685
714 rootH1_10091162
715 JGI25160J50197_1009351
716 JGI25160J50197_1009544
717 JGI25160J50197_1091987
718 Ga0070690_101210393
719 Ga0070680_101183313
720 Ga0068868_101508957
721 Ga0070668_101799039
722 Ga0070678_101986934
723 Ga0070681_11476556
724 Ga0070686_100410756
725 Ga0070704_100438118
726 Ga0068855_100075048
727 Ga0068855_100132732
728 Ga0068854_101714125
729 Ga0068856_100484683
730 Ga0068859_100303123
731 Ga0068864_100134844
732 Ga0068870_10353475
733 Ga0068858_101029214
734 Ga0068862_101813230
735 Ga0068865_100353000
736 Ga0075436_100188405
737 Ga0097620_100303129
738 Ga0099826_10067827
739 Ga0105240_10027872
740 Ga0111539_10106652
741 Ga0105245_10257993
742 Ga0105245_12226492
743 Ga0105243_10398119
744 Ga0105242_10998858
745 Ga0105242_11665724
746 Ga0105248_10642371
747 Ga0105238_10522624
748 Ga0105246_10249858
749 Ga0157313_1027653
750 Ga0157369_10087579
751 Ga0157374_10773822
752 Ga0157378_10975161
753 Ga0163162_10071458
754 Ga0163162_12149436
755 Ga0157372_10208360
756 Ga0157375_10605617
757 Ga0157375_10725291
758 Ga0157376_10263507
759 Ga0182006_1017034
760 Ga0182007_10002422
761 Ga0206355_1208892
762 Ga0206353_10306429
763 Ga0213875_10052410
764 Ga0209758_1013617
765 Ga0207426_1000396
766 Ga0207426_1001513
767 Ga0207426_1002187
768 Ga0207426_1005153
769 Ga0207426_1006361
770 Ga0207426_1038653
771 Ga0207426_1130571
772 Ga0207696_1040208
773 Ga0207710_10220129
774 Ga0207688_10651880
775 Ga0207647_10005240
776 Ga0207707_10550293
777 Ga0207695_10038526
778 Ga0207686_10473785
779 Ga0207709_10306891
780 Ga0207667_10075912
781 Ga0207667_10408358
782 Ga0207668_12059916
783 Ga0207640_10069392
784 Ga0207703_11505356
785 Ga0207639_11632252
786 Ga0207648_10693005
787 Ga0207676_10640184
788 Ga0209371_1067381
789 Ga0209282_1100910
790 Ga0207428_11035629
791 Ga0268256_1018141
792 Ga0307511_10074842
793 Ga0307512_10004518
794 Ga0307508_10006837
795 Ga0307508_10063623
796 Ga0307514_10059521
797 Ga0307514_10079423
798 Ga0316577_10807722
799 Ga0307518_10063769
800 Ga0307518_10185994
801 Ga0307416_101605613
802 Ga0307416_103035409
803 Ga0316593_10109099
804 Ga0316593_10167277
805 Ga0316593_10301246
806 Ga0307507_10045296
807 Ga0307510_10230001
808 Ga0307510_10406999
809 Ga0395898_0003092
810 Ga0395898_0230829
811 Ga0395898_0396822
812 Ga0436364_1242868
813 Ga0395901_0074271
814 Ga0395901_0507829
815 Ga0439436_0002729
816 Ga0439436_0003166
817 Ga0439439_0033271
818 Ga0439453_0124307
819 Ga0451853_2009427
820 Ga0439433_0002860
821 Ga0439433_0036333
822 Ga0439448_0004898
823 Ga0439448_0024821
824 Ga0439432_040878
825 Ga0439449_0000358
826 Ga0439449_0120838
827 Ga0439449_0264335
828 Ga0439450_044395
829 Ga0439454_016112
830 Ga0439455_0010286
831 Ga0439457_002398
832 Ga0439457_004233
833 Ga0439462_0028590
834 Ga0450920_114001
835 Ga0450897_009761
836 Ga0450894_000136
