F476487

General Info

Members Datasets Scaffolds Average Seq Length
706 332 584 425

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0009358|Ga0395899_0009358_308_1717
Length 469
Sequence VSEKVKNASEFVNPQKGRTARIEPSPTNAGGAEPHSAPRPHYGYAMSNTEPFFTQTLADRDAPVRAAVLRELERQQSQVELIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCEFVDEVEALAIERVKRLFGAGYANVQPHSGAQANGSVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNAVQYGVSRDTMLIDYGQIEALAAEHRPSLIIAGFSAYPRALDFARFRAIADSVGAKLMVDMAHIAGIVAAGRHPNPIEHAHVVTSTTHKTLRGPRGGFVLTNDEDIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALDDGFKGYIDRVLANAQALGAVLREGGVDLVTGGTDNHLLLVDLRPKGLKGTQVETALERAGITCNKNGIPFDTEKPTVTSGIRLGTPAGTTRGFGVAQFEQIGRLILEVFEALTRHPEGDAQTEQRVRREIFALCERFPIY

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
4 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
5 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
6 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
9 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
10 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
11 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
12 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
13 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
14 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
15 2519103095 Burkholderia sp. KJ006 Isolate Nodule
16 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
17 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
18 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
19 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
20 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
21 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
22 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
23 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
24 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
25 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
26 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
27 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
28 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
29 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
30 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
31 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
32 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
33 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
34 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
35 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
36 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
37 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
38 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
39 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
40 2818991436 Collimonas arenae 515 Isolate Unclassified
41 2818991450 Burkholderia sp. 604 Isolate Unclassified
42 2818991452 Burkholderia cepacia 561 Isolate Unclassified
43 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
44 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
45 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
46 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
47 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
48 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
49 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
50 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
51 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
52 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
53 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
54 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
55 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
56 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
57 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
58 2902330777 Methylobacterium sp. 2A Isolate Unclassified
59 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
60 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
61 2904564687 Burkholderia sp. 571 Isolate Unclassified
62 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
63 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
64 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
