F476605

General Info

Members Datasets Scaffolds Average Seq Length
708 320 1416 346

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0015729|Ga0395901_0015729_19_1227
Length 402
Sequence MDQEANEWKTFLTGANQLFRATTHPAAVQLPVEGSLLSLAGATGWLNSPPLTAAGLRGKVVLVDFWTYTCINWLRTLPYLRAWAQTYQDHGLVVIGVHTPEFDFEHDLDNVRRAVKELRVDYPVVVDSDYAIWTAFDNHYWPALYVVDAQGQVRHHRFGEGGYQQAEMILRQLLTEAGAGGIDQDLVSVDGGGVEAPADWDSLWSPENYLGYERTENFASPDGAVLGTRQVYAVPARLRLNHWAVAGDWTVNRQAIVLNAPDGRIAYRFHARDLHLVMGPAARGTPVRFRVRLDGQPPGAAHGVDIDDQGNGTVAEPRLYQLVRQPGPVGERTFEVTFLDPGVQAYAFTFGRRRDHDPSPWLEPLATVRAGVLEVAYQAGPADGGHSSFLHESVKSCERGSS

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
172 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
213 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
214 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
215 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
216 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
217 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
220 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
221 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
293 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
294 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
295 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
296 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
313 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
314 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
318 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
319 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
320 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.28
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.42
Nodule 0.28
Rhizoplane 4.52
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 1.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0015729 3300038443 Bacteria 7709
2 JGI25406J46586_10001594 3300003203 Bacteria 10716
3 JGI25406J46586_10002090 3300003203 Bacteria 9432
4 JGI25406J46586_10027120 3300003203 Bacteria 2201
5 JGI25407J50210_10004777 3300003373 Bacteria 3309
6 JGI25407J50210_10009262 3300003373 Bacteria 2492
7 JGI25407J50210_10010602 3300003373 Bacteria 2346
8 JGI25407J50210_10023900 3300003373 Bacteria 1587
9 JGI25404J52841_10003810 3300003659 Bacteria 3013
10 Ga0070658_10298424 3300005327 Bacteria 1374
11 Ga0070676_10003205 3300005328 Bacteria 8482
12 Ga0070676_10015129 3300005328 Bacteria 4253
13 Ga0070683_100017509 3300005329 Bacteria 6333
14 Ga0070683_100257360 3300005329 Bacteria 1660
15 Ga0070683_100353136 3300005329 Bacteria 1400
16 Ga0068869_100040648 3300005334 Bacteria 3326
17 Ga0068869_100042608 3300005334 Bacteria 3255
18 Ga0068869_100090180 3300005334 Bacteria 2303
19 Ga0070666_10034052 3300005335 Bacteria 3375
20 Ga0070680_100013947 3300005336 Bacteria 6271
21 Ga0070682_100006465 3300005337 Bacteria 6589
22 Ga0068868_100021934 3300005338 Bacteria 4814
23 Ga0068868_100033453 3300005338 Bacteria 3963
24 Ga0068868_100109305 3300005338 Bacteria 2245
25 Ga0070660_100006826 3300005339 Bacteria 7920
26 Ga0070660_100196859 3300005339 Bacteria 1634
27 Ga0070689_100115526 3300005340 Bacteria 2139
28 Ga0070689_100369606 3300005340 Bacteria 1206
29 Ga0070691_10030191 3300005341 Bacteria 2538
30 Ga0070691_10052187 3300005341 Bacteria 1955
31 Ga0070661_100000665 3300005344 Bacteria 25244
32 Ga0070661_100381562 3300005344 Bacteria 1111
33 Ga0070692_10056482 3300005345 Bacteria 2056
34 Ga0070668_100011167 3300005347 Bacteria 6687
35 Ga0070668_100014080 3300005347 Bacteria 5978
36 Ga0070668_100033551 3300005347 Bacteria 3910
37 Ga0070675_100200525 3300005354 Bacteria 1732
38 Ga0070674_100000146 3300005356 Bacteria 32925
39 Ga0070674_100008855 3300005356 Bacteria 6008
40 Ga0070674_100016016 3300005356 Bacteria 4694
41 Ga0070674_100265584 3300005356 Bacteria 1354
42 Ga0070673_100049235 3300005364 Bacteria 3290
43 Ga0070673_100092628 3300005364 Bacteria 2473
44 Ga0070673_100255382 3300005364 Bacteria 1529
45 Ga0070667_100038592 3300005367 Bacteria 4004
46 Ga0070703_10047544 3300005406 Bacteria 1360
47 Ga0070709_10227690 3300005434 Bacteria 1332
48 Ga0070714_100075620 3300005435 Bacteria 2922
49 Ga0070713_100000454 3300005436 Bacteria 26216
50 Ga0070713_100005015 3300005436 Bacteria 8993
51 Ga0070713_100010279 3300005436 Bacteria 6756
52 Ga0070713_100109722 3300005436 Bacteria 2404
53 Ga0070713_100144261 3300005436 Bacteria 2112
54 Ga0070710_10018009 3300005437 Bacteria 3627
55 Ga0070710_10057122 3300005437 Bacteria 2210
56 Ga0070710_10080614 3300005437 Bacteria 1899
57 Ga0070701_10046684 3300005438 Bacteria 2227
58 Ga0070711_100026193 3300005439 Bacteria 3820
59 Ga0070711_100053679 3300005439 Bacteria 2778
60 Ga0070711_100118602 3300005439 Bacteria 1953
61 Ga0070705_100000420 3300005440 Bacteria 24448
62 Ga0070705_100007440 3300005440 Bacteria 5387
63 Ga0070700_100016835 3300005441 Bacteria 4169
64 Ga0070694_100007788 3300005444 Bacteria 6536
65 Ga0070708_100001132 3300005445 Bacteria 20455
66 Ga0070708_100029538 3300005445 Bacteria 4728
67 Ga0070708_100181593 3300005445 Bacteria 1967
68 Ga0070708_100454900 3300005445 Bacteria 1208
69 Ga0070708_100505978 3300005445 Bacteria 1139
70 Ga0070663_100143445 3300005455 Bacteria 1825
71 Ga0070678_100045941 3300005456 Bacteria 3128
72 Ga0070662_100000751 3300005457 Bacteria 19888
73 Ga0070662_100122319 3300005457 Bacteria 1996
74 Ga0070662_100203094 3300005457 Bacteria 1574
75 Ga0068867_100006449 3300005459 Bacteria 8284
76 Ga0068867_100044441 3300005459 Bacteria 3255
77 Ga0070685_10025569 3300005466 Bacteria 3250
78 Ga0070706_100000003 3300005467 Bacteria 284182
79 Ga0070706_100000319 3300005467 Bacteria 58620
80 Ga0070706_100139702 3300005467 Bacteria 2261
81 Ga0070706_100173115 3300005467 Unclassified 2016
82 Ga0070707_100002662 3300005468 Bacteria 16975
83 Ga0070707_100004145 3300005468 Bacteria 13591
84 Ga0070707_100015267 3300005468 Bacteria 7208
85 Ga0070707_100025392 3300005468 Bacteria 5621
86 Ga0070707_100054633 3300005468 Unclassified 3829
87 Ga0070698_100002690 3300005471 Bacteria 19569
88 Ga0070698_100085865 3300005471 Bacteria 3134
89 Ga0070698_100123548 3300005471 Unclassified 2546
90 Ga0070699_100000370 3300005518 Bacteria 44000
91 Ga0070699_100085184 3300005518 Bacteria 2758
92 Ga0070699_100091331 3300005518 Bacteria 2662
93 Ga0070699_100092501 3300005518 Bacteria 2645
94 Ga0070699_100177096 3300005518 Bacteria 1891
95 Ga0070699_100359945 3300005518 Bacteria 1311
96 Ga0070679_100086616 3300005530 Bacteria 3119
97 Ga0070679_100122521 3300005530 Bacteria 2584
98 Ga0070684_100280908 3300005535 Bacteria 1525
99 Ga0070697_100006162 3300005536 Bacteria 9280
100 Ga0070697_100205658 3300005536 Bacteria 1674
101 Ga0070697_100274866 3300005536 Unclassified 1444
102 Ga0068853_100000593 3300005539 Bacteria 24841
103 Ga0068853_100000923 3300005539 Bacteria 20561
104 Ga0068853_100001809 3300005539 Bacteria 15721
105 Ga0068853_100043986 3300005539 Bacteria 3821
106 Ga0068853_100249997 3300005539 Bacteria 1626
107 Ga0070686_100015694 3300005544 Bacteria 4394
108 Ga0070695_100002485 3300005545 Bacteria 10608
109 Ga0070696_100004131 3300005546 Bacteria 9680
110 Ga0070696_100170522 3300005546 Bacteria 1608
111 Ga0070665_100022487 3300005548 Bacteria 6346
112 Ga0070665_100139643 3300005548 Bacteria 2426
113 Ga0070665_100323928 3300005548 Bacteria 1545
114 Ga0068855_100008597 3300005563 Bacteria 12339
115 Ga0070664_100013713 3300005564 Bacteria 6604
116 Ga0070664_100164226 3300005564 Bacteria 1966
117 Ga0068857_100120036 3300005577 Bacteria 2366
118 Ga0068857_100378494 3300005577 Bacteria 1314