837 Ga0450898_000424
838 Ga0450898_025572
839 Ga0450902_008532
840 Ga0450903_000233
841 Ga0450906_018467
842 Ga0450907_013840
843 Ga0439458_0018008
844 Ga0450901_012411
845 Ga0466969_0012190
846 Ga0466969_0083017
847 Ga0466972_0004064
848 Ga0466972_0004540
849 Ga0466972_0023472
850 Ga0466972_0067178
851 Ga0466972_0109751
852 Ga0466965_0031059
853 Ga0466966_0003918
854 Ga0466966_0008100
855 Ga0466966_0027375
856 Ga0466966_0354438
857 Ga0466961_0017066
858 Ga0466961_0023342
859 Ga0466961_0062455
860 Ga0466961_0073046
861 Ga0466961_0080676
862 Ga0466963_0000213
863 Ga0466963_0003003
864 Ga0466963_0039151
865 Ga0466964_0012547
866 Ga0466964_0025974
867 Ga0466971_0000575
868 Ga0466971_0001207
869 Ga0466971_0172792
870 Ga0466970_0001274
871 Ga0466970_0006583
872 Ga0466970_0177661
873 Ga0466970_0185410
874 Ga0466970_0570321
875 Ga0466970_0860022
876 Ga0466957_0023199
877 Ga0466957_0484362
878 Ga0466960_0102207
879 Ga0466960_0236237
880 Ga0466959_0002515
881 Ga0466959_0003363
882 Ga0466959_0029667
883 Ga0466959_0728170
884 Ga0466958_0082986
885 Ga0466958_0323776
886 Ga0466958_0877133
887 Ga0466967_0052759
888 Ga0466967_0192631
889 Ga0466967_0212446
890 Ga0466967_1401693
891 Ga0495617_082112
892 Ga0495627_064266
893 Ga0495592_0000574
894 Ga0495592_0028509
895 Ga0495592_0210741
896 Ga0495603_0028210
897 Ga0495603_0234590
898 Ga0495603_0272480
899 Ga0495603_0341877
900 Ga0495629_0000405
901 Ga0495629_0002819
902 Ga0495629_0009074
903 Ga0495629_0013612
904 Ga0495629_0078601
905 Ga0495629_0121152
906 Ga0495629_0384081
907 Ga0495638_0101286
908 Ga0495638_0626291
909 Ga0495651_0056038
910 Ga0495651_0102999
911 Ga0495651_0259698
912 Ga0495653_0061599
913 Ga0495580_0098754
914 Ga0495582_0100885
915 Ga0495582_0181594
916 Ga0495582_0647639
917 Ga0495605_0004096
918 Ga0495639_0018492
919 Ga0495639_0092804
920 Ga0495662_0000154
921 Ga0495662_0012526
922 Ga0495662_0013250
923 Ga0495662_0018848
924 Ga0495662_0026659
925 Ga0495662_0035348
926 Ga0495662_0039446
927 Ga0495662_0101601
928 Ga0495664_0004639
929 Ga0495664_0031093
930 Ga0495664_0202095
931 Ga0495664_0554005
932 Ga0495584_0393895
933 Ga0495585_0019750
934 Ga0495585_0118469
935 Ga0495585_0147331
936 Ga0495594_0005107
937 Ga0495594_0026114
938 Ga0495594_0078134
939 Ga0495594_0861964
940 Ga0495607_0170128
941 Ga0495583_0061262
942 Ga0495583_0180048
943 Ga0495608_0005526
944 Ga0495608_0129963
945 Ga0495610_0074964
946 Ga0495616_0061904
947 Ga0495618_0022418
948 Ga0495618_0886815
949 Ga0495620_0016425
950 Ga0495628_0005810
951 Ga0495628_0158132
952 Ga0495628_0178311
953 Ga0495630_0033011
954 Ga0495630_0033921
955 Ga0495631_0018548
956 Ga0495631_0047678
957 Ga0495637_0047011
958 Ga0495637_0370716
959 Ga0495644_0410340
960 Ga0495648_0030330
961 Ga0495666_0007896
962 Ga0495652_0030071
963 Ga0495652_0037557
964 Ga0495652_0111389