65 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
66 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
67 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
68 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
69 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
70 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
71 2928163908 Burkholderia sp. 567 Isolate Unclassified
72 2928170801 Burkholderia sp. 572 Isolate Unclassified
73 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
74 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
75 2928536128 Burkholderia sola 565 Isolate Unclassified
76 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
77 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
78 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
79 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
80 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
81 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
82 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
83 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
84 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
85 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
86 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
87 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
88 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
91 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
92 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
93 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
94 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
95 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
96 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
97 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
98 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
99 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
100 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
105 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
106 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
107 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
108 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
109 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
152 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
202 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
305 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
306 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
309 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
316 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
317 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
318 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
319 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
320 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
321 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
322 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
323 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
324 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
325 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
326 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
327 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
328 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
329 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
330 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
331 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
332 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.29
Metatranscriptomes 0.57
Isolates 17.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.88
Nodule 3.97
Rhizoplane 5.95
Rhizosphere 61.76
Stem 0
Stem Tuber 0
Unclassified 14.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000031 3300001979 Bacteria 46967
2 JGI24740J21852_10000333 3300001979 Bacteria 19977
3 JGI24740J21852_10011891 3300001979 Bacteria 3300
4 JGI24739J22299_10001631 3300001989 Bacteria 8513
5 JGI24739J22299_10002527 3300001989 Bacteria 7049
6 JGI24739J22299_10006381 3300001989 Bacteria 4453
7 JGI24737J22298_10009927 3300001990 Bacteria 3151
8 JGI24735J21928_10020765 3300002067 Bacteria 2010
