F476550

General Info

Members Datasets Scaffolds Average Seq Length
707 336 1414 135

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10377888|Ga0207700_103778883
Length 161
Sequence MQVRDGMSQIVLQVGPGHTLREAARQMSERKVGAAVVHDPDAPGPGIITERDILNAVGSGVDPDAAMVEAHTTGRGLVFAAPDWSLEEAAAAMVRGAFRHLIVVEAGEITGILAMRDIVRCWTDDGAICDVPESAAGPGPQALAATSRTRMVKLTSAAVSV

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
192 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
232 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
293 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
321 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
322 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
323 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
324 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
325 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
326 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
330 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 2506783011 Frankia datiscae Dg1 Isolate Nodule
335 2773857922 Frankia sp. CcI49 Isolate Nodule
336 2773857933 Frankia sp. BMG5.30 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 2.83
Isolates 0.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0.42
Rhizoplane 8.35
Rhizosphere 88.83
Stem 0
Stem Tuber 0
Unclassified 5.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10377888 3300025928 Bacteria 1238
2 JGI25406J46586_10124702 3300003203 Archaea 757
3 JGI25406J46586_10137318 3300003203 Bacteria 716
4 JGI25407J50210_10002128 3300003373 Bacteria 4622
5 JGI25407J50210_10003335 3300003373 Bacteria 3830
6 JGI25407J50210_10005156 3300003373 Bacteria 3203
7 JGI25407J50210_10161874 3300003373 Bacteria 551
8 Ga0070676_10507321 3300005328 Bacteria 857
9 Ga0070683_100010508 3300005329 Bacteria 7959
10 Ga0070683_100319918 3300005329 Bacteria 1477
11 Ga0070683_101597382 3300005329 Bacteria 627
12 Ga0070670_102224089 3300005331 Bacteria 505
13 Ga0068869_100349564 3300005334 Bacteria 1205
14 Ga0070680_100128585 3300005336 Unclassified 2118
15 Ga0070680_100863593 3300005336 Bacteria 780
16 Ga0070682_100094966 3300005337 Bacteria 1957
17 Ga0068868_100101847 3300005338 Bacteria 2324
18 Ga0070660_100099291 3300005339 Bacteria 2305
19 Ga0070660_100306273 3300005339 Bacteria 1303
20 Ga0070689_100180511 3300005340 Bacteria 1714
21 Ga0070691_10092153 3300005341 Bacteria 1495
22 Ga0070691_10245535 3300005341 Bacteria 958
23 Ga0070691_10351471 3300005341 Bacteria 819
24 Ga0070687_100147964 3300005343 Bacteria 1375
25 Ga0070668_100044675 3300005347 Bacteria 3398
26 Ga0070669_100901977 3300005353 Bacteria 755
27 Ga0070675_100152345 3300005354 Bacteria 1983
28 Ga0070673_101806614 3300005364 Bacteria 579
29 Ga0070688_100710711 3300005365 Bacteria 779
30 Ga0070659_100660941 3300005366 Bacteria 901
31 Ga0070703_10289707 3300005406 Bacteria 679
32 Ga0070703_10468946 3300005406 Bacteria 561
33 Ga0070709_10000333 3300005434 Bacteria 29686
34 Ga0070709_10207732 3300005434 Bacteria 1390
35 Ga0070714_100001680 3300005435 Bacteria 16088
36 Ga0070714_101307073 3300005435 Unclassified 708
37 Ga0070713_100002308 3300005436 Bacteria 12414
38 Ga0070713_100303483 3300005436 Bacteria 1470
39 Ga0070713_100308739 3300005436 Bacteria 1458
40 Ga0070710_10000287 3300005437 Bacteria 23880
41 Ga0070701_10038618 3300005438 Bacteria 2417
42 Ga0070701_10244287 3300005438 Bacteria 1081
43 Ga0070701_10446385 3300005438 Bacteria 829
44 Ga0070711_100003986 3300005439 Bacteria 8680
45 Ga0070711_100004497 3300005439 Bacteria 8240
46 Ga0070705_100958905 3300005440 Bacteria 692
47 Ga0070700_100026758 3300005441 Bacteria 3411
48 Ga0070700_100075533 3300005441 Bacteria 2161
49 Ga0070700_100365618 3300005441 Bacteria 1074
50 Ga0070694_100574813 3300005444 Bacteria 905
51 Ga0070694_100811652 3300005444 Bacteria 768
52 Ga0070663_100124134 3300005455 Bacteria 1954
53 Ga0070662_100582655 3300005457 Bacteria 940
54 Ga0070681_10094631 3300005458 Bacteria 2936
55 Ga0070681_11300027 3300005458 Bacteria 650
56 Ga0070679_100058362 3300005530 Bacteria 3845
57 Ga0070679_100129117 3300005530 Bacteria 2509
58 Ga0070679_100587573 3300005530 Bacteria 1057
59 Ga0070679_102116189 3300005530 Unclassified 512
60 Ga0070684_100046773 3300005535 Bacteria 3749
61 Ga0070684_101146570 3300005535 Bacteria 731
62 Ga0068853_101376555 3300005539 Bacteria 682
63 Ga0068853_102151707 3300005539 Bacteria 541
64 Ga0070695_100192983 3300005545 Unclassified 1451
65 Ga0070695_101030181 3300005545 Bacteria 671
66 Ga0070695_101304087 3300005545 Bacteria 600
67 Ga0070696_100290076 3300005546 Bacteria 1250
68 Ga0070693_100147204 3300005547 Bacteria 1488
69 Ga0070693_100622139 3300005547 Bacteria 782
70 Ga0070665_100330602 3300005548 Bacteria 1529
71 Ga0070704_100555703 3300005549 Bacteria 1004
72 Ga0070704_100609762 3300005549 Bacteria 960
73 Ga0070704_100621005 3300005549 Bacteria 952
74 Ga0068855_100281110 3300005563 Bacteria 1848
75 Ga0070664_100140688 3300005564 Bacteria 2125
76 Ga0070664_101233078 3300005564 Bacteria 706
77 Ga0068857_100379212 3300005577 Unclassified 1313
78 Ga0068854_100065693 3300005578 Bacteria 2638
79 Ga0068854_100216621 3300005578 Bacteria 1513
80 Ga0068854_100310755 3300005578 Bacteria 1278
81 Ga0068854_100553605 3300005578 Bacteria 976
82 Ga0068856_100057386 3300005614 Bacteria 3843
83 Ga0068856_100118189 3300005614 Bacteria 2652
84 Ga0068856_100365513 3300005614 Bacteria 1461
85 Ga0068852_101505984 3300005616 Bacteria 695
86 Ga0068852_101896221 3300005616 Bacteria 618
87 Ga0068859_100504085 3300005617 Bacteria 1305
88 Ga0068864_100023513 3300005618 Bacteria 5176
89 Ga0068861_100008130 3300005719 Bacteria 7218
90 Ga0068851_10375409 3300005834 Bacteria 832
91 Ga0068862_100174734 3300005844 Bacteria 1925
92 Ga0068862_101351190 3300005844 Bacteria 715
93 Ga0081455_10011139 3300005937 Bacteria 9050
94 Ga0081455_10067881 3300005937 Bacteria 2970
95 Ga0081455_10351570 3300005937 Bacteria 1039
96 Ga0081538_10000018 3300005981 Bacteria 143542
97 Ga0081538_10000146 3300005981 Bacteria 73599
98 Ga0081538_10000173 3300005981 Bacteria 69480
99 Ga0081538_10000881 3300005981 Bacteria 32414
100 Ga0081538_10001026 3300005981 Bacteria 29811
101 Ga0081538_10001651 3300005981 Bacteria 22862
102 Ga0081538_10010274 3300005981 Bacteria 7688
103 Ga0081538_10015533 3300005981 Bacteria 5887
104 Ga0081538_10031166 3300005981 Bacteria 3604
105 Ga0081538_10039802 3300005981 Bacteria 3009
106 Ga0081538_10057228 3300005981 Bacteria 2275
107 Ga0081538_10148454 3300005981 Bacteria 1067
108 Ga0081538_10156485 3300005981 Bacteria 1021
109 Ga0081540_1000221 3300005983 Bacteria 59958
110 Ga0081540_1046537 3300005983 Bacteria 2189