965 Ga0495652_0175580
966 Ga0495665_0013928
967 Ga0495665_0046977
968 Ga0495665_0457515
969 Ga0495640_0010190
970 Ga0495640_0035770
971 Ga0495640_0083077
972 Ga0495640_0536599
973 Ga0495586_0027327
974 Ga0495586_0092894
975 Ga0495587_0003221
976 Ga0495587_0018256
977 Ga0495609_0074505
978 Ga0495609_0147933
979 Ga0495609_0159745
980 Ga0495597_0032768
981 Ga0495645_0032240
982 Ga0495645_0050882
983 Ga0495622_0022237
984 Ga0495622_0024901
985 Ga0495622_0045253
986 Ga0495622_0334794
987 Ga0495633_0032976
988 Ga0495667_0009330
989 Ga0495667_0320136
990 Ga0495668_0079355
991 Ga0495634_0005531
992 Ga0495634_0015826
993 Ga0495634_0054603
994 Ga0495634_0067825
995 Ga0495634_0161036
996 Ga0495611_0023607
997 Ga0495611_0100820
998 Ga0495611_0117844
999 Ga0495625_0097561
1000 Ga0495625_0469010
1001 Ga0495635_0098428
1002 Ga0495635_0201024
1003 Ga0495661_0027671
1004 Ga0495588_0001268
1005 Ga0495588_0115384
1006 Ga0495588_0299011
1007 Ga0495588_0516029
1008 Ga0495657_0001214
1009 Ga0495657_0013555
1010 Ga0495657_0020442
1011 Ga0495657_0100978
1012 Ga0495657_0124798
1013 Ga0495657_0282724
1014 Ga0495599_0194168
1015 Ga0495599_0202379
1016 Ga0495599_0559247
1017 Ga0495623_0042876
1018 Ga0495623_0062226
1019 Ga0495623_0171290
1020 Ga0495646_0004598
1021 Ga0495646_0014451
1022 Ga0495646_0222262
1023 Ga0495646_0235315
1024 Ga0495658_0144361
1025 Ga0495658_0762414
1026 Ga0495613_0003424
1027 Ga0495613_0010395
1028 Ga0495613_0012117
1029 Ga0495613_0021841
1030 Ga0495613_0043428
1031 Ga0495613_0109870
1032 Ga0495613_0135378
1033 Ga0495613_0186143
1034 Ga0495613_0326395
1035 Ga0495613_0424172
1036 Ga0495613_0568552
1037 Ga0495624_0057743
1038 Ga0495624_0076696
1039 Ga0495624_0164911
1040 Ga0495624_0271689
1041 Ga0495670_0087594
1042 Ga0495670_0419425
1043 Ga0495671_0022519
1044 Ga0495649_0012890
1045 Ga0495649_0401384
1046 Ga0495589_0042124
1047 Ga0495589_0099476
1048 Ga0495589_0116807
1049 Ga0495589_0166580
1050 Ga0495589_0320315
1051 Ga0495600_0007018
1052 Ga0495600_0041460
1053 Ga0495600_0198955
1054 Ga0495600_0523215
1055 Ga0495660_0091248
1056 Ga0495581_0005237
1057 Ga0495581_0007377
1058 Ga0495581_0023311
1059 Ga0495604_0003060
1060 Ga0495604_0026542
1061 Ga0495604_0113627
1062 Ga0495604_0118749
1063 Ga0495604_0256408
1064 Ga0495604_0773860
1065 Ga0495636_0015865
1066 Ga0495636_0049522
1067 Ga0495636_0078232
1068 Ga0495636_0137913
1069 Ga0495674_0031505
1070 Ga0495674_0333377
1071 Ga0495674_0808390
1072 Ga0495676_0005451
1073 Ga0495676_0005856
1074 Ga0495676_0009055
1075 Ga0495676_0019746
1076 Ga0495676_0028024
1077 Ga0495676_0123941
1078 Ga0495676_0810392
1079 Ga0495680_0010275
1080 Ga0495683_0241670
1081 Ga0495687_006392
1082 Ga0495687_042471
1083 Ga0495687_043028
1084 Ga0495687_070283
1085 Ga0495675_0008068
1086 Ga0495675_0106977
1087 Ga0495675_0139685
1088 Ga0495675_0142712