9 JGI25156J39149_1000366 3300002705 Bacteria 29011
10 JGI25156J39149_1000389 3300002705 Bacteria 27572
11 JGI25156J39149_1000562 3300002705 Bacteria 21189
12 JGI25156J39149_1000718 3300002705 Bacteria 17623
13 JGI25156J39149_1003583 3300002705 Bacteria 5021
14 JGI25156J39149_1004983 3300002705 Bacteria 3922
15 JGI25162J39368_1000052 3300002737 Bacteria 152144
16 JGI25154J39366_1000271 3300002738 Bacteria 32100
17 JGI25151J46595_10005206 3300003187 Bacteria 6745
18 JGI25165J46597_1000105 3300003214 Bacteria 152144
19 JGI25165J46597_1000717 3300003214 Bacteria 26046
20 JGI25160J50197_1000138 3300003354 Bacteria 65562
21 Ga0055538_1000043 3300003751 Bacteria 152144
22 Ga0055538_1000219 3300003751 Bacteria 33042
23 Ga0055539_1000057 3300003752 Bacteria 152144
24 Ga0055539_1000233 3300003752 Bacteria 38473
25 Ga0055533_1000064 3300003756 Bacteria 169672
26 Ga0055533_1000071 3300003756 Bacteria 152144
27 Ga0055533_1000247 3300003756 Bacteria 33939
28 Ga0055533_1000317 3300003756 Bacteria 22873
29 Ga0055533_1001095 3300003756 Bacteria 7758
30 Ga0055532_1000013 3300003758 Bacteria 380677
31 Ga0055532_1000245 3300003758 Bacteria 39120
32 Ga0055525_1000085 3300003759 Bacteria 152144
33 Ga0055525_1000318 3300003759 Bacteria 38473
34 Ga0055527_1000010 3300003760 Bacteria 380677
35 Ga0055527_1000260 3300003760 Bacteria 32074
36 Ga0055527_1000468 3300003760 Bacteria 15486
37 Ga0055527_1000470 3300003760 Bacteria 15436
38 Ga0055535_1000010 3300003761 Bacteria 380677
39 Ga0055535_1000431 3300003761 Bacteria 39120
40 Ga0055535_1001162 3300003761 Bacteria 15486
41 Ga0055535_1001166 3300003761 Bacteria 15436
42 Ga0055542_1000016 3300003762 Bacteria 380677
43 Ga0055542_1000990 3300003762 Bacteria 18375
44 Ga0055542_1001151 3300003762 Bacteria 15486
45 Ga0055542_1003283 3300003762 Bacteria 4496
46 Ga0055529_1000012 3300003763 Bacteria 380677
47 Ga0055529_1000517 3300003763 Bacteria 33886
48 Ga0055529_1000670 3300003763 Bacteria 23836
49 Ga0055529_1000746 3300003763 Bacteria 21012
50 Ga0055528_1002297 3300003790 Bacteria 10350
51 Ga0055541_1000044 3300003841 Bacteria 152144
52 Ga0055541_1000113 3300003841 Bacteria 58560
53 Ga0055541_1000160 3300003841 Bacteria 33042
54 Ga0065165_1000810 3300005262 Bacteria 41615
55 Ga0065165_1001078 3300005262 Bacteria 32546
56 Ga0070658_10003407 3300005327 Bacteria 13079
57 Ga0070658_10017930 3300005327 Bacteria 5662
58 Ga0070658_10048516 3300005327 Bacteria 3438
59 Ga0070658_10056707 3300005327 Bacteria 3185
60 Ga0070683_100191065 3300005329 Bacteria 1944
61 Ga0070660_100000006 3300005339 Bacteria 166714
62 Ga0070660_100000507 3300005339 Bacteria 26032
63 Ga0070661_100000348 3300005344 Bacteria 36613
64 Ga0070659_100000082 3300005366 Bacteria 71707
65 Ga0070659_100002151 3300005366 Bacteria 14041
66 Ga0070659_100040921 3300005366 Bacteria 3622
67 Ga0070659_100094113 3300005366 Bacteria 2405
68 Ga0070711_100000008 3300005439 Bacteria 180012
69 Ga0070711_100018442 3300005439 Bacteria 4457
70 Ga0070663_100000069 3300005455 Bacteria 44710
71 Ga0070663_100000075 3300005455 Bacteria 43381
72 Ga0070663_100062773 3300005455 Bacteria 2680
73 Ga0070681_10001701 3300005458 Bacteria 19683
74 Ga0070679_100048109 3300005530 Bacteria 4250
75 Ga0070679_100100214 3300005530 Bacteria 2884
76 Ga0068855_100040376 3300005563 Bacteria 5539
77 Ga0070664_100000191 3300005564 Bacteria 43340
78 Ga0068857_100009953 3300005577 Bacteria 8255
79 Ga0068856_100000504 3300005614 Bacteria 43340
80 Ga0068856_100062220 3300005614 Bacteria 3686
81 Ga0068856_100076217 3300005614 Bacteria 3323
82 Ga0068852_100015182 3300005616 Bacteria 5961
83 Ga0105251_10000043 3300009011 Bacteria 113848
84 Ga0105251_10000127 3300009011 Bacteria 76233
85 Ga0105250_10015150 3300009092 Bacteria 3158
86 Ga0105240_10004374 3300009093 Bacteria 21565
87 Ga0105240_10066046 3300009093 Bacteria 4490
88 Ga0105240_10142600 3300009093 Bacteria 2863
89 Ga0105240_10154226 3300009093 Bacteria 2733
90 Ga0105240_10256948 3300009093 Bacteria 2017
91 Ga0105240_10362086 3300009093 Bacteria 1642
92 Ga0105237_10175134 3300009545 Bacteria 2146
93 Ga0105239_10002079 3300010375 Bacteria 25954
94 Ga0105239_10003831 3300010375 Bacteria 18277