119 Ga0068854_100001772 3300005578 Bacteria 13144
120 Ga0068854_100032243 3300005578 Bacteria 3643
121 Ga0068854_100039741 3300005578 Bacteria 3316
122 Ga0068856_100001009 3300005614 Bacteria 29932
123 Ga0068856_100015072 3300005614 Bacteria 7468
124 Ga0068856_100085369 3300005614 Bacteria 3136
125 Ga0070702_100027318 3300005615 Bacteria 3077
126 Ga0070702_100095471 3300005615 Bacteria 1812
127 Ga0068852_100000187 3300005616 Bacteria 41869
128 Ga0068852_100016573 3300005616 Bacteria 5753
129 Ga0068852_100018843 3300005616 Bacteria 5447
130 Ga0068852_100197940 3300005616 Bacteria 1900
131 Ga0068859_100030649 3300005617 Bacteria 5398
132 Ga0068859_100297047 3300005617 Bacteria 1708
133 Ga0068859_100299270 3300005617 Bacteria 1702
134 Ga0068864_100106056 3300005618 Bacteria 2498
135 Ga0068864_100164407 3300005618 Bacteria 2019
136 Ga0068866_10000027 3300005718 Bacteria 59348
137 Ga0068861_100013991 3300005719 Bacteria 5625
138 Ga0068861_100045774 3300005719 Bacteria 3296
139 Ga0068861_100231493 3300005719 Bacteria 1567
140 Ga0068861_100272683 3300005719 Bacteria 1453
141 Ga0068870_10050128 3300005840 Bacteria 2205
142 Ga0068863_100093027 3300005841 Bacteria 2861
143 Ga0068863_100156222 3300005841 Bacteria 2184
144 Ga0068858_100089793 3300005842 Bacteria 2859
145 Ga0068860_100025384 3300005843 Bacteria 5717
146 Ga0068862_100044457 3300005844 Bacteria 3788
147 Ga0068862_100141317 3300005844 Bacteria 2137
148 Ga0081455_10005977 3300005937 Bacteria 13203
149 Ga0081455_10038779 3300005937 Bacteria 4217
150 Ga0081455_10110615 3300005937 Bacteria 2184
151 Ga0081455_10245690 3300005937 Bacteria 1312
152 Ga0081538_10000339 3300005981 Bacteria 53160
153 Ga0081538_10001010 3300005981 Bacteria 30020
154 Ga0081538_10001429 3300005981 Bacteria 24542
155 Ga0081538_10002754 3300005981 Bacteria 16866
156 Ga0081538_10003911 3300005981 Bacteria 13895
157 Ga0081538_10005292 3300005981 Bacteria 11645
158 Ga0081538_10006276 3300005981 Bacteria 10505
159 Ga0081538_10007237 3300005981 Bacteria 9627
160 Ga0081538_10007784 3300005981 Bacteria 9203
161 Ga0081538_10010055 3300005981 Bacteria 7800
162 Ga0081538_10011672 3300005981 Bacteria 7100
163 Ga0081538_10014482 3300005981 Bacteria 6172
164 Ga0081538_10015077 3300005981 Bacteria 6006
165 Ga0081538_10015508 3300005981 Bacteria 5892
166 Ga0081538_10017237 3300005981 Bacteria 5493
167 Ga0081538_10026413 3300005981 Bacteria 4061
168 Ga0081538_10050934 3300005981 Bacteria 2493
169 Ga0081538_10058582 3300005981 Bacteria 2232
170 Ga0081540_1000531 3300005983 Bacteria 37099
171 Ga0081540_1026864 3300005983 Bacteria 3275
172 Ga0081539_10000336 3300005985 Bacteria 104057
173 Ga0081539_10001103 3300005985 Bacteria 49011
174 Ga0081539_10002642 3300005985 Bacteria 24471
175 Ga0081539_10005440 3300005985 Bacteria 12998
176 Ga0081539_10011696 3300005985 Bacteria 6897
177 Ga0070717_10005668 3300006028 Bacteria 9124
178 Ga0070717_10013579 3300006028 Bacteria 6247
179 Ga0070717_10089083 3300006028 Bacteria 2602
180 Ga0070717_10274247 3300006028 Bacteria 1494
181 Ga0075432_10004031 3300006058 Bacteria 5014
182 Ga0075432_10007347 3300006058 Bacteria 3752
183 Ga0070712_100060114 3300006175 Bacteria 2679
184 Ga0070712_100243561 3300006175 Bacteria 1433
185 Ga0070712_100359438 3300006175 Bacteria 1194
186 Ga0075427_10002758 3300006194 Bacteria 2382
187 Ga0075427_10003263 3300006194 Bacteria 2228
188 Ga0097621_100143570 3300006237 Bacteria 2042
189 Ga0068871_100077750 3300006358 Unclassified 2743
190 Ga0075428_100000785 3300006844 Bacteria 33102
191 Ga0075428_100043203 3300006844 Bacteria 4954
192 Ga0075428_100136668 3300006844 Bacteria 2665
193 Ga0075428_100225168 3300006844 Bacteria 2025
194 Ga0075430_100003789 3300006846 Bacteria 12717
195 Ga0075430_100163911 3300006846 Bacteria 1850
196 Ga0075430_100272619 3300006846 Bacteria 1400
197 Ga0075431_100031106 3300006847 Bacteria 5498
198 Ga0075431_100105777 3300006847 Bacteria 2903
199 Ga0075431_100158307 3300006847 Bacteria 2330
200 Ga0075431_100450090 3300006847 Bacteria 1283
201 Ga0075433_10018638 3300006852 Bacteria 5772
202 Ga0075433_10160064 3300006852 Bacteria 2003
203 Ga0075433_10190382 3300006852 Bacteria 1825
204 Ga0075433_10277980 3300006852 Bacteria 1483
205 Ga0075434_100033871 3300006871 Bacteria 5042
206 Ga0075434_100120634 3300006871 Bacteria 2637
207 Ga0075429_100010017 3300006880 Bacteria 8213
208 Ga0075429_100016822 3300006880 Bacteria 6330
209 Ga0075429_100020519 3300006880 Bacteria 5734
210 Ga0068865_100014944 3300006881 Bacteria 4944
211 Ga0068865_100082810 3300006881 Bacteria 2307
212 Ga0075436_100053480 3300006914 Bacteria 2787
213 Ga0097620_100030649 3300006931 Bacteria 5398
214 Ga0097620_100236951 3300006931 Bacteria 1914
215 Ga0097620_100297060 3300006931 Bacteria 1708
216 Ga0097620_100299288 3300006931 Bacteria 1702
217 Ga0105240_10007274 3300009093 Bacteria 16115
218 Ga0105240_10384756 3300009093 Bacteria 1583
219 Ga0105240_10532470 3300009093 Bacteria 1302
220 Ga0111539_10012188 3300009094 Bacteria 10785
221 Ga0111539_10014484 3300009094 Bacteria 9843
222 Ga0111539_10028936 3300009094 Bacteria 6756
223 Ga0111539_10037742 3300009094 Bacteria 5831
224 Ga0111539_10080731 3300009094 Bacteria 3826
225 Ga0111539_10127056 3300009094 Bacteria 2986
226 Ga0111539_10209225 3300009094 Bacteria 2273
227 Ga0111539_10237068 3300009094 Bacteria 2124
228 Ga0105245_10022250 3300009098 Bacteria 5564
229 Ga0105245_10056079 3300009098 Bacteria 3540
230 Ga0114129_10033551 3300009147 Bacteria 7254
231 Ga0114129_10103520 3300009147 Bacteria 3936
232 Ga0114129_10107210 3300009147 Bacteria 3859
233 Ga0114129_10131833 3300009147 Bacteria 3431
234 Ga0114129_10141740 3300009147 Bacteria 3294
235 Ga0114129_10212130 3300009147 Bacteria 2617
236 Ga0114129_10277915 3300009147 Bacteria 2238
237 Ga0114129_10310531 3300009147 Bacteria 2099
238 Ga0114129_10428389 3300009147 Bacteria 1739
239 Ga0114129_10441939 3300009147 Bacteria 1707
240 Ga0114129_10464997 3300009147 Bacteria 1657
241 Ga0105243_10002222 3300009148 Bacteria 16355
242 Ga0105243_10022990 3300009148 Bacteria 4741
243 Ga0105243_10086198 3300009148 Bacteria 2575
244 Ga0105241_10000210 3300009174 Bacteria 43877
245 Ga0105241_10002350 3300009174 Bacteria 14209
246 Ga0105242_10000188 3300009176 Bacteria 47561
247 Ga0105242_10023059 3300009176 Bacteria 4905
248 Ga0105242_10087255 3300009176 Bacteria 2619
249 Ga0105248_10001416 3300009177 Bacteria 26806
250 Ga0105237_10000628 3300009545 Bacteria 49290
251 Ga0105237_10006309 3300009545 Bacteria 13177
252 Ga0105237_10301778 3300009545 Bacteria 1605
253 Ga0105238_10001186 3300009551 Bacteria 26227
254 Ga0105238_10014753 3300009551 Bacteria 7902
255 Ga0105238_10269670 3300009551 Bacteria 1682
256 Ga0105249_10137471 3300009553 Bacteria 2340
257 Ga0105249_10304018 3300009553 Bacteria 1601
258 Ga0105249_10305147 3300009553 Bacteria 1598
259 Ga0105249_10421204 3300009553 Bacteria 1369
260 Ga0099796_10001394 3300010159 Bacteria 4836
261 Ga0105239_10000288 3300010375 Bacteria 74273
262 Ga0105239_10001480 3300010375 Bacteria 31224
263 Ga0105239_10004196 3300010375 Bacteria 17308
264 Ga0105239_10084478 3300010375 Bacteria 3496
265 Ga0105239_10091103 3300010375 Bacteria 3364
266 Ga0105246_10012157 3300011119 Bacteria 5365
267 Ga0105246_10085567 3300011119 Bacteria 2258
268 Ga0157373_10089427 3300013100 Bacteria 2169
269 Ga0157373_10114672 3300013100 Bacteria 1894
270 Ga0157371_10043997 3300013102 Bacteria 3180
271 Ga0157370_10323564 3300013104 Bacteria 1422
272 Ga0157369_10000902 3300013105 Bacteria 37916
273 Ga0157369_10012755 3300013105 Bacteria 9530
274 Ga0157369_10078688 3300013105 Bacteria 3532