1089 Ga0495675_0231928
1090 Ga0495675_0374988
1091 Ga0495675_0419713
1092 Ga0495675_0471872
1093 Ga0495685_005303
1094 Ga0495685_018741
1095 Ga0495685_109819
1096 Ga0495673_0163867
1097 Ga0495681_0000567
1098 Ga0495681_0032151
1099 Ga0495681_0077806
1100 Ga0495684_0077790
1101 Ga0495684_0095811
1102 Ga0495686_0015791
1103 Ga0495686_0084897
1104 Ga0495593_0000488
1105 Ga0495593_0126278
1106 Ga0495593_0144866
1107 Ga0495602_0077375
1108 Ga0495602_0112376
1109 Ga0495614_0003426
1110 Ga0495614_0041644
1111 Ga0495626_0015565
1112 Ga0496102_0200450
1113 Ga0496103_0096870
1114 Ga0496104_0001987
1115 Ga0496106_0155525
1116 Ga0496108_0010274
1117 Ga0496109_0005561
1118 Ga0496109_0681273
1119 Ga0496109_1532922
1120 Ga0496110_0125508
1121 Ga0496110_0802593
1122 Ga0496111_0000176
1123 Ga0496111_0894031
1124 Ga0496113_0529357
1125 Ga0496114_0369476
1126 Ga0496114_1217354
1127 Ga0496114_1592032
1128 Ga0496115_0338177
1129 Ga0496125_0318190
1130 Ga0496126_0857791
1131 Ga0501306_081757
1132 Ga0501310_083203
1133 Ga0495678_172916
1134 Ga0495682_0047000
1135 Ga0501317_043709
1136 Ga0501322_019967
1137 Ga0501031_0002467
1138 Ga0501031_0033763
1139 Ga0501031_0039348
1140 Ga0501031_0091296
1141 Ga0501031_0170939
1142 Ga0501031_0171880
1143 Ga0501031_0174821
1144 Ga0501032_0008641
1145 Ga0501032_0041778
1146 Ga0501032_0073062
1147 Ga0501032_0110060
1148 Ga0501032_0161676
1149 Ga0501032_0163717
1150 Ga0501032_0164040
1151 Ga0501033_0003519
1152 Ga0501033_0011502
1153 Ga0501033_0014547
1154 Ga0501033_0026616
1155 Ga0501033_0038081
1156 Ga0501033_0053149
1157 Ga0501033_0109891
1158 Ga0501033_0116704
1159 Ga0501033_0128487
1160 Ga0501034_0007425
1161 Ga0501034_0011443
1162 Ga0501034_0015656
1163 Ga0501034_0023142
1164 Ga0501034_0035254
1165 Ga0501034_0514398
1166 Ga0501034_1065384
1167 Ga0501034_1283275
1168 Ga0501034_1577707
1169 Ga0501036_0006643
1170 Ga0501036_0017596
1171 Ga0501036_0031200
1172 Ga0501036_0031599
1173 Ga0501036_0064257
1174 Ga0501036_0225088
1175 Ga0501036_0246677
1176 Ga0501036_0302546
1177 Ga0501037_0001324
1178 Ga0501037_0019328
1179 Ga0501037_0040582
1180 Ga0501037_0075086
1181 Ga0501037_0101845
1182 Ga0501037_0194265
1183 Ga0501037_0325636
1184 Ga0501037_0546395
1185 Ga0501038_0001194
1186 Ga0501038_0005372
1187 Ga0501038_0024208
1188 Ga0501038_0049375
1189 Ga0501038_0061563
1190 Ga0501038_0064244
1191 Ga0501038_0096954
1192 Ga0501038_0231676
1193 Ga0501038_1368772
1194 Ga0501039_0047992
1195 Ga0501039_0055212
1196 Ga0501039_0431080
1197 Ga0501040_0047457
1198 Ga0501041_0006009
1199 Ga0501042_0041545
1200 Ga0501043_0001624
1201 Ga0501043_0003998
1202 Ga0501043_0017888
1203 Ga0501043_0019731
1204 Ga0501043_0027296
1205 Ga0501043_0031845
1206 Ga0501043_0058599
1207 Ga0501043_0064550
1208 Ga0501043_0108548
1209 Ga0501043_0114459
1210 Ga0501043_0271293
1211 Ga0501046_0261205