95 Ga0157373_10000358 3300013100 Bacteria 36729
96 Ga0157373_10002832 3300013100 Bacteria 13112
97 Ga0157371_10000608 3300013102 Bacteria 42626
98 Ga0157371_10008084 3300013102 Bacteria 8411
99 Ga0157370_10000690 3300013104 Bacteria 42091
100 Ga0157370_10000852 3300013104 Bacteria 38700
101 Ga0157370_10001717 3300013104 Bacteria 26975
102 Ga0157369_10000120 3300013105 Bacteria 111290
103 Ga0157369_10000743 3300013105 Bacteria 42070
104 Ga0157369_10003555 3300013105 Bacteria 18512
105 Ga0157369_10130895 3300013105 Bacteria 2659
106 Ga0157374_10000976 3300013296 Bacteria 24794
107 Ga0157372_10000519 3300013307 Bacteria 42478
108 Ga0157372_10003761 3300013307 Bacteria 16301
109 Ga0157375_10010236 3300013308 Bacteria 8249
110 Ga0182008_10025257 3300014497 Bacteria 3017
111 Ga0182006_1001401 3300015261 Bacteria 14627
112 Ga0182007_10000795 3300015262 Bacteria 17642
113 Ga0182007_10003364 3300015262 Bacteria 7557
114 Ga0182007_10004520 3300015262 Bacteria 6289
115 Ga0182007_10030545 3300015262 Bacteria 1840
116 Ga0183361_10061 3300016635 Bacteria 3339
117 Ga0224712_10000332 3300022467 Bacteria 8963
118 Ga0209435_102220 3300025206 Bacteria 2306
119 Ga0209435_104222 3300025206 Bacteria 1628
120 Ga0209784_100069 3300025224 Bacteria 152424
121 Ga0209784_100215 3300025224 Bacteria 39580
122 Ga0209784_100567 3300025224 Bacteria 12794
123 Ga0209566_100018 3300025225 Bacteria 448638
124 Ga0209566_100083 3300025225 Bacteria 152424
125 Ga0209566_100161 3300025225 Bacteria 75269
126 Ga0209566_100215 3300025225 Bacteria 58348
127 Ga0209674_100011 3300025226 Bacteria 997175
128 Ga0209674_100048 3300025226 Bacteria 353032
129 Ga0209674_100106 3300025226 Bacteria 152424
130 Ga0209674_100157 3300025226 Bacteria 91077
131 Ga0209674_100183 3300025226 Bacteria 71751
132 Ga0209674_100271 3300025226 Bacteria 39580
133 Ga0209674_102503 3300025226 Bacteria 3905
134 Ga0209672_100002 3300025228 Bacteria 1733325
135 Ga0209672_100020 3300025228 Bacteria 429003
136 Ga0209672_100066 3300025228 Bacteria 189828
137 Ga0209672_100188 3300025228 Bacteria 50151
138 Ga0209672_100234 3300025228 Bacteria 42161
139 Ga0209672_100439 3300025228 Bacteria 23788
140 Ga0209147_100003 3300025229 Bacteria 1733325
141 Ga0209147_100024 3300025229 Bacteria 429003
142 Ga0209147_100084 3300025229 Bacteria 189828
143 Ga0209147_100295 3300025229 Bacteria 42161
144 Ga0209563_100100 3300025230 Bacteria 152424
145 Ga0209563_100181 3300025230 Bacteria 39580
146 Ga0209563_101061 3300025230 Bacteria 7950
147 Ga0209437_100156 3300025233 Bacteria 152424
148 Ga0209258_100042 3300025242 Bacteria 380729
149 Ga0209258_100084 3300025242 Bacteria 244783
150 Ga0209258_100117 3300025242 Bacteria 189828
151 Ga0209258_100477 3300025242 Bacteria 42161
152 Ga0209646_1000046 3300025246 Bacteria 332737
153 Ga0209026_1003728 3300025250 Bacteria 4852
154 Ga0209677_100061 3300025253 Bacteria 152424
155 Ga0209677_100230 3300025253 Bacteria 39580
156 Ga0209677_102128 3300025253 Bacteria 7768
157 Ga0209148_1000006 3300025254 Bacteria 1733325
158 Ga0209148_1000148 3300025254 Bacteria 159642
159 Ga0209148_1000187 3300025254 Bacteria 117659
160 Ga0209148_1000785 3300025254 Bacteria 23584
161 Ga0209148_1003392 3300025254 Bacteria 4445
162 Ga0209759_1000002 3300025256 Bacteria 1027596
163 Ga0209759_1000032 3300025256 Bacteria 278697
164 Ga0209759_1000210 3300025256 Bacteria 90325
165 Ga0209759_1000363 3300025256 Bacteria 57937
166 Ga0209759_1000587 3300025256 Bacteria 35659
167 Ga0209759_1003547 3300025256 Bacteria 6177
168 Ga0209759_1006120 3300025256 Bacteria 4096
169 Ga0209759_1011323 3300025256 Bacteria 2542
170 Ga0209759_1020077 3300025256 Bacteria 1564
171 Ga0209233_1000033 3300025261 Bacteria 596094
172 Ga0209233_1000165 3300025261 Bacteria 152424
173 Ga0209565_1009103 3300025263 Bacteria 2552
174 Ga0209455_1000003 3300025272 Bacteria 1471893
175 Ga0209455_1000110 3300025272 Bacteria 189828
176 Ga0209455_1000362 3300025272 Bacteria 42161
177 Ga0209455_1001376 3300025272 Bacteria 11110
178 Ga0209673_1000057 3300025273 Bacteria 270150
179 Ga0209130_1004039 3300025284 Bacteria 5826
180 Ga0209130_1009846 3300025284 Bacteria 2682