275 Ga0157369_10105679 3300013105 Bacteria 2997
276 Ga0157374_10028469 3300013296 Bacteria 5047
277 Ga0157378_10000966 3300013297 Bacteria 26354
278 Ga0157378_10037965 3300013297 Bacteria 4268
279 Ga0163162_10032596 3300013306 Bacteria 5175
280 Ga0163162_10264202 3300013306 Bacteria 1852
281 Ga0157372_10000966 3300013307 Bacteria 31334
282 Ga0157372_10009628 3300013307 Bacteria 10270
283 Ga0157372_10080322 3300013307 Bacteria 3689
284 Ga0157372_10214898 3300013307 Bacteria 2229
285 Ga0157375_10112831 3300013308 Bacteria 2819
286 Ga0157375_10162531 3300013308 Bacteria 2376
287 Ga0157375_10274055 3300013308 Bacteria 1849
288 Ga0163163_10082685 3300014325 Bacteria 3215
289 Ga0157377_10069096 3300014745 Bacteria 2037
290 Ga0157377_10083889 3300014745 Bacteria 1868
291 Ga0157379_10013027 3300014968 Bacteria 7281
292 Ga0157379_10115024 3300014968 Bacteria 2418
293 Ga0157376_10140655 3300014969 Unclassified 2165
294 Ga0163161_10033183 3300017792 Bacteria 3689
295 Ga0206353_10625318 3300020082 Bacteria 1369
296 Ga0224712_10016850 3300022467 Bacteria 2410
297 Ga0207656_10075827 3300025321 Bacteria 1503
298 Ga0207692_10109463 3300025898 Bacteria 1530
299 Ga0207642_10058379 3300025899 Bacteria 1780
300 Ga0207688_10000948 3300025901 Bacteria 14706
301 Ga0207688_10005801 3300025901 Bacteria 6722
302 Ga0207688_10199457 3300025901 Bacteria 1199
303 Ga0207647_10065064 3300025904 Bacteria 2214
304 Ga0207699_10010480 3300025906 Bacteria 4654
305 Ga0207699_10070275 3300025906 Bacteria 2137
306 Ga0207699_10136469 3300025906 Bacteria 1607
307 Ga0207645_10001998 3300025907 Bacteria 16384
308 Ga0207645_10007952 3300025907 Bacteria 7445
309 Ga0207705_10150332 3300025909 Bacteria 1745
310 Ga0207684_10000032 3300025910 Bacteria 293234
311 Ga0207684_10000035 3300025910 Bacteria 289353
312 Ga0207684_10360593 3300025910 Bacteria 1251
313 Ga0207654_10000034 3300025911 Bacteria 113041
314 Ga0207654_10000330 3300025911 Bacteria 28452
315 Ga0207654_10132075 3300025911 Unclassified 1581
316 Ga0207695_10001433 3300025913 Bacteria 40092
317 Ga0207671_10000662 3300025914 Bacteria 44965
318 Ga0207671_10007548 3300025914 Bacteria 9416
319 Ga0207693_10272948 3300025915 Unclassified 1325
320 Ga0207663_10100424 3300025916 Bacteria 1942
321 Ga0207663_10125096 3300025916 Bacteria 1767
322 Ga0207662_10035707 3300025918 Bacteria 2904
323 Ga0207657_10011614 3300025919 Bacteria 8734
324 Ga0207657_10031678 3300025919 Bacteria 4786
325 Ga0207649_10000511 3300025920 Bacteria 27298
326 Ga0207646_10014659 3300025922 Bacteria 7427
327 Ga0207646_10016864 3300025922 Bacteria 6849
328 Ga0207646_10018612 3300025922 Bacteria 6477
329 Ga0207646_10028874 3300025922 Bacteria 5046
330 Ga0207646_10047642 3300025922 Bacteria 3844
331 Ga0207646_10092675 3300025922 Bacteria 2705
332 Ga0207646_10310853 3300025922 Bacteria 1424
333 Ga0207646_10384000 3300025922 Bacteria 1269
334 Ga0207694_10000159 3300025924 Bacteria 68923
335 Ga0207694_10107208 3300025924 Bacteria 2219
336 Ga0207659_10009413 3300025926 Bacteria 6103
337 Ga0207659_10080735 3300025926 Bacteria 2403
338 Ga0207687_10015480 3300025927 Bacteria 5002
339 Ga0207700_10000341 3300025928 Bacteria 27463
340 Ga0207700_10015906 3300025928 Bacteria 4981
341 Ga0207700_10125891 3300025928 Bacteria 2085
342 Ga0207700_10162600 3300025928 Bacteria 1855
343 Ga0207664_10079557 3300025929 Bacteria 2661
344 Ga0207664_10110730 3300025929 Bacteria 2283
345 Ga0207664_10219023 3300025929 Bacteria 1650
346 Ga0207706_10000051 3300025933 Bacteria 115572
347 Ga0207686_10130266 3300025934 Bacteria 1724
348 Ga0207709_10016801 3300025935 Bacteria 4076
349 Ga0207670_10084393 3300025936 Bacteria 2230
350 Ga0207670_10121157 3300025936 Bacteria 1901
351 Ga0207669_10026581 3300025937 Bacteria 3151
352 Ga0207669_10027125 3300025937 Bacteria 3129
353 Ga0207669_10132755 3300025937 Bacteria 1714
354 Ga0207704_10000195 3300025938 Bacteria 31376
355 Ga0207704_10008210 3300025938 Bacteria 4976
356 Ga0207665_10094703 3300025939 Bacteria 2074
357 Ga0207711_10009699 3300025941 Bacteria 8021
358 Ga0207689_10037000 3300025942 Bacteria 4051
359 Ga0207689_10059046 3300025942 Bacteria 3155
360 Ga0207689_10061352 3300025942 Bacteria 3092
361 Ga0207661_10018047 3300025944 Bacteria 5238
362 Ga0207679_10123062 3300025945 Bacteria 2068
363 Ga0207667_10007800 3300025949 Bacteria 12795
364 Ga0207667_10499312 3300025949 Bacteria 1234
365 Ga0207651_10221697 3300025960 Bacteria 1529
366 Ga0207651_10297006 3300025960 Bacteria 1342
367 Ga0207712_10099293 3300025961 Bacteria 2161
368 Ga0207712_10157301 3300025961 Bacteria 1762
369 Ga0207668_10054959 3300025972 Bacteria 2765
370 Ga0207668_10099036 3300025972 Bacteria 2161
371 Ga0207668_10119893 3300025972 Bacteria 1990
372 Ga0207668_10328048 3300025972 Bacteria 1272
373 Ga0207640_10004513 3300025981 Bacteria 7554
374 Ga0207640_10035037 3300025981 Bacteria 3138
375 Ga0207640_10039195 3300025981 Bacteria 2997
376 Ga0207658_10053877 3300025986 Bacteria 2974
377 Ga0207658_10063852 3300025986 Bacteria 2761
378 Ga0207677_10020240 3300026023 Bacteria 4036
379 Ga0207677_10069194 3300026023 Bacteria 2481
380 Ga0207677_10071063 3300026023 Bacteria 2455
381 Ga0207703_10063045 3300026035 Bacteria 3038
382 Ga0207703_10249426 3300026035 Bacteria 1599
383 Ga0207639_10000187 3300026041 Bacteria 48392
384 Ga0207639_10000587 3300026041 Bacteria 25053
385 Ga0207639_10026448 3300026041 Bacteria 4217
386 Ga0207639_10050893 3300026041 Bacteria 3148
387 Ga0207678_10003156 3300026067 Bacteria 14908
388 Ga0207678_10029637 3300026067 Bacteria 4778
389 Ga0207708_10025531 3300026075 Bacteria 4471
390 Ga0207708_10028996 3300026075 Bacteria 4192
391 Ga0207702_10012214 3300026078 Bacteria 7147
392 Ga0207702_10015368 3300026078 Bacteria 6344
393 Ga0207641_10017605 3300026088 Bacteria 5850
394 Ga0207641_10302188 3300026088 Bacteria 1512
395 Ga0207648_10000046 3300026089 Bacteria 111511
396 Ga0207648_10001960 3300026089 Bacteria 22497
397 Ga0207648_10074400 3300026089 Bacteria 2960
398 Ga0207648_10080340 3300026089 Bacteria 2844
399 Ga0207676_10047653 3300026095 Bacteria 3323
400 Ga0207676_10398524 3300026095 Bacteria 1285
401 Ga0207674_10005732 3300026116 Bacteria 14730
402 Ga0207675_100014721 3300026118 Bacteria 7295
403 Ga0207675_100019338 3300026118 Bacteria 6355
404 Ga0207675_100033429 3300026118 Bacteria 4792
405 Ga0207675_100060137 3300026118 Bacteria 3546
406 Ga0207675_100071825 3300026118 Bacteria 3236
407 Ga0207683_10008324 3300026121 Bacteria 8871
408 Ga0207683_10067331 3300026121 Unclassified 3159
409 Ga0207698_10000126 3300026142 Bacteria 47895
410 Ga0207698_10012938 3300026142 Bacteria 5485
411 Ga0268266_10032032 3300028379 Bacteria 4466
412 Ga0268265_10154092 3300028380 Bacteria 1942
413 Ga0268265_10565156 3300028380 Bacteria 1082
414 Ga0265336_10013550 3300028666 Unclassified 2717
415 Ga0307515_10002389 3300028794 Bacteria 40941
416 Ga0265320_10000836 3300031240 Bacteria 23203
417 Ga0265340_10062939 3300031247 Unclassified 1771
418 Ga0265331_10002192 3300031250 Bacteria 13408
419 Ga0265316_10001372 3300031344 Bacteria 26246
420 Ga0307408_100047621 3300031548 Bacteria 3071
421 Ga0307408_100119477 3300031548 Bacteria 2039
422 Ga0307408_100205124 3300031548 Bacteria 1598
423 Ga0307516_10003200 3300031730 Bacteria 21277
424 Ga0307405_10000631 3300031731 Bacteria 13540
425 Ga0307405_10017818 3300031731 Bacteria 3904
426 Ga0307405_10050746 3300031731 Bacteria 2570
427 Ga0307405_10211458 3300031731 Bacteria 1416
428 Ga0307413_10108424 3300031824 Bacteria 1853
429 Ga0307413_10119566 3300031824 Bacteria 1781
430 Ga0307413_10157217 3300031824 Bacteria 1592