1212 Ga0501046_0946219
1213 Ga0501047_0000110
1214 Ga0501047_0008078
1215 Ga0501047_0008535
1216 Ga0501047_0009843
1217 Ga0501047_0039504
1218 Ga0501047_0098154
1219 Ga0501047_0145397
1220 Ga0501047_0189423
1221 Ga0501047_0375671
1222 Ga0501047_0376423
1223 Ga0501048_0014635
1224 Ga0501048_0492130
1225 Ga0501048_0855050
1226 Ga0501067_0010923
1227 Ga0501067_0584739
1228 Ga0501067_0766847
1229 Ga0501068_0006918
1230 Ga0501068_1032717
1231 Ga0501069_0034082
1232 Ga0501070_0022161
1233 Ga0501070_0023294
1234 Ga0501070_0194908
1235 Ga0501070_0260232
1236 Ga0501070_0307236
1237 Ga0501070_0335980
1238 Ga0501070_0404195
1239 Ga0501070_0446150
1240 Ga0501070_0544014
1241 Ga0501070_1118244
1242 Ga0501072_0012542
1243 Ga0501072_1551483
1244 Ga0501073_0013259
1245 Ga0501073_0058150
1246 Ga0501074_0013997
1247 Ga0501074_0034649
1248 Ga0501075_0096472
1249 Ga0501076_0150934
1250 Ga0501076_0483159
1251 Ga0501076_0489873
1252 Ga0501077_0024633
1253 Ga0501202_170215
1254 Ga0501227_195581
1255 Ga0501221_180118
1256 Ga0501079_0003173
1257 Ga0501079_1039583
1258 Ga0501079_1541738
1259 Ga0501080_0025292
1260 Ga0501080_0068525
1261 Ga0501083_0004750
1262 Ga0501035_0004388
1263 Ga0501035_0005215
1264 Ga0501035_0011367
1265 Ga0501035_0014839
1266 Ga0501035_0026105
1267 Ga0501035_0101021
1268 Ga0501035_0129751
1269 Ga0501035_0150580
1270 Ga0501035_0281893
1271 Ga0501035_0368964
1272 Ga0501035_0494612
1273 Ga0501044_0004261
1274 Ga0501044_0004420
1275 Ga0501044_0020637
1276 Ga0501044_0033712
1277 Ga0501044_0108696
1278 Ga0501044_0128367
1279 Ga0501044_0142631
1280 Ga0501044_0166315
1281 Ga0501044_0237321
1282 Ga0501044_0464529
1283 Ga0501044_0859545
1284 Ga0501045_0016414
1285 Ga0501045_0216308
1286 Ga0501045_0231417
1287 Ga0501045_0270622
1288 Ga0501045_0348481
1289 Ga0501045_0402128
1290 Ga0501045_0889401
1291 nmdc:mga03n38_235664_c1
1292 nmdc:mga0yw44_519596_c1
1293 nmdc:mga08y16_174273_c1
1294 nmdc:mga08x19_170982_c1
1295 Ga0495601_0040509
1296 Ga0495655_0027063
1297 Ga0495595_0319577
1298 Ga0495619_0009410
1299 Ga0495619_0184798
1300 Ga0495619_0544015
1301 Ga0500578_0512382
1302 Ga0500644_0028242
1303 Ga0500583_0111776
1304 Ga0500566_0175054
1305 Ga0500640_015759
1306 Ga0500560_002253
1307 Ga0500560_044395
1308 Ga0500572_013583
1309 Ga0500608_281954
1310 Ga0500642_0173840
1311 Ga0500573_0455130
1312 Ga0500600_0037488
1313 Ga0501084_0022822
1314 Ga0501084_0685764
1315 Ga0587084_020241
1316 Ga0587070_032381
1317 Ga0587090_025852
1318 Ga0587106_068807
1319 Ga0587125_051234
1320 Ga0587107_075264
1321 Ga0587071_033775
1322 Ga0501082_0008454
1323 Ga0501082_1301438
1324 Ga0466962_0000234
1325 Ga0466962_0004079
1326 Ga0466962_0040152
1327 Ga0530510_0026751
1328 Ga0530510_0053563
1329 Ga0530510_0710404
1330 2554256367
1331 2585296439
1332 2585299498
1333 2585306965
1334 2585318640
1335 2616900071