111 Ga0081540_1217260 3300005983 Bacteria 683
112 Ga0081539_10003461 3300005985 Bacteria 19333
113 Ga0081539_10032928 3300005985 Bacteria 3165
114 Ga0081539_10046060 3300005985 Bacteria 2502
115 Ga0070717_10015612 3300006028 Bacteria 5869
116 Ga0075365_10330597 3300006038 Archaea 1073
117 Ga0075365_10525085 3300006038 Bacteria 837
118 Ga0075365_10636010 3300006038 Bacteria 754
119 Ga0075363_100343499 3300006048 Bacteria 871
120 Ga0075432_10004169 3300006058 Bacteria 4925
121 Ga0075432_10154805 3300006058 Bacteria 883
122 Ga0075432_10590121 3300006058 Bacteria 507
123 Ga0070715_10004804 3300006163 Bacteria 4472
124 Ga0070716_100000183 3300006173 Bacteria 24682
125 Ga0070712_100032265 3300006175 Bacteria 3535
126 Ga0070712_101207009 3300006175 Unclassified 658
127 Ga0075428_100040729 3300006844 Bacteria 5110
128 Ga0075428_100074774 3300006844 Bacteria 3701
129 Ga0075428_100126274 3300006844 Bacteria 2784
130 Ga0075428_100324303 3300006844 Bacteria 1655
131 Ga0075428_100329713 3300006844 Unclassified 1640
132 Ga0075430_100000846 3300006846 Bacteria 24008
133 Ga0075430_100010488 3300006846 Bacteria 7845
134 Ga0075430_100213803 3300006846 Bacteria 1600
135 Ga0075430_100432982 3300006846 Bacteria 1086
136 Ga0075430_100707073 3300006846 Unclassified 831
137 Ga0075431_100002442 3300006847 Bacteria 17884
138 Ga0075431_100013385 3300006847 Bacteria 8289
139 Ga0075431_100519206 3300006847 Bacteria 1181
140 Ga0075431_100764373 3300006847 Bacteria 941
141 Ga0075433_10217151 3300006852 Bacteria 1699
142 Ga0075433_10425752 3300006852 Bacteria 1171
143 Ga0075434_100364841 3300006871 Bacteria 1465
144 Ga0075434_100391820 3300006871 Bacteria 1410
145 Ga0075434_100509847 3300006871 Bacteria 1223
146 Ga0075429_100064780 3300006880 Bacteria 3182
147 Ga0075429_100200201 3300006880 Bacteria 1750
148 Ga0075429_100252404 3300006880 Bacteria 1545
149 Ga0075429_100275222 3300006880 Bacteria 1474
150 Ga0075436_100642426 3300006914 Bacteria 783
151 Ga0075436_100748075 3300006914 Unclassified 726
152 Ga0097620_100504060 3300006931 Bacteria 1305
153 Ga0075435_100054136 3300007076 Bacteria 3238
154 Ga0105240_11504003 3300009093 Bacteria 706
155 Ga0111539_10063041 3300009094 Bacteria 4387
156 Ga0111539_10092646 3300009094 Bacteria 3550
157 Ga0111539_10743805 3300009094 Bacteria 1141
158 Ga0111539_10835524 3300009094 Bacteria 1072
159 Ga0111539_11095397 3300009094 Unclassified 926
160 Ga0105245_10000909 3300009098 Bacteria 26907
161 Ga0105245_10116789 3300009098 Bacteria 2488
162 Ga0105245_10377515 3300009098 Bacteria 1411
163 Ga0105245_11591188 3300009098 Bacteria 705
164 Ga0105245_12793473 3300009098 Bacteria 541
165 Ga0105245_13095259 3300009098 Unclassified 515
166 Ga0105247_11762387 3300009101 Bacteria 514
167 Ga0114129_10000969 3300009147 Bacteria 37546
168 Ga0114129_10018327 3300009147 Bacteria 9973
169 Ga0114129_10198496 3300009147 Bacteria 2719
170 Ga0114129_10236919 3300009147 Bacteria 2455
171 Ga0114129_10259036 3300009147 Bacteria 2332
172 Ga0114129_10273022 3300009147 Bacteria 2261
173 Ga0114129_10429294 3300009147 Unclassified 1736
174 Ga0114129_10655129 3300009147 Bacteria 1355
175 Ga0114129_10852422 3300009147 Bacteria 1158
176 Ga0114129_11306271 3300009147 Bacteria 899
177 Ga0114129_12652854 3300009147 Unclassified 597
178 Ga0114129_13485198 3300009147 Bacteria 503
179 Ga0105241_10019996 3300009174 Bacteria 4943
180 Ga0105241_10485561 3300009174 Bacteria 1099
181 Ga0105242_10115789 3300009176 Bacteria 2292
182 Ga0105242_10745402 3300009176 Bacteria 963
183 Ga0105242_11726768 3300009176 Bacteria 663
184 Ga0105237_10811666 3300009545 Bacteria 942
185 Ga0105249_10054968 3300009553 Bacteria 3641
186 Ga0105249_10718160 3300009553 Bacteria 1060
187 Ga0105239_10060090 3300010375 Bacteria 4171
188 Ga0105239_10149637 3300010375 Bacteria 2605
189 Ga0105239_10803179 3300010375 Bacteria 1078
190 Ga0105246_10232536 3300011119 Bacteria 1452
191 Ga0157371_10362149 3300013102 Bacteria 1057
192 Ga0157371_10504261 3300013102 Bacteria 894
193 Ga0157369_10514717 3300013105 Bacteria 1238
194 Ga0157369_12135650 3300013105 Bacteria 568
195 Ga0157369_12570828 3300013105 Bacteria 515
196 Ga0157374_10079323 3300013296 Bacteria 3111
197 Ga0163162_10225976 3300013306 Unclassified 2001
198 Ga0163162_10650328 3300013306 Bacteria 1178
199 Ga0157372_10131143 3300013307 Bacteria 2884
200 Ga0157372_10240781 3300013307 Bacteria 2099
201 Ga0157372_10682701 3300013307 Bacteria 1195
202 Ga0157372_11036695 3300013307 Bacteria 950
203 Ga0163163_10021565 3300014325 Bacteria 6082
204 Ga0163163_10599353 3300014325 Bacteria 1165
205 Ga0157380_10842836 3300014326 Bacteria 938
206 Ga0157377_10015759 3300014745 Bacteria 3874
207 Ga0157379_10532400 3300014968 Bacteria 1092
208 Ga0163161_10085709 3300017792 Bacteria 2324
209 Ga0163161_11442367 3300017792 Bacteria 602
210 Ga0197907_11064785 3300020069 Bacteria 593
211 Ga0197907_11080574 3300020069 Bacteria 763
212 Ga0206356_10274653 3300020070 Bacteria 723
213 Ga0206356_10348789 3300020070 Unclassified 554
214 Ga0206356_11159634 3300020070 Unclassified 1260
215 Ga0206351_10683145 3300020077 Bacteria 724
216 Ga0206352_10641722 3300020078 Bacteria 562
217 Ga0206350_11432032 3300020080 Bacteria 709
218 Ga0206354_10347671 3300020081 Bacteria 523
219 Ga0206354_11454795 3300020081 Unclassified 616
220 Ga0206353_10070912 3300020082 Bacteria 691
221 Ga0206353_10449245 3300020082 Unclassified 1636
222 Ga0206353_10466835 3300020082 Bacteria 1279
223 Ga0206353_10817488 3300020082 Bacteria 1003
224 Ga0206353_11879009 3300020082 Unclassified 1615
225 Ga0213873_10038197 3300021358 Bacteria 1226
226 Ga0213875_10000050 3300021388 Bacteria 143822
227 Ga0224712_10120942 3300022467 Unclassified 1134
228 Ga0224712_10145582 3300022467 Bacteria 1046
229 Ga0224712_10300003 3300022467 Bacteria 751
230 Ga0224712_10639786 3300022467 Bacteria 521
231 Ga0207692_10000205 3300025898 Bacteria 19845
232 Ga0207642_10838284 3300025899 Bacteria 586
233 Ga0207688_10032176 3300025901 Bacteria 2898
234 Ga0207699_10000447 3300025906 Bacteria 21142
235 Ga0207645_10221102 3300025907 Bacteria 1248
236 Ga0207654_10051875 3300025911 Bacteria 2362
237 Ga0207707_10523351 3300025912 Bacteria 1010
238 Ga0207707_11060528 3300025912 Unclassified 662
239 Ga0207707_11085409 3300025912 Bacteria 653
240 Ga0207693_10025126 3300025915 Bacteria 4725
241 Ga0207663_10002562 3300025916 Bacteria 8737
242 Ga0207663_10004635 3300025916 Bacteria 6854
243 Ga0207657_10352260 3300025919 Bacteria 1161
244 Ga0207657_10451693 3300025919 Bacteria 1008
245 Ga0207649_10896893 3300025920 Bacteria 695
246 Ga0207652_10152634 3300025921 Bacteria 2068
247 Ga0207652_10256587 3300025921 Bacteria 1577