431 Ga0307410_10012146 3300031852 Bacteria 4963
432 Ga0307410_10018213 3300031852 Bacteria 4239
433 Ga0307410_10036127 3300031852 Bacteria 3214
434 Ga0307410_10076636 3300031852 Bacteria 2334
435 Ga0307410_10112731 3300031852 Bacteria 1970
436 Ga0307406_10009377 3300031901 Bacteria 5487
437 Ga0307406_10016954 3300031901 Bacteria 4239
438 Ga0307406_10041571 3300031901 Bacteria 2865
439 Ga0307406_10139013 3300031901 Bacteria 1716
440 Ga0307407_10013537 3300031903 Bacteria 3964
441 Ga0307407_10015641 3300031903 Bacteria 3758
442 Ga0307407_10054213 3300031903 Bacteria 2311
443 Ga0307407_10054635 3300031903 Bacteria 2304
444 Ga0307407_10066341 3300031903 Bacteria 2128
445 Ga0307412_10107925 3300031911 Bacteria 1982
446 Ga0307409_100002185 3300031995 Bacteria 10098
447 Ga0307409_100047725 3300031995 Bacteria 3253
448 Ga0307409_100133965 3300031995 Bacteria 2122
449 Ga0307409_100379616 3300031995 Bacteria 1343
450 Ga0307416_100001752 3300032002 Bacteria 12018
451 Ga0307416_100026960 3300032002 Bacteria 4245
452 Ga0307416_100031979 3300032002 Bacteria 3969
453 Ga0307416_100083746 3300032002 Bacteria 2707
454 Ga0307416_100105206 3300032002 Bacteria 2469
455 Ga0307416_100149305 3300032002 Bacteria 2140
456 Ga0307416_100167575 3300032002 Bacteria 2040
457 Ga0307414_10012148 3300032004 Bacteria 5081
458 Ga0307411_10047337 3300032005 Bacteria 2780
459 Ga0307411_10137288 3300032005 Bacteria 1797
460 Ga0307411_10277798 3300032005 Bacteria 1331
461 Ga0307415_100008214 3300032126 Bacteria 5775
462 Ga0307415_100012318 3300032126 Bacteria 4940
463 Ga0307415_100016466 3300032126 Bacteria 4409
464 Ga0307415_100028421 3300032126 Bacteria 3558
465 Ga0307415_100034455 3300032126 Bacteria 3297
466 Ga0307415_100236218 3300032126 Bacteria 1475
467 Ga0307415_100303721 3300032126 Bacteria 1323
468 Ga0373938_0010203 3300034957 Bacteria 1720
469 Ga0373932_0026700 3300035112 Bacteria 1573
470 Ga0373936_0015293 3300035113 Bacteria 2940
471 Ga0373939_0002483 3300035114 Bacteria 4353
472 Ga0373957_0111568 3300035120 Bacteria 1102
473 Ga0373946_0023443 3300035171 Bacteria 2411
474 Ga0373961_0004579 3300035241 Bacteria 3340
475 Ga0373935_0007410 3300035692 Bacteria 6567
476 Ga0373927_0015391 3300035695 Bacteria 5055
477 Ga0373927_0017459 3300035695 Bacteria 4721
478 Ga0373947_0007370 3300035725 Bacteria 6369
479 Ga0373947_0058206 3300035725 Bacteria 2341
480 Ga0373937_0026414 3300036401 Bacteria 5247
481 Ga0373937_0036002 3300036401 Bacteria 4509
482 Ga0373925_0000216 3300037068 Bacteria 62790
483 Ga0373925_0008746 3300037068 Bacteria 7375
484 Ga0373925_0033147 3300037068 Bacteria 3807
485 Ga0395899_0015076 3300037312 Bacteria 5891
486 Ga0395899_0055726 3300037312 Bacteria 2923
487 Ga0395900_0007619 3300037418 Bacteria 11178
488 Ga0395900_0040750 3300037418 Bacteria 4786
489 Ga0395900_0094571 3300037418 Bacteria 3070
490 Ga0395900_0189283 3300037418 Bacteria 2088
491 Ga0395898_0051510 3300037466 Bacteria 4025
492 Ga0395898_0097982 3300037466 Bacteria 2815
493 Ga0395898_0153762 3300037466 Bacteria 2201
494 Ga0395898_0210827 3300037466 Bacteria 1853
495 Ga0395898_0256845 3300037466 Bacteria 1666
496 Ga0395905_0001388 3300037471 Bacteria 29372
497 Ga0395905_0031877 3300037471 Bacteria 4959
498 Ga0395905_0044701 3300037471 Bacteria 4155
499 Ga0395905_0056562 3300037471 Bacteria 3669
500 Ga0395905_0140241 3300037471 Bacteria 2274
501 Ga0395905_0143038 3300037471 Bacteria 2250
502 Ga0395901_0003745 3300038443 Bacteria 15320
503 Ga0395901_0015579 3300038443 Bacteria 7743
504 Ga0395901_0036965 3300038443 Bacteria 5049
505 Ga0395901_0072696 3300038443 Bacteria 3585
506 Ga0395901_0272068 3300038443 Bacteria 1761
507 Ga0395901_0274158 3300038443 Bacteria 1754
508 Ga0395901_0391570 3300038443 Bacteria 1429
509 Ga0395901_0442445 3300038443 Bacteria 1330
510 Ga0436365_0450538 3300039437 Bacteria 7958
511 Ga0436360_0124737 3300039438 Bacteria 1042
512 Ga0436363_0888459 3300039450 Bacteria 4519
513 Ga0436362_1013513 3300039453 Bacteria 1914
514 Ga0439448_0001904 3300042005 Bacteria 5556
515 Ga0439448_0006854 3300042005 Bacteria 3286
516 Ga0439448_0018645 3300042005 Bacteria 2130
517 Ga0439450_001088 3300042008 Bacteria 3847
518 Ga0439451_007316 3300042009 Bacteria 2253
519 Ga0439454_007884 3300042011 Bacteria 1346
520 Ga0439455_0006489 3300042012 Bacteria 2432
521 Ga0439463_003438 3300042016 Bacteria 4008
522 Ga0439463_004391 3300042016 Bacteria 3534
523 Ga0450914_000535 3300042118 Bacteria 1854
524 Ga0439444_0002448 3300042437 Bacteria 2539
525 Ga0439460_0004935 3300042461 Bacteria 3258
526 Ga0439460_0044074 3300042461 Bacteria 1320
527 Ga0439460_0068667 3300042461 Bacteria 1094
528 Ga0450916_000756 3300042530 Bacteria 2988
529 Ga0450916_002631 3300042530 Bacteria 1923
530 Ga0450893_0022997 3300042532 Bacteria 1082
531 Ga0439440_0000805 3300042993 Bacteria 5432
532 Ga0439440_0003187 3300042993 Bacteria 3144
533 Ga0439440_0006495 3300042993 Bacteria 2356
534 Ga0495603_0050579 3300046455 Bacteria 2471
535 Ga0495629_0002999 3300046459 Bacteria 12845
536 Ga0495638_0007037 3300046460 Bacteria 8116
537 Ga0495651_0009668 3300046462 Bacteria 7415
538 Ga0495651_0095773 3300046462 Bacteria 2219
539 Ga0495653_0003932 3300046463 Bacteria 12015
540 Ga0495653_0010975 3300046463 Bacteria 7415
541 Ga0495653_0156903 3300046463 Bacteria 1584
542 Ga0495580_0062057 3300046472 Bacteria 2623
543 Ga0495582_0000100 3300046473 Bacteria 44455
544 Ga0495582_0004953 3300046473 Bacteria 7461
545 Ga0495639_0012443 3300046475 Bacteria 3669
546 Ga0495639_0014053 3300046475 Bacteria 3463
547 Ga0495664_0003730 3300046477 Bacteria 8309
548 Ga0495608_0008442 3300046511 Bacteria 7216
549 Ga0495608_0109601 3300046511 Bacteria 1775
550 Ga0495618_0108837 3300046514 Bacteria 1774
551 Ga0495628_0110962 3300046516 Bacteria 2109
552 Ga0495628_0133274 3300046516 Bacteria 1900
553 Ga0495666_0102195 3300046526 Bacteria 1350
554 Ga0495652_0077113 3300046529 Bacteria 2763
555 Ga0495652_0210969 3300046529 Bacteria 1466
556 Ga0495665_0004188 3300046531 Bacteria 7783
557 Ga0495665_0004336 3300046531 Bacteria 7658
558 Ga0495665_0082695 3300046531 Bacteria 1688
559 Ga0495640_0072082 3300046533 Bacteria 2315
560 Ga0495640_0130628 3300046533 Bacteria 1626
561 Ga0495587_0003733 3300046536 Bacteria 10102
562 Ga0495667_0054755 3300046559 Bacteria 2624
563 Ga0495667_0122606 3300046559 Bacteria 1678
564 Ga0495656_0014143 3300046615 Bacteria 2986
565 Ga0495634_0103681 3300046642 Bacteria 1835
566 Ga0495625_0017014 3300046660 Bacteria 5701
567 Ga0495635_0031441 3300046663 Bacteria 3685
568 Ga0495635_0035031 3300046663 Bacteria 3481
569 Ga0495635_0043028 3300046663 Bacteria 3117
570 Ga0495635_0050716 3300046663 Bacteria 2860
571 Ga0495659_0020591 3300046664 Bacteria 2217
572 Ga0495657_0017721 3300046675 Bacteria 5166
573 Ga0495599_0001934 3300046678 Bacteria 12000
574 Ga0495599_0037028 3300046678 Bacteria 3065
575 Ga0495623_0144810 3300046679 Bacteria 1410
576 Ga0495646_0009810 3300046680 Bacteria 6083
577 Ga0495647_0010537 3300046681 Bacteria 3148
578 Ga0495658_0000961 3300046683 Bacteria 15334
579 Ga0495658_0002334 3300046683 Bacteria 9581
580 Ga0495613_0000429 3300046689 Bacteria 35908
581 Ga0495613_0007152 3300046689 Bacteria 8310
582 Ga0495624_0099510 3300046690 Bacteria 1791
583 Ga0495670_0050502 3300046691 Bacteria 2082
584 Ga0495600_0008900 3300046809 Bacteria 6184
585 Ga0495581_0002779 3300047315 Bacteria 9977
586 Ga0495581_0016664 3300047315 Bacteria 4272
587 Ga0495581_0017412 3300047315 Bacteria 4173
588 Ga0495604_0004649 3300047317 Bacteria 10884
589 Ga0495604_0066928 3300047317 Bacteria 2731