1336 2643763846
1337 2643764161
1338 2643902431
1339 2643905006
1340 2643945503
1341 2644265972
1342 2644386741
1343 2644403065
1344 2644404002
1345 2644431166
1346 2644439868
1347 2644461406
1348 2644461720
1349 2644632801
1350 2768646945
1351 2785371317
1352 2786672504
1353 2793984655
1354 2808843876
1355 2808913416
1356 2809236326
1357 2811844589
1358 2819746569
1359 2852642109
1360 2862179130
1361 2862180280
1362 2862284926
1363 2862293021
1364 2862388621
1365 2862509483
1366 2862513321
1367 2862577684
1368 2867370822
1369 2867373704
1370 2867434540
1371 2867475436
1372 2867477659
1373 2875392422
1374 2875396524
1375 2877679288
1376 2912717886
1377 2912730311
1378 2912761123
1379 2912762589
1380 2918506325
1381 2919471556
1382 2935394517
1383 2946048030
1384 2946052389
1385 2946077582
1386 2954384173
1387 2954678776
1388 2954685377
1389 2954694995
1390 2954710169
1391 2954714488
1392 2954724434
1393 2954737384
1394 2954743356
1395 2954756237
1396 2954762313
1397 2966601008
1398 2997453231
1399 2997455567
1400 3006397089
1401 3006430041
1402 3006489035
1403 3006498092
1404 8008562612
1405 8008577323
1406 8023627965
1407 8025537064
1408 8047896305
1409 8048128081
1410 8048362631
1411 8048373314
1412 8048384928
1413 8048406625
1414 8054161162
1415 8056671487
1416 8056831988

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

25

143

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nbc-assembly1.cif.gz_C structure of prokaryotic transcription factors 0.8574 14 136
5nbc-assembly1.cif.gz_D structure of prokaryotic transcription factors 0.8561 15 135
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.8521 3 82
4rb2-assembly1.cif.gz_D crystal structure of magnetospirillum gryphiswaldense msr-1 semet-fur-mn2+-feoab1 operator 0.8518 1 132
3f8n-assembly1.cif.gz_B crystal structure of perr-zn-mn 0.8505 3 135
ID Description Score Start End Superfamily
4razB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9495 3 81 1.10.10.10
5fd6D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9276 4 81 1.10.10.10
4rb3C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9243 3 81 1.10.10.10
4rb3D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9143 1 81 1.10.10.10
4rb2C01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9039 1 81 1.10.10.10
ID Description Score Start End GO Terms
AF-H1QI34-F1-model_v4 deleted 0.9916 15 138
AF-A0A3S8W3J1-F1-model_v4 Transcriptional repressor 0.9874 1 138 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-H1QI34-F1-model_v4 deleted 0.9837 15 138
AF-A0A6N2HQP0-F1-model_v4 Transcriptional repressor 0.9782 1 137 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376
AF-A0A1G9AJN5-F1-model_v4 Fur family transcriptional regulator, ferric uptake regulator 0.9758 1 136 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376

Map