248 Ga0207652_10428733 3300025921 Bacteria 1192
249 Ga0207687_10022468 3300025927 Bacteria 4198
250 Ga0207687_11040103 3300025927 Bacteria 703
251 Ga0207700_10000922 3300025928 Bacteria 16870
252 Ga0207700_10123166 3300025928 Bacteria 2105
253 Ga0207664_10000435 3300025929 Bacteria 29855
254 Ga0207664_10113961 3300025929 Bacteria 2252
255 Ga0207706_10002965 3300025933 Bacteria 16376
256 Ga0207706_10010816 3300025933 Bacteria 8325
257 Ga0207706_10121852 3300025933 Bacteria 2293
258 Ga0207686_10351901 3300025934 Bacteria 1109
259 Ga0207670_10265859 3300025936 Bacteria 1331
260 Ga0207665_10000283 3300025939 Bacteria 35248
261 Ga0207665_10771905 3300025939 Bacteria 758
262 Ga0207689_10036980 3300025942 Bacteria 4052
263 Ga0207661_10033521 3300025944 Bacteria 3987
264 Ga0207661_10089487 3300025944 Unclassified 2561
265 Ga0207661_10587574 3300025944 Bacteria 1022
266 Ga0207661_10594750 3300025944 Bacteria 1015
267 Ga0207679_10235322 3300025945 Bacteria 1549
268 Ga0207679_10502641 3300025945 Bacteria 1082
269 Ga0207679_11393699 3300025945 Bacteria 643
270 Ga0207667_11298428 3300025949 Bacteria 704
271 Ga0207651_11279234 3300025960 Bacteria 659
272 Ga0207712_10155751 3300025961 Bacteria 1770
273 Ga0207712_10427920 3300025961 Bacteria 1118
274 Ga0207668_10014910 3300025972 Archaea 4820
275 Ga0207668_11057298 3300025972 Bacteria 727
276 Ga0207668_11916753 3300025972 Bacteria 534
277 Ga0207640_10054122 3300025981 Bacteria 2623
278 Ga0207640_10108743 3300025981 Bacteria 1960
279 Ga0207640_10130788 3300025981 Bacteria 1814
280 Ga0207640_11085914 3300025981 Bacteria 707
281 Ga0207677_10037868 3300026023 Bacteria 3156
282 Ga0207639_11409843 3300026041 Bacteria 654
283 Ga0207678_10036354 3300026067 Bacteria 4287
284 Ga0207708_10002526 3300026075 Bacteria 13458
285 Ga0207708_10078537 3300026075 Bacteria 2534
286 Ga0207708_10214123 3300026075 Bacteria 1541
287 Ga0207708_11146487 3300026075 Bacteria 679
288 Ga0207702_10109484 3300026078 Bacteria 2453
289 Ga0207702_10157415 3300026078 Bacteria 2072
290 Ga0207702_10347306 3300026078 Bacteria 1419
291 Ga0207702_11621231 3300026078 Bacteria 640
292 Ga0207641_11886458 3300026088 Bacteria 599
293 Ga0207676_10132405 3300026095 Bacteria 2122
294 Ga0207674_10352405 3300026116 Unclassified 1423
295 Ga0207675_100046076 3300026118 Bacteria 4073
296 Ga0207675_101054585 3300026118 Bacteria 832
297 Ga0207698_11255475 3300026142 Bacteria 755
298 Ga0207698_11651615 3300026142 Bacteria 656
299 Ga0207428_10015559 3300027907 Bacteria 6576
300 Ga0207428_10132199 3300027907 Bacteria 1909
301 Ga0207428_10150234 3300027907 Unclassified 1773
302 Ga0207428_10153353 3300027907 Bacteria 1753
303 Ga0268266_10410487 3300028379 Bacteria 1282
304 Ga0268265_10091913 3300028380 Bacteria 2428
305 Ga0268265_10535351 3300028380 Bacteria 1110
306 Ga0268264_11483312 3300028381 Bacteria 689
307 Ga0265338_10288188 3300028800 Bacteria 1197
308 Ga0265777_122737 3300030877 Unclassified 526
309 Ga0265327_10026990 3300031251 Bacteria 3314
310 Ga0307408_100038810 3300031548 Bacteria 3362
311 Ga0307408_100280542 3300031548 Bacteria 1387
312 Ga0307408_100918383 3300031548 Bacteria 802
313 Ga0307408_101585017 3300031548 Bacteria 621
314 Ga0307405_10010442 3300031731 Bacteria 4813
315 Ga0307405_10200022 3300031731 Bacteria 1450
316 Ga0307405_10354196 3300031731 Bacteria 1133
317 Ga0307405_11493800 3300031731 Bacteria 593
318 Ga0307413_10056270 3300031824 Bacteria 2398
319 Ga0307413_10271171 3300031824 Bacteria 1270
320 Ga0307413_10380706 3300031824 Bacteria 1099
321 Ga0307413_10523268 3300031824 Unclassified 957
322 Ga0307413_10828415 3300031824 Bacteria 780
323 Ga0307413_10828490 3300031824 Bacteria 780
324 Ga0307410_10026257 3300031852 Bacteria 3664
325 Ga0307410_10043525 3300031852 Bacteria 2976
326 Ga0307410_10266356 3300031852 Bacteria 1338
327 Ga0307410_10363973 3300031852 Bacteria 1159
328 Ga0307406_10010417 3300031901 Bacteria 5242
329 Ga0307406_10012278 3300031901 Bacteria 4884
330 Ga0307406_10094245 3300031901 Bacteria 2023
331 Ga0307406_10108416 3300031901 Bacteria 1907
332 Ga0307406_10170505 3300031901 Bacteria 1574
333 Ga0307406_10262729 3300031901 Bacteria 1307
334 Ga0307406_10322275 3300031901 Bacteria 1196
335 Ga0307406_10565731 3300031901 Bacteria 932
336 Ga0307406_10586367 3300031901 Bacteria 917
337 Ga0307407_10052243 3300031903 Bacteria 2346
338 Ga0307407_10060915 3300031903 Bacteria 2204
339 Ga0307412_10524470 3300031911 Bacteria 990
340 Ga0307412_10792424 3300031911 Bacteria 822
341 Ga0307409_100021357 3300031995 Bacteria 4436
342 Ga0307409_100100228 3300031995 Bacteria 2400
343 Ga0307409_100182437 3300031995 Bacteria 1859
344 Ga0307409_100259040 3300031995 Unclassified 1595
345 Ga0307409_100281418 3300031995 Bacteria 1537
346 Ga0307409_100400030 3300031995 Bacteria 1311
347 Ga0307409_100733497 3300031995 Bacteria 990
348 Ga0307409_101531957 3300031995 Bacteria 694
349 Ga0307416_100029928 3300032002 Bacteria 4077
350 Ga0307416_100066753 3300032002 Bacteria 2963
351 Ga0307416_100098005 3300032002 Bacteria 2541
352 Ga0307416_100450455 3300032002 Bacteria 1339
353 Ga0307416_100458230 3300032002 Bacteria 1329
354 Ga0307416_100634386 3300032002 Bacteria 1152
355 Ga0307416_101200240 3300032002 Bacteria 864
356 Ga0307416_102653546 3300032002 Bacteria 598
357 Ga0307416_103457409 3300032002 Bacteria 528
358 Ga0307414_10054683 3300032004 Bacteria 2791
359 Ga0307414_10287889 3300032004 Bacteria 1384
360 Ga0307414_10299304 3300032004 Bacteria 1360
361 Ga0307414_11277486 3300032004 Bacteria 681
362 Ga0307411_10168149 3300032005 Bacteria 1650
363 Ga0307411_10276461 3300032005 Bacteria 1334
364 Ga0307411_10425397 3300032005 Bacteria 1104
365 Ga0307411_11869791 3300032005 Bacteria 558
366 Ga0307415_100007898 3300032126 Bacteria 5856
367 Ga0307415_100087647 3300032126 Bacteria 2243
368 Ga0307415_100117783 3300032126 Bacteria 1984
369 Ga0307415_100203110 3300032126 Bacteria 1574
370 Ga0307415_100809253 3300032126 Unclassified 856
371 Ga0307415_102331749 3300032126 Bacteria 525
372 Ga0316214_1052885 3300033545 Bacteria 590
373 Ga0373929_0041531 3300035085 Bacteria 1023
374 Ga0373934_0003462 3300035086 Bacteria 5788
375 Ga0373940_0337009 3300035088 Bacteria 526
376 Ga0373949_0068073 3300035090 Bacteria 928
377 Ga0373923_0000246 3300035111 Bacteria 11595
378 Ga0373936_0001067 3300035113 Bacteria 9822
379 Ga0373945_0000087 3300035116 Bacteria 21445
380 Ga0373953_0194113 3300035117 Bacteria 877
381 Ga0373954_0027395 3300035118 Bacteria 2615
382 Ga0373957_0079665 3300035120 Bacteria 1291
383 Ga0373960_0189156 3300035121 Bacteria 722
384 Ga0373943_0026225 3300035170 Bacteria 2729
385 Ga0373946_0001667 3300035171 Bacteria 7732
386 Ga0373955_0071957 3300035172 Bacteria 1935