590 Ga0495636_0094084 3300047318 Bacteria 1304
591 Ga0495674_0037966 3300047319 Bacteria 4327
592 Ga0495674_0394221 3300047319 Bacteria 1118
593 Ga0495680_0002412 3300047322 Bacteria 19146
594 Ga0495680_0067749 3300047322 Bacteria 2728
595 Ga0495680_0077361 3300047322 Bacteria 2520
596 Ga0495680_0097171 3300047322 Bacteria 2199
597 Ga0495680_0140254 3300047322 Bacteria 1769
598 Ga0495684_0001455 3300047471 Bacteria 18943
599 Ga0495684_0006352 3300047471 Bacteria 9185
600 Ga0495684_0057913 3300047471 Bacteria 2952
601 Ga0495593_0132638 3300047673 Bacteria 1264
602 Ga0495602_0020610 3300048088 Bacteria 6511
603 Ga0496100_0184288 3300048903 Bacteria 1511
604 Ga0496100_0215987 3300048903 Bacteria 1405
605 Ga0496101_0053525 3300048904 Bacteria 2913
606 Ga0496102_0040905 3300048905 Bacteria 4195
607 Ga0496102_0241297 3300048905 Bacteria 1704
608 Ga0496103_0003284 3300048906 Bacteria 9904
609 Ga0496103_0124020 3300048906 Bacteria 1647
610 Ga0496104_0001721 3300048907 Bacteria 18894
611 Ga0496104_0033128 3300048907 Bacteria 4810
612 Ga0496105_0055616 3300048908 Bacteria 3267
613 Ga0496105_0068225 3300048908 Bacteria 2937
614 Ga0496105_0202059 3300048908 Bacteria 1622
615 Ga0496106_0065503 3300048909 Bacteria 2766
616 Ga0496107_0078908 3300048910 Bacteria 2399
617 Ga0496108_0007777 3300048911 Bacteria 8684
618 Ga0496108_0024190 3300048911 Bacteria 5000
619 Ga0496109_0013517 3300048912 Bacteria 7084
620 Ga0496109_0017024 3300048912 Bacteria 6362
621 Ga0496110_0027482 3300048913 Bacteria 4878
622 Ga0496110_0035007 3300048913 Bacteria 4353
623 Ga0496110_0236813 3300048913 Bacteria 1661
624 Ga0496110_0338849 3300048913 Bacteria 1370
625 Ga0496111_0012569 3300048914 Bacteria 5737
626 Ga0496111_0014685 3300048914 Bacteria 5356
627 Ga0496111_0081736 3300048914 Bacteria 2359
628 Ga0496112_0035658 3300048915 Bacteria 4848
629 Ga0496112_0058371 3300048915 Bacteria 3800
630 Ga0496112_0195651 3300048915 Bacteria 1982
631 Ga0496113_0007893 3300048916 Bacteria 6885
632 Ga0496113_0015873 3300048916 Bacteria 5189
633 Ga0496114_0415731 3300048917 Bacteria 1191
634 Ga0496115_0060982 3300048918 Bacteria 3040
635 Ga0501031_0009445 3300049568 Bacteria 6340
636 Ga0501033_0099054 3300049570 Bacteria 2128
637 Ga0501034_0085671 3300049571 Bacteria 3152
638 Ga0501036_0018498 3300049572 Bacteria 5839
639 Ga0501037_0025496 3300049573 Bacteria 4368
640 Ga0501038_0004126 3300049574 Bacteria 13517
641 Ga0501040_0000516 3300049576 Bacteria 23123
642 Ga0501042_0032023 3300049578 Bacteria 3721
643 Ga0501043_0050324 3300049579 Bacteria 3275
644 Ga0501047_0373288 3300049581 Bacteria 1261
645 Ga0501048_0002443 3300049582 Bacteria 14183
646 Ga0501068_0010985 3300049584 Bacteria 5096
647 Ga0501068_0048543 3300049584 Bacteria 2563
648 Ga0501070_0067409 3300049586 Bacteria 2964
649 Ga0501071_0006270 3300049587 Bacteria 7716
650 Ga0501072_0005443 3300049588 Bacteria 9696
651 Ga0501073_0063269 3300049589 Bacteria 2581
652 Ga0501074_0013512 3300049590 Bacteria 5934
653 Ga0501075_0000981 3300049591 Bacteria 18184
654 Ga0501080_0043524 3300049742 Bacteria 4181
655 Ga0501081_0001540 3300049743 Bacteria 14175
656 Ga0501083_0016500 3300049744 Bacteria 5168
657 Ga0501035_0022881 3300049822 Bacteria 5739
658 Ga0501035_0065319 3300049822 Bacteria 3232
659 Ga0501045_0006456 3300049824 Bacteria 8121
660 nmdc:mga05p37_14029_c1 3300050507 Bacteria 9611
661 nmdc:mga05p37_197943_c1 3300050507 Bacteria 2436
662 nmdc:mga05p37_294504_c1 3300050507 Bacteria 1931
663 nmdc:mga05p37_358965_c1 3300050507 Bacteria 1714
664 nmdc:mga05p37_391241_c1 3300050507 Bacteria 1626
665 nmdc:mga05p37_556215_c1 3300050507 Bacteria 1305
666 nmdc:mga05p37_79281_c1 3300050507 Bacteria 4044
667 nmdc:mga05p37_92144_c1 3300050507 Bacteria 3734
668 nmdc:mga09592_132951_c1 3300050508 Bacteria 2142
669 nmdc:mga09592_191214_c1 3300050508 Bacteria 1772
670 nmdc:mga09592_46071_c1 3300050508 Bacteria 3674
671 nmdc:mga0qj67_147683_c1 3300050509 Bacteria 1906
672 nmdc:mga0qj67_17678_c1 3300050509 Bacteria 5425
673 nmdc:mga0qj67_2737_c1 3300050509 Bacteria 12639
674 nmdc:mga06r32_142190_c1 3300050510 Bacteria 2376
675 nmdc:mga06r32_14520_c1 3300050510 Bacteria 7148
676 nmdc:mga06r32_30259_c1 3300050510 Bacteria 5080
677 nmdc:mga06r32_393893_c1 3300050510 Bacteria 1367
678 nmdc:mga06r32_44285_c1 3300050510 Bacteria 4237
679 nmdc:mga06r32_503899_c1 3300050510 Bacteria 1187
680 nmdc:mga06r32_57630_c1 3300050510 Bacteria 3732
681 nmdc:mga06r32_82201_c1 3300050510 Bacteria 3138
682 nmdc:mga08y16_18172_c1 3300050511 Bacteria 7409
683 nmdc:mga08y16_63887_c1 3300050511 Bacteria 3845
684 nmdc:mga08y16_6894_c1 3300050511 Bacteria 11912
685 nmdc:mga08y16_76826_c1 3300050511 Bacteria 3481
686 nmdc:mga08y16_92902_c1 3300050511 Bacteria 3144
687 nmdc:mga0n895_422169_c1 3300050512 Bacteria 1348
688 nmdc:mga0n895_83624_c1 3300050512 Bacteria 3184
689 nmdc:mga0rr50_107561_c1 3300050513 Bacteria 2202
690 nmdc:mga0rr50_133781_c1 3300050513 Bacteria 1988
691 nmdc:mga0a205_17867_c1 3300050515 Bacteria 6655
692 nmdc:mga0a205_187512_c1 3300050515 Bacteria 1961
693 nmdc:mga0a205_39041_c1 3300050515 Bacteria 4569
694 nmdc:mga0a205_47028_c1 3300050515 Bacteria 4162
695 nmdc:mga0a205_51655_c1 3300050515 Bacteria 3968
696 Ga0495595_0056679 3300053084 Bacteria 1826
697 Ga0495619_0008571 3300053085 Bacteria 6472
698 Ga0495619_0040365 3300053085 Bacteria 3051
699 Ga0500583_0002885 3300053092 Bacteria 5283
700 Ga0500583_0006310 3300053092 Bacteria 4065
701 Ga0500604_0006207 3300053151 Unclassified 3158
702 Ga0590071_020568 3300059421 Bacteria 1554
703 Ga0590075_029958 3300059424 Bacteria 1377
704 Ga0501082_0003197 3300060353 Bacteria 14282
705 Ga0530510_0009041 3300061734 Bacteria 6982
706 2842042937 2842038055 Bacteria 8002051
707 2842050978 2842045827 Bacteria 8006841
708 2913917676 2913912277 Bacteria 9037797
709 Ga0395901_0015729
710 JGI25406J46586_10001594
711 JGI25406J46586_10002090
712 JGI25406J46586_10027120
713 JGI25407J50210_10004777
714 JGI25407J50210_10009262
715 JGI25407J50210_10010602
716 JGI25407J50210_10023900
717 JGI25404J52841_10003810
718 Ga0070658_10298424
719 Ga0070676_10003205
720 Ga0070676_10015129
721 Ga0070683_100017509
722 Ga0070683_100257360
723 Ga0070683_100353136
724 Ga0068869_100040648
725 Ga0068869_100042608
726 Ga0068869_100090180
727 Ga0070666_10034052
728 Ga0070680_100013947
729 Ga0070682_100006465
730 Ga0068868_100021934
731 Ga0068868_100033453
732 Ga0068868_100109305
733 Ga0070660_100006826
734 Ga0070660_100196859
735 Ga0070689_100115526
736 Ga0070689_100369606
737 Ga0070691_10030191
738 Ga0070691_10052187
739 Ga0070661_100000665
740 Ga0070661_100381562
741 Ga0070692_10056482
742 Ga0070668_100011167
743 Ga0070668_100014080
744 Ga0070668_100033551
745 Ga0070675_100200525
746 Ga0070674_100000146
747 Ga0070674_100008855
748 Ga0070674_100016016
749 Ga0070674_100265584
750 Ga0070673_100049235
751 Ga0070673_100092628
752 Ga0070673_100255382
753 Ga0070667_100038592
754 Ga0070703_10047544
755 Ga0070709_10227690
756 Ga0070714_100075620
757 Ga0070713_100000454
758 Ga0070713_100005015
759 Ga0070713_100010279
760 Ga0070713_100109722
761 Ga0070713_100144261
762 Ga0070710_10018009
763 Ga0070710_10057122
764 Ga0070710_10080614
765 Ga0070701_10046684
766 Ga0070711_100026193
767 Ga0070711_100053679
768 Ga0070711_100118602
769 Ga0070705_100000420
770 Ga0070705_100007440
771 Ga0070700_100016835
772 Ga0070694_100007788
773 Ga0070708_100001132
774 Ga0070708_100029538
775 Ga0070708_100181593
776 Ga0070708_100454900
777 Ga0070708_100505978
778 Ga0070663_100143445
779 Ga0070678_100045941
780 Ga0070662_100000751
781 Ga0070662_100122319
782 Ga0070662_100203094
783 Ga0068867_100006449
784 Ga0068867_100044441
785 Ga0070685_10025569
786 Ga0070706_100000003
787 Ga0070706_100000319
788 Ga0070706_100139702
789 Ga0070706_100173115
790 Ga0070707_100002662
791 Ga0070707_100004145
792 Ga0070707_100015267
793 Ga0070707_100025392
794 Ga0070707_100054633
795 Ga0070698_100002690
796 Ga0070698_100085865
797 Ga0070698_100123548
798 Ga0070699_100000370
799 Ga0070699_100085184
800 Ga0070699_100091331
801 Ga0070699_100092501
802 Ga0070699_100177096
803 Ga0070699_100359945
804 Ga0070679_100086616
805 Ga0070679_100122521
806 Ga0070684_100280908
807 Ga0070697_100006162
808 Ga0070697_100205658
809 Ga0070697_100274866
810 Ga0068853_100000593
811 Ga0068853_100000923
812 Ga0068853_100001809
813 Ga0068853_100043986
814 Ga0068853_100249997
815 Ga0070686_100015694
816 Ga0070695_100002485
817 Ga0070696_100004131
818 Ga0070696_100170522
819 Ga0070665_100022487
820 Ga0070665_100139643
821 Ga0070665_100323928
822 Ga0068855_100008597
823 Ga0070664_100013713
824 Ga0070664_100164226
825 Ga0068857_100120036
826 Ga0068857_100378494
827 Ga0068854_100001772
828 Ga0068854_100032243
829 Ga0068854_100039741
830 Ga0068856_100001009
831 Ga0068856_100015072
832 Ga0068856_100085369
833 Ga0070702_100027318
834 Ga0070702_100095471
835 Ga0068852_100000187
836 Ga0068852_100016573
837 Ga0068852_100018843
838 Ga0068852_100197940
839 Ga0068859_100030649
840 Ga0068859_100297047
841 Ga0068859_100299270
842 Ga0068864_100106056
843 Ga0068864_100164407
844 Ga0068866_10000027
845 Ga0068861_100013991
846 Ga0068861_100045774
847 Ga0068861_100231493
848 Ga0068861_100272683
849 Ga0068870_10050128
850 Ga0068863_100093027
851 Ga0068863_100156222
852 Ga0068858_100089793
853 Ga0068860_100025384
854 Ga0068862_100044457
855 Ga0068862_100141317
856 Ga0081455_10005977
857 Ga0081455_10038779
858 Ga0081455_10110615
859 Ga0081455_10245690
860 Ga0081538_10000339
861 Ga0081538_10001010
862 Ga0081538_10001429
863 Ga0081538_10002754
864 Ga0081538_10003911
865 Ga0081538_10005292
866 Ga0081538_10006276
867 Ga0081538_10007237
868 Ga0081538_10007784
869 Ga0081538_10010055
870 Ga0081538_10011672
871 Ga0081538_10014482
872 Ga0081538_10015077
873 Ga0081538_10015508
874 Ga0081538_10017237
875 Ga0081538_10026413
876 Ga0081538_10050934
877 Ga0081538_10058582
878 Ga0081540_1000531
879 Ga0081540_1026864
880 Ga0081539_10000336
881 Ga0081539_10001103
882 Ga0081539_10002642
883 Ga0081539_10005440
884 Ga0081539_10011696
885 Ga0070717_10005668
886 Ga0070717_10013579
887 Ga0070717_10089083
888 Ga0070717_10274247
889 Ga0075432_10004031
890 Ga0075432_10007347
891 Ga0070712_100060114
892 Ga0070712_100243561
893 Ga0070712_100359438
894 Ga0075427_10002758
895 Ga0075427_10003263
896 Ga0097621_100143570
897 Ga0068871_100077750
898 Ga0075428_100000785
899 Ga0075428_100043203
900 Ga0075428_100136668
901 Ga0075428_100225168
902 Ga0075430_100003789
903 Ga0075430_100163911
904 Ga0075430_100272619
905 Ga0075431_100031106
906 Ga0075431_100105777
907 Ga0075431_100158307
908 Ga0075431_100450090
909 Ga0075433_10018638
910 Ga0075433_10160064
911 Ga0075433_10190382
912 Ga0075433_10277980
913 Ga0075434_100033871
914 Ga0075434_100120634
915 Ga0075429_100010017
916 Ga0075429_100016822
917 Ga0075429_100020519
918 Ga0068865_100014944
919 Ga0068865_100082810
920 Ga0075436_100053480
921 Ga0097620_100030649
922 Ga0097620_100236951
923 Ga0097620_100297060
924 Ga0097620_100299288
925 Ga0105240_10007274
926 Ga0105240_10384756
927 Ga0105240_10532470
928 Ga0111539_10012188
929 Ga0111539_10014484
930 Ga0111539_10028936
931 Ga0111539_10037742
932 Ga0111539_10080731
933 Ga0111539_10127056
934 Ga0111539_10209225
935 Ga0111539_10237068
936 Ga0105245_10022250
937 Ga0105245_10056079
938 Ga0114129_10033551
939 Ga0114129_10103520
940 Ga0114129_10107210
941 Ga0114129_10131833
942 Ga0114129_10141740
943 Ga0114129_10212130
944 Ga0114129_10277915
945 Ga0114129_10310531
946 Ga0114129_10428389
947 Ga0114129_10441939
948 Ga0114129_10464997
949 Ga0105243_10002222
950 Ga0105243_10022990
951 Ga0105243_10086198
952 Ga0105241_10000210
953 Ga0105241_10002350
954 Ga0105242_10000188
955 Ga0105242_10023059
956 Ga0105242_10087255
957 Ga0105248_10001416
958 Ga0105237_10000628
959 Ga0105237_10006309
960 Ga0105237_10301778
961 Ga0105238_10001186
962 Ga0105238_10014753
963 Ga0105238_10269670
964 Ga0105249_10137471
965 Ga0105249_10304018
966 Ga0105249_10305147
967 Ga0105249_10421204
968 Ga0099796_10001394
969 Ga0105239_10000288
970 Ga0105239_10001480
971 Ga0105239_10004196
972 Ga0105239_10084478
973 Ga0105239_10091103
974 Ga0105246_10012157
975 Ga0105246_10085567
976 Ga0157373_10089427
977 Ga0157373_10114672
978 Ga0157371_10043997
979 Ga0157370_10323564
980 Ga0157369_10000902
981 Ga0157369_10012755
982 Ga0157369_10078688
983 Ga0157369_10105679
984 Ga0157374_10028469
985 Ga0157378_10000966
986 Ga0157378_10037965
987 Ga0163162_10032596
988 Ga0163162_10264202
989 Ga0157372_10000966
990 Ga0157372_10009628
991 Ga0157372_10080322
992 Ga0157372_10214898
993 Ga0157375_10112831
994 Ga0157375_10162531
995 Ga0157375_10274055
996 Ga0163163_10082685
997 Ga0157377_10069096
998 Ga0157377_10083889
999 Ga0157379_10013027
1000 Ga0157379_10115024
1001 Ga0157376_10140655
1002 Ga0163161_10033183
1003 Ga0206353_10625318
1004 Ga0224712_10016850
1005 Ga0207656_10075827
1006 Ga0207692_10109463
1007 Ga0207642_10058379
1008 Ga0207688_10000948
1009 Ga0207688_10005801
1010 Ga0207688_10199457
1011 Ga0207647_10065064
1012 Ga0207699_10010480
1013 Ga0207699_10070275
1014 Ga0207699_10136469
1015 Ga0207645_10001998
1016 Ga0207645_10007952
1017 Ga0207705_10150332
1018 Ga0207684_10000032
1019 Ga0207684_10000035
1020 Ga0207684_10360593
1021 Ga0207654_10000034
1022 Ga0207654_10000330
1023 Ga0207654_10132075
1024 Ga0207695_10001433
1025 Ga0207671_10000662
1026 Ga0207671_10007548
1027 Ga0207693_10272948
1028 Ga0207663_10100424
1029 Ga0207663_10125096
1030 Ga0207662_10035707
1031 Ga0207657_10011614
1032 Ga0207657_10031678
1033 Ga0207649_10000511
1034 Ga0207646_10014659
1035 Ga0207646_10016864
1036 Ga0207646_10018612
1037 Ga0207646_10028874
1038 Ga0207646_10047642
1039 Ga0207646_10092675
1040 Ga0207646_10310853
1041 Ga0207646_10384000
1042 Ga0207694_10000159
1043 Ga0207694_10107208
1044 Ga0207659_10009413
1045 Ga0207659_10080735
1046 Ga0207687_10015480
1047 Ga0207700_10000341
1048 Ga0207700_10015906
1049 Ga0207700_10125891
1050 Ga0207700_10162600
1051 Ga0207664_10079557
1052 Ga0207664_10110730
1053 Ga0207664_10219023
1054 Ga0207706_10000051
1055 Ga0207686_10130266
1056 Ga0207709_10016801
1057 Ga0207670_10084393
1058 Ga0207670_10121157
1059 Ga0207669_10026581
1060 Ga0207669_10027125
1061 Ga0207669_10132755
1062 Ga0207704_10000195
1063 Ga0207704_10008210
1064 Ga0207665_10094703
1065 Ga0207711_10009699
1066 Ga0207689_10037000
1067 Ga0207689_10059046
1068 Ga0207689_10061352
1069 Ga0207661_10018047
1070 Ga0207679_10123062
1071 Ga0207667_10007800
1072 Ga0207667_10499312
1073 Ga0207651_10221697
1074 Ga0207651_10297006
1075 Ga0207712_10099293
1076 Ga0207712_10157301
1077 Ga0207668_10054959
1078 Ga0207668_10099036
1079 Ga0207668_10119893
1080 Ga0207668_10328048
1081 Ga0207640_10004513
1082 Ga0207640_10035037
1083 Ga0207640_10039195
1084 Ga0207658_10053877
1085 Ga0207658_10063852
1086 Ga0207677_10020240
1087 Ga0207677_10069194
1088 Ga0207677_10071063
1089 Ga0207703_10063045
1090 Ga0207703_10249426
1091 Ga0207639_10000187
1092 Ga0207639_10000587
1093 Ga0207639_10026448
1094 Ga0207639_10050893
1095 Ga0207678_10003156
1096 Ga0207678_10029637
1097 Ga0207708_10025531
1098 Ga0207708_10028996
1099 Ga0207702_10012214
1100 Ga0207702_10015368
1101 Ga0207641_10017605