387 Ga0373955_0187263 3300035172 Bacteria 1229
388 Ga0373961_0136708 3300035241 Bacteria 825
389 Ga0373924_0014317 3300035410 Bacteria 2995
390 Ga0373931_0060805 3300035691 Bacteria 2035
391 Ga0373935_0045363 3300035692 Bacteria 2773
392 Ga0373927_0003461 3300035695 Bacteria 11307
393 Ga0373933_0219459 3300035724 Bacteria 1219
394 Ga0373947_0001748 3300035725 Bacteria 13284
395 Ga0373947_1109276 3300035725 Bacteria 539
396 Ga0373925_0021468 3300037068 Bacteria 4704
397 Ga0395900_0149575 3300037418 Bacteria 2386
398 Ga0395900_0811774 3300037418 Bacteria 863
399 Ga0395898_0024449 3300037466 Bacteria 6094
400 Ga0395898_0044851 3300037466 Bacteria 4349
401 Ga0395898_0165913 3300037466 Bacteria 2112
402 Ga0395898_0204971 3300037466 Bacteria 1882
403 Ga0395898_0362164 3300037466 Bacteria 1383
404 Ga0395898_0520887 3300037466 Bacteria 1130
405 Ga0395898_0672870 3300037466 Bacteria 977
406 Ga0395905_0887891 3300037471 Bacteria 794
407 Ga0436364_0750607 3300037853 Bacteria 104121
408 Ga0395901_0058272 3300038443 Bacteria 4018
409 Ga0395901_0117301 3300038443 Bacteria 2797
410 Ga0395901_0207916 3300038443 Bacteria 2049
411 Ga0395901_0231886 3300038443 Bacteria 1927
412 Ga0395901_0412151 3300038443 Bacteria 1387
413 Ga0395901_0451664 3300038443 Unclassified 1314
414 Ga0395901_1297012 3300038443 Bacteria 690
415 Ga0395901_1828290 3300038443 Bacteria 556
416 Ga0436365_0077243 3300039437 Bacteria 819
417 Ga0436365_0651128 3300039437 Bacteria 995
418 Ga0436363_0299025 3300039450 Bacteria 600
419 Ga0436363_0533476 3300039450 Bacteria 2902
420 Ga0436363_0998335 3300039450 Bacteria 507
421 Ga0436362_0663754 3300039453 Bacteria 2580
422 Ga0439448_0098722 3300042005 Bacteria 991
423 Ga0439463_083442 3300042016 Bacteria 822
424 Ga0450915_007642 3300042119 Bacteria 710
425 Ga0439460_0201061 3300042461 Bacteria 679
426 Ga0439460_0251984 3300042461 Bacteria 610
427 Ga0439440_0152447 3300042993 Bacteria 663
428 Ga0466972_0209769 3300044658 Bacteria 912
429 Ga0466965_0481598 3300044683 Bacteria 694
430 Ga0466965_0792796 3300044683 Bacteria 548
431 Ga0466966_0035267 3300044684 Bacteria 3233
432 Ga0466963_0094142 3300044694 Bacteria 2043
433 Ga0466964_0044105 3300044706 Bacteria 1811
434 Ga0466964_0565149 3300044706 Bacteria 619
435 Ga0466964_0717694 3300044706 Bacteria 558
436 Ga0466968_0134169 3300044735 Bacteria 1128
437 Ga0466970_0054841 3300044765 Bacteria 2129
438 Ga0466957_0037489 3300044842 Bacteria 2919
439 Ga0466957_0224230 3300044842 Bacteria 1242
440 Ga0466960_0180039 3300044901 Bacteria 1145
441 Ga0466960_0457375 3300044901 Bacteria 743
442 Ga0466967_0007606 3300045976 Bacteria 7835
443 Ga0466967_0050467 3300045976 Bacteria 3643
444 Ga0466967_0056133 3300045976 Bacteria 3471
445 Ga0466967_0709185 3300045976 Bacteria 997
446 Ga0466967_0749613 3300045976 Bacteria 968
447 Ga0466967_1299335 3300045976 Unclassified 725
448 Ga0495592_0116460 3300046454 Bacteria 1885
449 Ga0495603_0004934 3300046455 Bacteria 7987
450 Ga0495603_0082671 3300046455 Bacteria 1881
451 Ga0495629_0001498 3300046459 Bacteria 18366
452 Ga0495641_0003379 3300046461 Bacteria 11974
453 Ga0495641_0323438 3300046461 Bacteria 696
454 Ga0495651_0219590 3300046462 Bacteria 1316
455 Ga0495653_0609041 3300046463 Bacteria 670
456 Ga0495582_0005033 3300046473 Bacteria 7407
457 Ga0495582_0055147 3300046473 Bacteria 2191
458 Ga0495639_0002154 3300046475 Bacteria 8686
459 Ga0495662_0000669 3300046476 Bacteria 16176
460 Ga0495664_0008356 3300046477 Bacteria 5773
461 Ga0495584_0019416 3300046491 Bacteria 3452
462 Ga0495584_0082075 3300046491 Bacteria 1623
463 Ga0495585_0143393 3300046492 Bacteria 1250
464 Ga0495594_0035549 3300046499 Bacteria 2714
465 Ga0495594_0411772 3300046499 Bacteria 769
466 Ga0495596_0092852 3300046500 Bacteria 1172
467 Ga0495607_0377311 3300046501 Bacteria 649
468 Ga0495608_0007436 3300046511 Bacteria 7738
469 Ga0495618_0002803 3300046514 Bacteria 11047
470 Ga0495628_0048354 3300046516 Bacteria 3371
471 Ga0495631_0264387 3300046518 Bacteria 733
472 Ga0495644_0092671 3300046523 Unclassified 1141
473 Ga0495666_0000704 3300046526 Bacteria 15192
474 Ga0495652_0082673 3300046529 Bacteria 2645
475 Ga0495665_0000926 3300046531 Bacteria 15462
476 Ga0495640_0009747 3300046533 Bacteria 7461
477 Ga0495586_0000603 3300046535 Bacteria 20817
478 Ga0495587_0021358 3300046536 Bacteria 3991
479 Ga0495609_0278883 3300046538 Bacteria 684
480 Ga0495597_0265375 3300046542 Bacteria 672
481 Ga0495645_0007935 3300046543 Bacteria 7387
482 Ga0495622_0093893 3300046557 Bacteria 1377
483 Ga0495667_0010574 3300046559 Bacteria 6244
484 Ga0495667_0343416 3300046559 Bacteria 943
485 Ga0495668_0080189 3300046616 Unclassified 1791
486 Ga0495668_0267119 3300046616 Bacteria 937
487 Ga0495634_0060071 3300046642 Bacteria 2530
488 Ga0495635_0006474 3300046663 Bacteria 8166
489 Ga0495588_0116388 3300046674 Bacteria 1409
490 Ga0495657_0082017 3300046675 Bacteria 2084
491 Ga0495599_0192946 3300046678 Bacteria 1252
492 Ga0495623_0033835 3300046679 Bacteria 3279
493 Ga0495646_0011062 3300046680 Bacteria 5731
494 Ga0495647_0003821 3300046681 Bacteria 4848
495 Ga0495658_0002808 3300046683 Bacteria 8747
496 Ga0495613_0010139 3300046689 Bacteria 6999
497 Ga0495624_0004956 3300046690 Bacteria 9649
498 Ga0495670_0499927 3300046691 Bacteria 660
499 Ga0495670_0793614 3300046691 Bacteria 517
500 Ga0495649_0465091 3300046694 Bacteria 631
501 Ga0495589_0104555 3300046794 Bacteria 1368
502 Ga0495589_0136537 3300046794 Bacteria 1176
503 Ga0495589_0384126 3300046794 Bacteria 645
504 Ga0495600_0008984 3300046809 Bacteria 6157
505 Ga0495581_0006600 3300047315 Bacteria 6722
506 Ga0495604_0022617 3300047317 Bacteria 5019
507 Ga0495674_0010877 3300047319 Bacteria 8603
508 Ga0495674_0312394 3300047319 Unclassified 1282
509 Ga0495674_0915306 3300047319 Bacteria 676
510 Ga0495672_0140301 3300047320 Bacteria 1263
511 Ga0495676_0005472 3300047321 Bacteria 11642
512 Ga0495680_0073660 3300047322 Bacteria 2594
513 Ga0495684_0145033 3300047471 Bacteria 1778
514 Ga0495593_0005721 3300047673 Bacteria 7336
515 Ga0495602_0379731 3300048088 Bacteria 1012
516 Ga0495614_0052306 3300048089 Bacteria 1750
517 Ga0496100_0009443 3300048903 Bacteria 5484
518 Ga0496100_0108748 3300048903 Bacteria 1923
519 Ga0496100_0136225 3300048903 Bacteria 1735
520 Ga0496101_0047047 3300048904 Bacteria 3096
521 Ga0496101_0358430 3300048904 Unclassified 1146
522 Ga0496102_0037257 3300048905 Bacteria 4386
523 Ga0496102_0064865 3300048905 Bacteria 3346
524 Ga0496102_0812145 3300048905 Bacteria 857
525 Ga0496102_1138484 3300048905 Bacteria 700
526 Ga0496103_0044435 3300048906 Bacteria 2738
527 Ga0496104_0085852 3300048907 Bacteria 3004