1102 Ga0207641_10302188
1103 Ga0207648_10000046
1104 Ga0207648_10001960
1105 Ga0207648_10074400
1106 Ga0207648_10080340
1107 Ga0207676_10047653
1108 Ga0207676_10398524
1109 Ga0207674_10005732
1110 Ga0207675_100014721
1111 Ga0207675_100019338
1112 Ga0207675_100033429
1113 Ga0207675_100060137
1114 Ga0207675_100071825
1115 Ga0207683_10008324
1116 Ga0207683_10067331
1117 Ga0207698_10000126
1118 Ga0207698_10012938
1119 Ga0268266_10032032
1120 Ga0268265_10154092
1121 Ga0268265_10565156
1122 Ga0265336_10013550
1123 Ga0307515_10002389
1124 Ga0265320_10000836
1125 Ga0265340_10062939
1126 Ga0265331_10002192
1127 Ga0265316_10001372
1128 Ga0307408_100047621
1129 Ga0307408_100119477
1130 Ga0307408_100205124
1131 Ga0307516_10003200
1132 Ga0307405_10000631
1133 Ga0307405_10017818
1134 Ga0307405_10050746
1135 Ga0307405_10211458
1136 Ga0307413_10108424
1137 Ga0307413_10119566
1138 Ga0307413_10157217
1139 Ga0307410_10012146
1140 Ga0307410_10018213
1141 Ga0307410_10036127
1142 Ga0307410_10076636
1143 Ga0307410_10112731
1144 Ga0307406_10009377
1145 Ga0307406_10016954
1146 Ga0307406_10041571
1147 Ga0307406_10139013
1148 Ga0307407_10013537
1149 Ga0307407_10015641
1150 Ga0307407_10054213
1151 Ga0307407_10054635
1152 Ga0307407_10066341
1153 Ga0307412_10107925
1154 Ga0307409_100002185
1155 Ga0307409_100047725
1156 Ga0307409_100133965
1157 Ga0307409_100379616
1158 Ga0307416_100001752
1159 Ga0307416_100026960
1160 Ga0307416_100031979
1161 Ga0307416_100083746
1162 Ga0307416_100105206
1163 Ga0307416_100149305
1164 Ga0307416_100167575
1165 Ga0307414_10012148
1166 Ga0307411_10047337
1167 Ga0307411_10137288
1168 Ga0307411_10277798
1169 Ga0307415_100008214
1170 Ga0307415_100012318
1171 Ga0307415_100016466
1172 Ga0307415_100028421
1173 Ga0307415_100034455
1174 Ga0307415_100236218
1175 Ga0307415_100303721
1176 Ga0373938_0010203
1177 Ga0373932_0026700
1178 Ga0373936_0015293
1179 Ga0373939_0002483
1180 Ga0373957_0111568
1181 Ga0373946_0023443
1182 Ga0373961_0004579
1183 Ga0373935_0007410
1184 Ga0373927_0015391
1185 Ga0373927_0017459
1186 Ga0373947_0007370
1187 Ga0373947_0058206
1188 Ga0373937_0026414
1189 Ga0373937_0036002
1190 Ga0373925_0000216
1191 Ga0373925_0008746
1192 Ga0373925_0033147
1193 Ga0395899_0015076
1194 Ga0395899_0055726
1195 Ga0395900_0007619
1196 Ga0395900_0040750
1197 Ga0395900_0094571
1198 Ga0395900_0189283
1199 Ga0395898_0051510
1200 Ga0395898_0097982
1201 Ga0395898_0153762
1202 Ga0395898_0210827
1203 Ga0395898_0256845
1204 Ga0395905_0001388
1205 Ga0395905_0031877
1206 Ga0395905_0044701
1207 Ga0395905_0056562
1208 Ga0395905_0140241
1209 Ga0395905_0143038
1210 Ga0395901_0003745
1211 Ga0395901_0015579
1212 Ga0395901_0036965
1213 Ga0395901_0072696
1214 Ga0395901_0272068
1215 Ga0395901_0274158
1216 Ga0395901_0391570
1217 Ga0395901_0442445
1218 Ga0436365_0450538
1219 Ga0436360_0124737
1220 Ga0436363_0888459
1221 Ga0436362_1013513
1222 Ga0439448_0001904
1223 Ga0439448_0006854
1224 Ga0439448_0018645
1225 Ga0439450_001088
1226 Ga0439451_007316
1227 Ga0439454_007884
1228 Ga0439455_0006489
1229 Ga0439463_003438
1230 Ga0439463_004391
1231 Ga0450914_000535
1232 Ga0439444_0002448
1233 Ga0439460_0004935
1234 Ga0439460_0044074
1235 Ga0439460_0068667
1236 Ga0450916_000756
1237 Ga0450916_002631
1238 Ga0450893_0022997
1239 Ga0439440_0000805
1240 Ga0439440_0003187
1241 Ga0439440_0006495
1242 Ga0495603_0050579
1243 Ga0495629_0002999
1244 Ga0495638_0007037
1245 Ga0495651_0009668
1246 Ga0495651_0095773
1247 Ga0495653_0003932
1248 Ga0495653_0010975
1249 Ga0495653_0156903
1250 Ga0495580_0062057
1251 Ga0495582_0000100
1252 Ga0495582_0004953
1253 Ga0495639_0012443
1254 Ga0495639_0014053
1255 Ga0495664_0003730
1256 Ga0495608_0008442
1257 Ga0495608_0109601
1258 Ga0495618_0108837
1259 Ga0495628_0110962
1260 Ga0495628_0133274
1261 Ga0495666_0102195
1262 Ga0495652_0077113
1263 Ga0495652_0210969
1264 Ga0495665_0004188
1265 Ga0495665_0004336
1266 Ga0495665_0082695
1267 Ga0495640_0072082
1268 Ga0495640_0130628
1269 Ga0495587_0003733
1270 Ga0495667_0054755
1271 Ga0495667_0122606
1272 Ga0495656_0014143
1273 Ga0495634_0103681
1274 Ga0495625_0017014
1275 Ga0495635_0031441
1276 Ga0495635_0035031
1277 Ga0495635_0043028
1278 Ga0495635_0050716
1279 Ga0495659_0020591
1280 Ga0495657_0017721
1281 Ga0495599_0001934
1282 Ga0495599_0037028
1283 Ga0495623_0144810
1284 Ga0495646_0009810
1285 Ga0495647_0010537
1286 Ga0495658_0000961
1287 Ga0495658_0002334
1288 Ga0495613_0000429
1289 Ga0495613_0007152
1290 Ga0495624_0099510
1291 Ga0495670_0050502
1292 Ga0495600_0008900
1293 Ga0495581_0002779
1294 Ga0495581_0016664
1295 Ga0495581_0017412
1296 Ga0495604_0004649
1297 Ga0495604_0066928
1298 Ga0495636_0094084
1299 Ga0495674_0037966
1300 Ga0495674_0394221
1301 Ga0495680_0002412
1302 Ga0495680_0067749
1303 Ga0495680_0077361
1304 Ga0495680_0097171
1305 Ga0495680_0140254
1306 Ga0495684_0001455
1307 Ga0495684_0006352
1308 Ga0495684_0057913
1309 Ga0495593_0132638
1310 Ga0495602_0020610
1311 Ga0496100_0184288
1312 Ga0496100_0215987
1313 Ga0496101_0053525
1314 Ga0496102_0040905
1315 Ga0496102_0241297
1316 Ga0496103_0003284
1317 Ga0496103_0124020
1318 Ga0496104_0001721
1319 Ga0496104_0033128
1320 Ga0496105_0055616
1321 Ga0496105_0068225
1322 Ga0496105_0202059
1323 Ga0496106_0065503
1324 Ga0496107_0078908
1325 Ga0496108_0007777
1326 Ga0496108_0024190
1327 Ga0496109_0013517
1328 Ga0496109_0017024
1329 Ga0496110_0027482
1330 Ga0496110_0035007
1331 Ga0496110_0236813
1332 Ga0496110_0338849
1333 Ga0496111_0012569
1334 Ga0496111_0014685
1335 Ga0496111_0081736
1336 Ga0496112_0035658
1337 Ga0496112_0058371
1338 Ga0496112_0195651
1339 Ga0496113_0007893
1340 Ga0496113_0015873
1341 Ga0496114_0415731
1342 Ga0496115_0060982
1343 Ga0501031_0009445
1344 Ga0501033_0099054
1345 Ga0501034_0085671
1346 Ga0501036_0018498
1347 Ga0501037_0025496
1348 Ga0501038_0004126
1349 Ga0501040_0000516
1350 Ga0501042_0032023
1351 Ga0501043_0050324
1352 Ga0501047_0373288
1353 Ga0501048_0002443
1354 Ga0501068_0010985
1355 Ga0501068_0048543
1356 Ga0501070_0067409
1357 Ga0501071_0006270
1358 Ga0501072_0005443
1359 Ga0501073_0063269
1360 Ga0501074_0013512
1361 Ga0501075_0000981
1362 Ga0501080_0043524
1363 Ga0501081_0001540
1364 Ga0501083_0016500
1365 Ga0501035_0022881
1366 Ga0501035_0065319
1367 Ga0501045_0006456
1368 nmdc:mga05p37_14029_c1
1369 nmdc:mga05p37_197943_c1
1370 nmdc:mga05p37_294504_c1
1371 nmdc:mga05p37_358965_c1
1372 nmdc:mga05p37_391241_c1
1373 nmdc:mga05p37_556215_c1
1374 nmdc:mga05p37_79281_c1
1375 nmdc:mga05p37_92144_c1
1376 nmdc:mga09592_132951_c1
1377 nmdc:mga09592_191214_c1
1378 nmdc:mga09592_46071_c1
1379 nmdc:mga0qj67_147683_c1
1380 nmdc:mga0qj67_17678_c1
1381 nmdc:mga0qj67_2737_c1
1382 nmdc:mga06r32_142190_c1
1383 nmdc:mga06r32_14520_c1
1384 nmdc:mga06r32_30259_c1
1385 nmdc:mga06r32_393893_c1
1386 nmdc:mga06r32_44285_c1
1387 nmdc:mga06r32_503899_c1
1388 nmdc:mga06r32_57630_c1
1389 nmdc:mga06r32_82201_c1
1390 nmdc:mga08y16_18172_c1
1391 nmdc:mga08y16_63887_c1
1392 nmdc:mga08y16_6894_c1
1393 nmdc:mga08y16_76826_c1
1394 nmdc:mga08y16_92902_c1
1395 nmdc:mga0n895_422169_c1
1396 nmdc:mga0n895_83624_c1
1397 nmdc:mga0rr50_107561_c1
1398 nmdc:mga0rr50_133781_c1
1399 nmdc:mga0a205_17867_c1
1400 nmdc:mga0a205_187512_c1
1401 nmdc:mga0a205_39041_c1
1402 nmdc:mga0a205_47028_c1
1403 nmdc:mga0a205_51655_c1
1404 Ga0495595_0056679
1405 Ga0495619_0008571
1406 Ga0495619_0040365
1407 Ga0500583_0002885
1408 Ga0500583_0006310
1409 Ga0500604_0006207
1410 Ga0590071_020568
1411 Ga0590075_029958
1412 Ga0501082_0003197
1413 Ga0530510_0009041
1414 2842042937
1415 2842050978
1416 2913917676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17991

Thioredoxin_10

Thioredoxin like C-terminal domain

205

351

0.99

PF00578

AhpC-TSA

AhpC/TSA family

46

156

0.92

PF08534

Redoxin

Redoxin

45

170

0.9

PF13905

Thioredoxin_8

Thioredoxin-like

58

153

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b5y-assembly1.cif.gz_A solution structure of a thioredoxin-like protein in the oxidized form 0.9034 48 180
1st9-assembly2.cif.gz_B crystal structure of a soluble domain of resa in the oxidised form 0.8949 47 177
4nmu-assembly2.cif.gz_B crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor' 0.893 59 177
2l5o-assembly1.cif.gz_A solution structure of a putative thioredoxin from neisseria meningitidis 0.8864 47 184
3ios-assembly1.cif.gz_A structure of mtb dsbf in its mixed oxidized and reduced forms 0.8736 38 177
ID Description Score Start End Superfamily
af_Q8VZ10_367_538_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9741 49 179 3.40.30.10
af_P9WG63_364_563_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9576 47 181 3.40.30.10
af_Q9W5T4_48_199_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9493 49 179 3.40.30.10
2b5yA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9034 48 180 3.40.30.10
3lorC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8895 47 179 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A317GW75-F1-model_v4 Thioredoxin 0.9927 142 355
AF-A0A1L3EPS0-F1-model_v4 Thioredoxin domain-containing protein 0.9911 42 355 GO:0016209
GO:0016491
AF-A0A663BPD0-F1-model_v4 deleted 0.9907 47 182
AF-A0A1Q7HR70-F1-model_v4 Thioredoxin 0.9906 47 179 GO:0016209
GO:0016491
AF-A0A2V8IK74-F1-model_v4 DipZ thioredoxin-like C-terminal domain-containing protein 0.9903 270 355

Map