528 Ga0496104_0167178 3300048907 Bacteria 2109
529 Ga0496104_0263513 3300048907 Bacteria 1636
530 Ga0496104_0269165 3300048907 Bacteria 1616
531 Ga0496105_0021744 3300048908 Bacteria 5192
532 Ga0496105_0122686 3300048908 Bacteria 2142
533 Ga0496105_0211584 3300048908 Bacteria 1580
534 Ga0496105_0282814 3300048908 Bacteria 1337
535 Ga0496106_0012066 3300048909 Bacteria 6376
536 Ga0496106_0024075 3300048909 Bacteria 4526
537 Ga0496107_0033191 3300048910 Bacteria 3693
538 Ga0496107_0051807 3300048910 Bacteria 2961
539 Ga0496107_0184327 3300048910 Bacteria 1550
540 Ga0496108_0002123 3300048911 Bacteria 15883
541 Ga0496108_0035947 3300048911 Bacteria 4120
542 Ga0496108_0125574 3300048911 Bacteria 2202
543 Ga0496108_0294011 3300048911 Bacteria 1414
544 Ga0496108_0572689 3300048911 Bacteria 985
545 Ga0496109_0015861 3300048912 Bacteria 6577
546 Ga0496109_0033970 3300048912 Bacteria 4590
547 Ga0496109_0064680 3300048912 Bacteria 3347
548 Ga0496109_0409326 3300048912 Bacteria 1281
549 Ga0496109_0444682 3300048912 Bacteria 1224
550 Ga0496110_0000052 3300048913 Bacteria 58549
551 Ga0496110_0002112 3300048913 Bacteria 14835
552 Ga0496110_0039844 3300048913 Bacteria 4092
553 Ga0496110_0094443 3300048913 Bacteria 2678
554 Ga0496110_0458532 3300048913 Bacteria 1161
555 Ga0496110_0572291 3300048913 Bacteria 1026
556 Ga0496110_0788252 3300048913 Bacteria 854
557 Ga0496111_0000555 3300048914 Bacteria 19389
558 Ga0496111_0005704 3300048914 Bacteria 8021
559 Ga0496111_0066766 3300048914 Bacteria 2612
560 Ga0496111_0103278 3300048914 Bacteria 2096
561 Ga0496111_0563868 3300048914 Bacteria 835
562 Ga0496111_1147047 3300048914 Bacteria 552
563 Ga0496112_0067216 3300048915 Bacteria 3537
564 Ga0496112_0080530 3300048915 Bacteria 3220
565 Ga0496112_0156589 3300048915 Bacteria 2245
566 Ga0496112_0196300 3300048915 Bacteria 1979
567 Ga0496112_0537129 3300048915 Bacteria 1103
568 Ga0496113_0006224 3300048916 Bacteria 7539
569 Ga0496113_0014625 3300048916 Bacteria 5362
570 Ga0496113_0206774 3300048916 Bacteria 1561
571 Ga0496114_0078912 3300048917 Bacteria 2778
572 Ga0496114_0136659 3300048917 Bacteria 2120
573 Ga0496114_0425037 3300048917 Bacteria 1177
574 Ga0496115_0079392 3300048918 Bacteria 2671
575 Ga0496115_0487521 3300048918 Bacteria 992
576 Ga0501031_0198481 3300049568 Bacteria 1309
577 Ga0501031_0284775 3300049568 Bacteria 1072
578 Ga0501031_0567051 3300049568 Bacteria 731
579 Ga0501031_0734757 3300049568 Bacteria 633
580 Ga0501031_0832393 3300049568 Bacteria 591
581 Ga0501032_0007506 3300049569 Bacteria 7965
582 Ga0501032_0140331 3300049569 Bacteria 1591
583 Ga0501033_0007013 3300049570 Bacteria 8798
584 Ga0501036_0006816 3300049572 Bacteria 9280
585 Ga0501036_0108795 3300049572 Bacteria 2343
586 Ga0501036_0141675 3300049572 Bacteria 2029
587 Ga0501036_0266657 3300049572 Bacteria 1434
588 Ga0501036_0523687 3300049572 Bacteria 986
589 Ga0501036_0934133 3300049572 Bacteria 711
590 Ga0501036_1043213 3300049572 Bacteria 669
591 Ga0501037_0002318 3300049573 Bacteria 13753
592 Ga0501037_0080648 3300049573 Bacteria 2360
593 Ga0501038_0003190 3300049574 Bacteria 15290
594 Ga0501038_0003920 3300049574 Bacteria 13840
595 Ga0501038_0106159 3300049574 Bacteria 2332
596 Ga0501038_0995722 3300049574 Bacteria 616
597 Ga0501039_0031212 3300049575 Bacteria 4107
598 Ga0501039_0531532 3300049575 Bacteria 923
599 Ga0501040_0043957 3300049576 Bacteria 3045
600 Ga0501040_0124955 3300049576 Bacteria 1807
601 Ga0501040_0235973 3300049576 Bacteria 1303
602 Ga0501041_0119072 3300049577 Bacteria 1640
603 Ga0501041_0121416 3300049577 Bacteria 1624
604 Ga0501041_0894780 3300049577 Bacteria 570
605 Ga0501042_0118477 3300049578 Bacteria 1906
606 Ga0501042_0445998 3300049578 Bacteria 938
607 Ga0501043_0004934 3300049579 Bacteria 10786
608 Ga0501046_0045490 3300049580 Bacteria 3487
609 Ga0501046_0050968 3300049580 Bacteria 3268
610 Ga0501046_0191449 3300049580 Bacteria 1525
611 Ga0501047_0067940 3300049581 Bacteria 3433
612 Ga0501048_0029583 3300049582 Bacteria 3970
613 Ga0501048_0043275 3300049582 Bacteria 3224
614 Ga0501048_0743181 3300049582 Unclassified 705
615 Ga0501048_0936906 3300049582 Bacteria 623
616 Ga0501067_0017125 3300049583 Bacteria 4004
617 Ga0501067_0328342 3300049583 Bacteria 852
618 Ga0501068_0543914 3300049584 Bacteria 755
619 Ga0501069_0082274 3300049585 Bacteria 1814
620 Ga0501069_0155750 3300049585 Bacteria 1314
621 Ga0501069_0372863 3300049585 Bacteria 843
622 Ga0501070_0006234 3300049586 Bacteria 10150
623 Ga0501070_0061166 3300049586 Bacteria 3120
624 Ga0501071_0016959 3300049587 Bacteria 5013
625 Ga0501071_0408934 3300049587 Bacteria 1036
626 Ga0501071_0579222 3300049587 Bacteria 862
627 Ga0501071_0706340 3300049587 Bacteria 776
628 Ga0501072_0112750 3300049588 Bacteria 2165
629 Ga0501072_0206548 3300049588 Bacteria 1566
630 Ga0501072_0749092 3300049588 Bacteria 766
631 Ga0501073_0017096 3300049589 Bacteria 5253
632 Ga0501074_0010710 3300049590 Bacteria 6659
633 Ga0501074_0036482 3300049590 Bacteria 3561
634 Ga0501074_0329793 3300049590 Bacteria 1083
635 Ga0501075_0011558 3300049591 Bacteria 6250
636 Ga0501075_0310680 3300049591 Bacteria 1201
637 Ga0501076_0872185 3300049592 Bacteria 742
638 Ga0501077_0097642 3300049593 Bacteria 1862
639 Ga0501235_030180 3300049669 Bacteria 1222
640 Ga0501079_0044679 3300049741 Bacteria 3419
641 Ga0501079_1027238 3300049741 Bacteria 649
642 Ga0501080_0014659 3300049742 Bacteria 7218
643 Ga0501080_0044211 3300049742 Bacteria 4147
644 Ga0501081_0053865 3300049743 Bacteria 2778
645 Ga0501081_0180169 3300049743 Bacteria 1528
646 Ga0501083_0007723 3300049744 Bacteria 7624
647 Ga0501271_014251 3300049768 Bacteria 878
648 Ga0501035_0047969 3300049822 Bacteria 3831
649 Ga0501035_0715535 3300049822 Bacteria 806
650 Ga0501044_0108148 3300049823 Bacteria 2791
651 Ga0501044_0315981 3300049823 Bacteria 1487
652 Ga0501045_0017503 3300049824 Bacteria 5090
653 Ga0501045_0082773 3300049824 Bacteria 2367
654 Ga0501045_0359936 3300049824 Unclassified 1083
655 nmdc:mga0yw44_112876_c1 3300050492 Archaea 1266
656 nmdc:mga06z11_233821_c1 3300050494 Bacteria 1077
657 nmdc:mga05p37_139508_c1 3300050507 Bacteria 2970
658 nmdc:mga05p37_205218_c1 3300050507 Bacteria 2384
659 nmdc:mga05p37_239345_c1 3300050507 Bacteria 2183
660 nmdc:mga05p37_601_c1 3300050507 Bacteria 39708
661 nmdc:mga05p37_604416_c1 3300050507 Bacteria 1237
662 nmdc:mga05p37_9564_c1 3300050507 Bacteria 11480
663 nmdc:mga09592_224220_c1 3300050508 Bacteria 1628
664 nmdc:mga09592_79137_c1 3300050508 Bacteria 2798
665 nmdc:mga0qj67_102102_c1 3300050509 Bacteria 2312
666 nmdc:mga0qj67_129704_c1 3300050509 Bacteria 2042
667 nmdc:mga0qj67_134097_c1 3300050509 Bacteria 2006
668 nmdc:mga06r32_111328_c1 3300050510 Bacteria 2694
669 nmdc:mga06r32_364957_c1 3300050510 Bacteria 1428
670 nmdc:mga06r32_38489_c1 3300050510 Bacteria 4532
671 nmdc:mga06r32_677718_c1 3300050510 Bacteria 998
672 nmdc:mga08y16_1449708_c1 3300050511 Unclassified 648
673 nmdc:mga08y16_18952_c1 3300050511 Bacteria 7246
674 nmdc:mga08y16_79196_c1 3300050511 Bacteria 3425
675 nmdc:mga08y16_966740_c1 3300050511 Bacteria 834
676 nmdc:mga0n895_1715361_c1 3300050512 Bacteria 590
677 nmdc:mga0n895_280496_c1 3300050512 Bacteria 1690
678 nmdc:mga0n895_931123_c1 3300050512 Bacteria 853
679 nmdc:mga0rr50_102613_c1 3300050513 Bacteria 2250
680 nmdc:mga08x19_681633_c1 3300050514 Unclassified 729
681 nmdc:mga08x19_96970_c1 3300050514 Bacteria 1952
682 nmdc:mga0a205_162658_c1 3300050515 Bacteria 2128
683 nmdc:mga0a205_263494_c1 3300050515 Bacteria 1601
684 Ga0495601_0172078 3300053077 Bacteria 1415
685 Ga0495601_0418288 3300053077 Bacteria 868
686 Ga0495612_0000921 3300053078 Bacteria 12033
687 Ga0495655_0373097 3300053083 Bacteria 503
688 Ga0495595_0010474 3300053084 Bacteria 3854
689 Ga0495619_0000088 3300053085 Bacteria 69615
690 Ga0495619_0002822 3300053085 Bacteria 11314
691 Ga0500556_0000753 3300053104 Bacteria 19339
692 Ga0500616_0002548 3300053153 Bacteria 15019
693 Ga0500599_001910 3300053736 Bacteria 2464
694 Ga0501084_0085123 3300054114 Bacteria 2655
695 Ga0501084_0133045 3300054114 Bacteria 2094
696 Ga0501084_0144922 3300054114 Bacteria 2000
697 Ga0501084_0520786 3300054114 Bacteria 1005
698 Ga0501084_1249290 3300054114 Bacteria 623
699 Ga0501082_0010692 3300060353 Bacteria 7899
700 Ga0501082_0051149 3300060353 Bacteria 3561
701 Ga0501082_0176851 3300060353 Bacteria 1856
702 Ga0501082_0860560 3300060353 Bacteria 793
703 Ga0530510_0005859 3300061734 Bacteria 8515
704 Ga0530510_0402664 3300061734 Bacteria 1032
705 2506868316 2506783011 Bacteria 5323186
706 2774858119 2773857922 Bacteria 9757215
707 2774902702 2773857933 Bacteria 5818019
708 Ga0207700_10377888
709 JGI25406J46586_10124702
710 JGI25406J46586_10137318
711 JGI25407J50210_10002128
712 JGI25407J50210_10003335
713 JGI25407J50210_10005156
714 JGI25407J50210_10161874
715 Ga0070676_10507321
716 Ga0070683_100010508
717 Ga0070683_100319918
718 Ga0070683_101597382
719 Ga0070670_102224089
720 Ga0068869_100349564
721 Ga0070680_100128585
722 Ga0070680_100863593
723 Ga0070682_100094966
724 Ga0068868_100101847
725 Ga0070660_100099291
726 Ga0070660_100306273
727 Ga0070689_100180511
728 Ga0070691_10092153
729 Ga0070691_10245535
730 Ga0070691_10351471
731 Ga0070687_100147964
732 Ga0070668_100044675
733 Ga0070669_100901977
734 Ga0070675_100152345
735 Ga0070673_101806614
736 Ga0070688_100710711
737 Ga0070659_100660941
738 Ga0070703_10289707
739 Ga0070703_10468946
740 Ga0070709_10000333
741 Ga0070709_10207732
742 Ga0070714_100001680
743 Ga0070714_101307073
744 Ga0070713_100002308
745 Ga0070713_100303483
746 Ga0070713_100308739
747 Ga0070710_10000287
748 Ga0070701_10038618
749 Ga0070701_10244287
750 Ga0070701_10446385
751 Ga0070711_100003986
752 Ga0070711_100004497
753 Ga0070705_100958905
754 Ga0070700_100026758
755 Ga0070700_100075533
756 Ga0070700_100365618
757 Ga0070694_100574813
758 Ga0070694_100811652
759 Ga0070663_100124134
760 Ga0070662_100582655
761 Ga0070681_10094631
762 Ga0070681_11300027
763 Ga0070679_100058362
764 Ga0070679_100129117
765 Ga0070679_100587573
766 Ga0070679_102116189
767 Ga0070684_100046773
768 Ga0070684_101146570
769 Ga0068853_101376555
770 Ga0068853_102151707
771 Ga0070695_100192983
772 Ga0070695_101030181
773 Ga0070695_101304087
774 Ga0070696_100290076
775 Ga0070693_100147204
776 Ga0070693_100622139
777 Ga0070665_100330602
778 Ga0070704_100555703
779 Ga0070704_100609762
780 Ga0070704_100621005
781 Ga0068855_100281110
782 Ga0070664_100140688
783 Ga0070664_101233078
784 Ga0068857_100379212
785 Ga0068854_100065693
786 Ga0068854_100216621
787 Ga0068854_100310755
788 Ga0068854_100553605
789 Ga0068856_100057386
790 Ga0068856_100118189
791 Ga0068856_100365513
792 Ga0068852_101505984
793 Ga0068852_101896221
794 Ga0068859_100504085
795 Ga0068864_100023513
796 Ga0068861_100008130
797 Ga0068851_10375409
798 Ga0068862_100174734
799 Ga0068862_101351190
800 Ga0081455_10011139
801 Ga0081455_10067881
802 Ga0081455_10351570
803 Ga0081538_10000018
804 Ga0081538_10000146
805 Ga0081538_10000173
806 Ga0081538_10000881
807 Ga0081538_10001026
808 Ga0081538_10001651
809 Ga0081538_10010274
810 Ga0081538_10015533
811 Ga0081538_10031166
812 Ga0081538_10039802
813 Ga0081538_10057228
814 Ga0081538_10148454
815 Ga0081538_10156485
816 Ga0081540_1000221
817 Ga0081540_1046537
818 Ga0081540_1217260
819 Ga0081539_10003461
820 Ga0081539_10032928
821 Ga0081539_10046060
822 Ga0070717_10015612
823 Ga0075365_10330597
824 Ga0075365_10525085
825 Ga0075365_10636010
826 Ga0075363_100343499
827 Ga0075432_10004169
828 Ga0075432_10154805
829 Ga0075432_10590121
830 Ga0070715_10004804
831 Ga0070716_100000183
832 Ga0070712_100032265
833 Ga0070712_101207009
834 Ga0075428_100040729
835 Ga0075428_100074774
836 Ga0075428_100126274
837 Ga0075428_100324303
838 Ga0075428_100329713
839 Ga0075430_100000846
840 Ga0075430_100010488
841 Ga0075430_100213803
842 Ga0075430_100432982
843 Ga0075430_100707073
844 Ga0075431_100002442
845 Ga0075431_100013385
846 Ga0075431_100519206
847 Ga0075431_100764373
848 Ga0075433_10217151
849 Ga0075433_10425752
850 Ga0075434_100364841
851 Ga0075434_100391820
852 Ga0075434_100509847
853 Ga0075429_100064780
854 Ga0075429_100200201
855 Ga0075429_100252404
856 Ga0075429_100275222
857 Ga0075436_100642426
858 Ga0075436_100748075
859 Ga0097620_100504060
860 Ga0075435_100054136
861 Ga0105240_11504003
862 Ga0111539_10063041
863 Ga0111539_10092646
864 Ga0111539_10743805
865 Ga0111539_10835524
866 Ga0111539_11095397
867 Ga0105245_10000909
868 Ga0105245_10116789
869 Ga0105245_10377515
870 Ga0105245_11591188
871 Ga0105245_12793473
872 Ga0105245_13095259
873 Ga0105247_11762387
874 Ga0114129_10000969
875 Ga0114129_10018327
876 Ga0114129_10198496
877 Ga0114129_10236919
878 Ga0114129_10259036
879 Ga0114129_10273022
880 Ga0114129_10429294
881 Ga0114129_10655129
882 Ga0114129_10852422
883 Ga0114129_11306271
884 Ga0114129_12652854
885 Ga0114129_13485198
886 Ga0105241_10019996
887 Ga0105241_10485561
888 Ga0105242_10115789
889 Ga0105242_10745402
890 Ga0105242_11726768
891 Ga0105237_10811666
892 Ga0105249_10054968
893 Ga0105249_10718160
894 Ga0105239_10060090
895 Ga0105239_10149637
896 Ga0105239_10803179
897 Ga0105246_10232536
898 Ga0157371_10362149
899 Ga0157371_10504261
900 Ga0157369_10514717
901 Ga0157369_12135650
902 Ga0157369_12570828
903 Ga0157374_10079323
904 Ga0163162_10225976
905 Ga0163162_10650328
906 Ga0157372_10131143
907 Ga0157372_10240781
908 Ga0157372_10682701
909 Ga0157372_11036695
910 Ga0163163_10021565
911 Ga0163163_10599353
912 Ga0157380_10842836
913 Ga0157377_10015759
914 Ga0157379_10532400
915 Ga0163161_10085709
916 Ga0163161_11442367
917 Ga0197907_11064785
918 Ga0197907_11080574
919 Ga0206356_10274653
920 Ga0206356_10348789
921 Ga0206356_11159634
922 Ga0206351_10683145
923 Ga0206352_10641722
924 Ga0206350_11432032
925 Ga0206354_10347671
926 Ga0206354_11454795
927 Ga0206353_10070912
928 Ga0206353_10449245
929 Ga0206353_10466835
930 Ga0206353_10817488
931 Ga0206353_11879009
932 Ga0213873_10038197
933 Ga0213875_10000050
934 Ga0224712_10120942
935 Ga0224712_10145582
936 Ga0224712_10300003
937 Ga0224712_10639786
938 Ga0207692_10000205
939 Ga0207642_10838284
940 Ga0207688_10032176
941 Ga0207699_10000447
942 Ga0207645_10221102
943 Ga0207654_10051875
944 Ga0207707_10523351
945 Ga0207707_11060528
946 Ga0207707_11085409
947 Ga0207693_10025126
948 Ga0207663_10002562
949 Ga0207663_10004635
950 Ga0207657_10352260
951 Ga0207657_10451693
952 Ga0207649_10896893
953 Ga0207652_10152634
954 Ga0207652_10256587
955 Ga0207652_10428733
956 Ga0207687_10022468
957 Ga0207687_11040103
958 Ga0207700_10000922
959 Ga0207700_10123166
960 Ga0207664_10000435
961 Ga0207664_10113961
962 Ga0207706_10002965
963 Ga0207706_10010816
964 Ga0207706_10121852
965 Ga0207686_10351901
966 Ga0207670_10265859
967 Ga0207665_10000283
968 Ga0207665_10771905
969 Ga0207689_10036980
970 Ga0207661_10033521
971 Ga0207661_10089487
972 Ga0207661_10587574
973 Ga0207661_10594750
974 Ga0207679_10235322
975 Ga0207679_10502641
976 Ga0207679_11393699
977 Ga0207667_11298428
978 Ga0207651_11279234
979 Ga0207712_10155751
980 Ga0207712_10427920
981 Ga0207668_10014910
982 Ga0207668_11057298
983 Ga0207668_11916753
984 Ga0207640_10054122
985 Ga0207640_10108743
986 Ga0207640_10130788
987 Ga0207640_11085914
988 Ga0207677_10037868
989 Ga0207639_11409843
990 Ga0207678_10036354
991 Ga0207708_10002526
992 Ga0207708_10078537
993 Ga0207708_10214123
994 Ga0207708_11146487
995 Ga0207702_10109484
996 Ga0207702_10157415
997 Ga0207702_10347306
998 Ga0207702_11621231
999 Ga0207641_11886458
1000 Ga0207676_10132405
1001 Ga0207674_10352405
1002 Ga0207675_100046076
1003 Ga0207675_101054585
1004 Ga0207698_11255475
1005 Ga0207698_11651615
1006 Ga0207428_10015559
1007 Ga0207428_10132199
1008 Ga0207428_10150234
1009 Ga0207428_10153353
1010 Ga0268266_10410487
1011 Ga0268265_10091913
1012 Ga0268265_10535351
1013 Ga0268264_11483312
1014 Ga0265338_10288188
1015 Ga0265777_122737
1016 Ga0265327_10026990
1017 Ga0307408_100038810
1018 Ga0307408_100280542
1019 Ga0307408_100918383
1020 Ga0307408_101585017
1021 Ga0307405_10010442
1022 Ga0307405_10200022
1023 Ga0307405_10354196
1024 Ga0307405_11493800
1025 Ga0307413_10056270
1026 Ga0307413_10271171
1027 Ga0307413_10380706
1028 Ga0307413_10523268
1029 Ga0307413_10828415
1030 Ga0307413_10828490
1031 Ga0307410_10026257
1032 Ga0307410_10043525
1033 Ga0307410_10266356
1034 Ga0307410_10363973
1035 Ga0307406_10010417
1036 Ga0307406_10012278
1037 Ga0307406_10094245
1038 Ga0307406_10108416
1039 Ga0307406_10170505
1040 Ga0307406_10262729
1041 Ga0307406_10322275
1042 Ga0307406_10565731
1043 Ga0307406_10586367
1044 Ga0307407_10052243
1045 Ga0307407_10060915
1046 Ga0307412_10524470
1047 Ga0307412_10792424
1048 Ga0307409_100021357
1049 Ga0307409_100100228
1050 Ga0307409_100182437
1051 Ga0307409_100259040
1052 Ga0307409_100281418
1053 Ga0307409_100400030
1054 Ga0307409_100733497
1055 Ga0307409_101531957
1056 Ga0307416_100029928
1057 Ga0307416_100066753
1058 Ga0307416_100098005
1059 Ga0307416_100450455
1060 Ga0307416_100458230
1061 Ga0307416_100634386
1062 Ga0307416_101200240
1063 Ga0307416_102653546
1064 Ga0307416_103457409
1065 Ga0307414_10054683
1066 Ga0307414_10287889
1067 Ga0307414_10299304
1068 Ga0307414_11277486
1069 Ga0307411_10168149
1070 Ga0307411_10276461
1071 Ga0307411_10425397
1072 Ga0307411_11869791
1073 Ga0307415_100007898
1074 Ga0307415_100087647
1075 Ga0307415_100117783
1076 Ga0307415_100203110
1077 Ga0307415_100809253
1078 Ga0307415_102331749
1079 Ga0316214_1052885
1080 Ga0373929_0041531
1081 Ga0373934_0003462
1082 Ga0373940_0337009
1083 Ga0373949_0068073
1084 Ga0373923_0000246
1085 Ga0373936_0001067
1086 Ga0373945_0000087
1087 Ga0373953_0194113
1088 Ga0373954_0027395
1089 Ga0373957_0079665
1090 Ga0373960_0189156
1091 Ga0373943_0026225
1092 Ga0373946_0001667
1093 Ga0373955_0071957
1094 Ga0373955_0187263
1095 Ga0373961_0136708
1096 Ga0373924_0014317
1097 Ga0373931_0060805
1098 Ga0373935_0045363
1099 Ga0373927_0003461
1100 Ga0373933_0219459
1101 Ga0373947_0001748
1102 Ga0373947_1109276
1103 Ga0373925_0021468
1104 Ga0395900_0149575
1105 Ga0395900_0811774
1106 Ga0395898_0024449
1107 Ga0395898_0044851
1108 Ga0395898_0165913
1109 Ga0395898_0204971
1110 Ga0395898_0362164
1111 Ga0395898_0520887
1112 Ga0395898_0672870
1113 Ga0395905_0887891
1114 Ga0436364_0750607
1115 Ga0395901_0058272
1116 Ga0395901_0117301
1117 Ga0395901_0207916
1118 Ga0395901_0231886
1119 Ga0395901_0412151
1120 Ga0395901_0451664
1121 Ga0395901_1297012
1122 Ga0395901_1828290
1123 Ga0436365_0077243
1124 Ga0436365_0651128
1125 Ga0436363_0299025
1126 Ga0436363_0533476
1127 Ga0436363_0998335
1128 Ga0436362_0663754
1129 Ga0439448_0098722
1130 Ga0439463_083442
1131 Ga0450915_007642
1132 Ga0439460_0201061
1133 Ga0439460_0251984
1134 Ga0439440_0152447
1135 Ga0466972_0209769
1136 Ga0466965_0481598
1137 Ga0466965_0792796
1138 Ga0466966_0035267
1139 Ga0466963_0094142
1140 Ga0466964_0044105
1141 Ga0466964_0565149
1142 Ga0466964_0717694
1143 Ga0466968_0134169
1144 Ga0466970_0054841
1145 Ga0466957_0037489
1146 Ga0466957_0224230
1147 Ga0466960_0180039
1148 Ga0466960_0457375
1149 Ga0466967_0007606
1150 Ga0466967_0050467
1151 Ga0466967_0056133
1152 Ga0466967_0709185
1153 Ga0466967_0749613
1154 Ga0466967_1299335
1155 Ga0495592_0116460
1156 Ga0495603_0004934
1157 Ga0495603_0082671
1158 Ga0495629_0001498
1159 Ga0495641_0003379
1160 Ga0495641_0323438
1161 Ga0495651_0219590
1162 Ga0495653_0609041
1163 Ga0495582_0005033
1164 Ga0495582_0055147
1165 Ga0495639_0002154
1166 Ga0495662_0000669
1167 Ga0495664_0008356
1168 Ga0495584_0019416
1169 Ga0495584_0082075
1170 Ga0495585_0143393
1171 Ga0495594_0035549
1172 Ga0495594_0411772
1173 Ga0495596_0092852
1174 Ga0495607_0377311
1175 Ga0495608_0007436
1176 Ga0495618_0002803
1177 Ga0495628_0048354
1178 Ga0495631_0264387
1179 Ga0495644_0092671
1180 Ga0495666_0000704
1181 Ga0495652_0082673
1182 Ga0495665_0000926
1183 Ga0495640_0009747
1184 Ga0495586_0000603
1185 Ga0495587_0021358
1186 Ga0495609_0278883
1187 Ga0495597_0265375
1188 Ga0495645_0007935
1189 Ga0495622_0093893
1190 Ga0495667_0010574
1191 Ga0495667_0343416
1192 Ga0495668_0080189
1193 Ga0495668_0267119
1194 Ga0495634_0060071
1195 Ga0495635_0006474
1196 Ga0495588_0116388
1197 Ga0495657_0082017
1198 Ga0495599_0192946
1199 Ga0495623_0033835
1200 Ga0495646_0011062
1201 Ga0495647_0003821
1202 Ga0495658_0002808
1203 Ga0495613_0010139
1204 Ga0495624_0004956
1205 Ga0495670_0499927
1206 Ga0495670_0793614
1207 Ga0495649_0465091
1208 Ga0495589_0104555
1209 Ga0495589_0136537
1210 Ga0495589_0384126
1211 Ga0495600_0008984
1212 Ga0495581_0006600
1213 Ga0495604_0022617
1214 Ga0495674_0010877
1215 Ga0495674_0312394
1216 Ga0495674_0915306
1217 Ga0495672_0140301
1218 Ga0495676_0005472
1219 Ga0495680_0073660
1220 Ga0495684_0145033
1221 Ga0495593_0005721
1222 Ga0495602_0379731
1223 Ga0495614_0052306
1224 Ga0496100_0009443
1225 Ga0496100_0108748
1226 Ga0496100_0136225
1227 Ga0496101_0047047
1228 Ga0496101_0358430
1229 Ga0496102_0037257
1230 Ga0496102_0064865
1231 Ga0496102_0812145
1232 Ga0496102_1138484
1233 Ga0496103_0044435
1234 Ga0496104_0085852
1235 Ga0496104_0167178
1236 Ga0496104_0263513
1237 Ga0496104_0269165
1238 Ga0496105_0021744
1239 Ga0496105_0122686
1240 Ga0496105_0211584
1241 Ga0496105_0282814
1242 Ga0496106_0012066
1243 Ga0496106_0024075
1244 Ga0496107_0033191
1245 Ga0496107_0051807
1246 Ga0496107_0184327
1247 Ga0496108_0002123
1248 Ga0496108_0035947
1249 Ga0496108_0125574
1250 Ga0496108_0294011
1251 Ga0496108_0572689
1252 Ga0496109_0015861
1253 Ga0496109_0033970
1254 Ga0496109_0064680
1255 Ga0496109_0409326
1256 Ga0496109_0444682
1257 Ga0496110_0000052
1258 Ga0496110_0002112
1259 Ga0496110_0039844
1260 Ga0496110_0094443
1261 Ga0496110_0458532
1262 Ga0496110_0572291
1263 Ga0496110_0788252
1264 Ga0496111_0000555
1265 Ga0496111_0005704
1266 Ga0496111_0066766
1267 Ga0496111_0103278
1268 Ga0496111_0563868
1269 Ga0496111_1147047
1270 Ga0496112_0067216
1271 Ga0496112_0080530
1272 Ga0496112_0156589
1273 Ga0496112_0196300
1274 Ga0496112_0537129
1275 Ga0496113_0006224
1276 Ga0496113_0014625
1277 Ga0496113_0206774
1278 Ga0496114_0078912
1279 Ga0496114_0136659
1280 Ga0496114_0425037
1281 Ga0496115_0079392
1282 Ga0496115_0487521
1283 Ga0501031_0198481
1284 Ga0501031_0284775
1285 Ga0501031_0567051
1286 Ga0501031_0734757
1287 Ga0501031_0832393
1288 Ga0501032_0007506
1289 Ga0501032_0140331
1290 Ga0501033_0007013
1291 Ga0501036_0006816
1292 Ga0501036_0108795
1293 Ga0501036_0141675
1294 Ga0501036_0266657
1295 Ga0501036_0523687
1296 Ga0501036_0934133
1297 Ga0501036_1043213
1298 Ga0501037_0002318
1299 Ga0501037_0080648
1300 Ga0501038_0003190
1301 Ga0501038_0003920
1302 Ga0501038_0106159
1303 Ga0501038_0995722
1304 Ga0501039_0031212
1305 Ga0501039_0531532
1306 Ga0501040_0043957
1307 Ga0501040_0124955
1308 Ga0501040_0235973
1309 Ga0501041_0119072
1310 Ga0501041_0121416
1311 Ga0501041_0894780
1312 Ga0501042_0118477
1313 Ga0501042_0445998
1314 Ga0501043_0004934
1315 Ga0501046_0045490
1316 Ga0501046_0050968
1317 Ga0501046_0191449
1318 Ga0501047_0067940
1319 Ga0501048_0029583
1320 Ga0501048_0043275
1321 Ga0501048_0743181
1322 Ga0501048_0936906
1323 Ga0501067_0017125
1324 Ga0501067_0328342
1325 Ga0501068_0543914
1326 Ga0501069_0082274
1327 Ga0501069_0155750
1328 Ga0501069_0372863
1329 Ga0501070_0006234
1330 Ga0501070_0061166
1331 Ga0501071_0016959
1332 Ga0501071_0408934
1333 Ga0501071_0579222
1334 Ga0501071_0706340
1335 Ga0501072_0112750
1336 Ga0501072_0206548
1337 Ga0501072_0749092
1338 Ga0501073_0017096
1339 Ga0501074_0010710
1340 Ga0501074_0036482
1341 Ga0501074_0329793
1342 Ga0501075_0011558
1343 Ga0501075_0310680
1344 Ga0501076_0872185
1345 Ga0501077_0097642
1346 Ga0501235_030180
1347 Ga0501079_0044679
1348 Ga0501079_1027238
1349 Ga0501080_0014659
1350 Ga0501080_0044211
1351 Ga0501081_0053865
1352 Ga0501081_0180169
1353 Ga0501083_0007723
1354 Ga0501271_014251
1355 Ga0501035_0047969
1356 Ga0501035_0715535
1357 Ga0501044_0108148
1358 Ga0501044_0315981
1359 Ga0501045_0017503
1360 Ga0501045_0082773
1361 Ga0501045_0359936
1362 nmdc:mga0yw44_112876_c1
1363 nmdc:mga06z11_233821_c1
1364 nmdc:mga05p37_139508_c1
1365 nmdc:mga05p37_205218_c1
1366 nmdc:mga05p37_239345_c1
1367 nmdc:mga05p37_601_c1
1368 nmdc:mga05p37_604416_c1
1369 nmdc:mga05p37_9564_c1
1370 nmdc:mga09592_224220_c1
1371 nmdc:mga09592_79137_c1
1372 nmdc:mga0qj67_102102_c1
1373 nmdc:mga0qj67_129704_c1
1374 nmdc:mga0qj67_134097_c1
1375 nmdc:mga06r32_111328_c1
1376 nmdc:mga06r32_364957_c1
1377 nmdc:mga06r32_38489_c1
1378 nmdc:mga06r32_677718_c1
1379 nmdc:mga08y16_1449708_c1
1380 nmdc:mga08y16_18952_c1
1381 nmdc:mga08y16_79196_c1
1382 nmdc:mga08y16_966740_c1
1383 nmdc:mga0n895_1715361_c1
1384 nmdc:mga0n895_280496_c1
1385 nmdc:mga0n895_931123_c1
1386 nmdc:mga0rr50_102613_c1
1387 nmdc:mga08x19_681633_c1
1388 nmdc:mga08x19_96970_c1
1389 nmdc:mga0a205_162658_c1
1390 nmdc:mga0a205_263494_c1
1391 Ga0495601_0172078
1392 Ga0495601_0418288
1393 Ga0495612_0000921
1394 Ga0495655_0373097
1395 Ga0495595_0010474
1396 Ga0495619_0000088
1397 Ga0495619_0002822
1398 Ga0500556_0000753
1399 Ga0500616_0002548
1400 Ga0500599_001910
1401 Ga0501084_0085123
1402 Ga0501084_0133045
1403 Ga0501084_0144922
1404 Ga0501084_0520786
1405 Ga0501084_1249290
1406 Ga0501082_0010692
1407 Ga0501082_0051149
1408 Ga0501082_0176851
1409 Ga0501082_0860560
1410 Ga0530510_0005859
1411 Ga0530510_0402664
1412 2506868316
1413 2774858119
1414 2774902702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

67

124

0.92

PF00571

CBS

CBS domain

2

59

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9245 4 116
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9139 3 118
1pvm-assembly1.cif.gz_A crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum 0.9056 1 113
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9017 2 116
3fhm-assembly2.cif.gz_C crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9009 4 113
ID Description Score Start End Superfamily
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9255 3 120 3.10.580.10
af_Q54FT9_77_228_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9217 2 120 3.10.580.10
af_Q75K17_104_256_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9141 1 120 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9139 3 118 3.10.580.10
af_A0A1D6Q1S7_52_188_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9088 2 113 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7Y6A768-F1-model_v4 CBS domain-containing protein 0.9772 1 120
AF-A0A1C6UYX1-F1-model_v4 CBS domain-containing protein 0.9771 1 120
AF-A0A7Y5P1B8-F1-model_v4 deleted 0.9762 1 120
AF-A0A7K2YH85-F1-model_v4 CBS domain-containing protein 0.9756 1 120
AF-H0E8H0-F1-model_v4 CBS domain containing protein 0.9754 1 120

Map