181 Ga0209025_1000123 3300025294 Bacteria 204125
182 Ga0209564_1004896 3300025295 Bacteria 7944
183 Ga0207426_1000018 3300025302 Bacteria 566740
184 Ga0207426_1000152 3300025302 Bacteria 183514
185 Ga0207713_1000240 3300025735 Bacteria 73219
186 Ga0207713_1000302 3300025735 Bacteria 56383
187 Ga0207647_10001027 3300025904 Bacteria 21661
188 Ga0207647_10003472 3300025904 Bacteria 11821
189 Ga0207647_10035914 3300025904 Bacteria 3153
190 Ga0207705_10003789 3300025909 Bacteria 11515
191 Ga0207705_10052350 3300025909 Bacteria 2939
192 Ga0207707_10000098 3300025912 Bacteria 87035
193 Ga0207695_10001113 3300025913 Bacteria 46732
194 Ga0207695_10006823 3300025913 Bacteria 14704
195 Ga0207695_10036944 3300025913 Bacteria 5274
196 Ga0207695_10048057 3300025913 Bacteria 4509
197 Ga0207695_10102080 3300025913 Bacteria 2862
198 Ga0207695_10114130 3300025913 Bacteria 2677
199 Ga0207663_10000023 3300025916 Bacteria 120745
200 Ga0207663_10013832 3300025916 Bacteria 4399
201 Ga0207660_10079740 3300025917 Bacteria 2402
202 Ga0207657_10000003 3300025919 Bacteria 263148
203 Ga0207657_10000885 3300025919 Bacteria 31657
204 Ga0207657_10206949 3300025919 Bacteria 1576
205 Ga0207649_10000326 3300025920 Bacteria 36079
206 Ga0207694_10019179 3300025924 Bacteria 5170
207 Ga0207664_10001839 3300025929 Bacteria 13993
208 Ga0207690_10000007 3300025932 Bacteria 388533
209 Ga0207690_10000380 3300025932 Bacteria 29474
210 Ga0207690_10076393 3300025932 Bacteria 2326
211 Ga0207706_10088231 3300025933 Bacteria 2727
212 Ga0207711_10030210 3300025941 Bacteria 4570
213 Ga0207679_10000002 3300025945 Bacteria 634491
214 Ga0207667_10006579 3300025949 Bacteria 14061
215 Ga0207667_10006899 3300025949 Bacteria 13718
216 Ga0207667_10030915 3300025949 Bacteria 5786
217 Ga0207667_10058573 3300025949 Bacteria 4039
218 Ga0207667_10073993 3300025949 Bacteria 3539
219 Ga0207667_10228092 3300025949 Bacteria 1907
220 Ga0207668_10118111 3300025972 Bacteria 2003
221 Ga0207678_10000319 3300026067 Bacteria 43404
222 Ga0207678_10001465 3300026067 Bacteria 21657
223 Ga0207678_10008540 3300026067 Bacteria 9025
224 Ga0207702_10000504 3300026078 Bacteria 44031
225 Ga0207702_10049899 3300026078 Bacteria 3532
226 Ga0207674_10004306 3300026116 Bacteria 17162
227 Ga0207698_10019094 3300026142 Bacteria 4684
228 Ga0207698_10071541 3300026142 Bacteria 2752
229 Ga0209371_1000076 3300027312 Bacteria 195166
230 Ga0265318_10013761 3300028577 Bacteria 3408
231 Ga0265338_10001766 3300028800 Bacteria 34128
232 Ga0265338_10019124 3300028800 Bacteria 7290
233 Ga0268256_1000087 3300030500 Bacteria 157659
234 Ga0268256_1005103 3300030500 Bacteria 5238
235 Ga0265320_10033832 3300031240 Bacteria 2606
236 Ga0307408_100004532 3300031548 Bacteria 9417
237 Ga0265313_10008523 3300031595 Bacteria 6797
238 Ga0265314_10006743 3300031711 Bacteria 10083
239 Ga0307412_10000095 3300031911 Bacteria 75002
240 Ga0395899_0000023 3300037312 Bacteria 367159
241 Ga0395899_0000241 3300037312 Bacteria 72826
242 Ga0395899_0006229 3300037312 Bacteria 9242
243 Ga0395899_0009358 3300037312 Bacteria 7526
244 Ga0395899_0074250 3300037312 Bacteria 2484
245 Ga0395899_0082115 3300037312 Bacteria 2344
246 Ga0395900_0000019 3300037418 Bacteria 357240
247 Ga0395900_0000265 3300037418 Bacteria 81381
248 Ga0395900_0000633 3300037418 Bacteria 47354
249 Ga0395900_0001069 3300037418 Bacteria 34842
250 Ga0395900_0032838 3300037418 Bacteria 5338
251 Ga0395900_0101315 3300037418 Bacteria 2958
252 Ga0395900_0170678 3300037418 Bacteria 2215
253 Ga0395900_0216467 3300037418 Bacteria 1932
254 Ga0395898_0000016 3300037466 Bacteria 435585
255 Ga0395898_0001705 3300037466 Bacteria 29237
256 Ga0395898_0063824 3300037466 Bacteria 3574
257 Ga0395898_0113022 3300037466 Bacteria 2602
258 Ga0395898_0127450 3300037466 Bacteria 2438
259 Ga0395905_0000009 3300037471 Bacteria 488729
260 Ga0395905_0000048 3300037471 Bacteria 236537
261 Ga0395905_0000144 3300037471 Bacteria 117622
262 Ga0395905_0001161 3300037471 Bacteria 32913
263 Ga0395905_0033555 3300037471 Bacteria 4821
264 Ga0395905_0048375 3300037471 Bacteria 3985
265 Ga0395905_0077844 3300037471 Bacteria 3107
266 Ga0395901_0000009 3300038443 Bacteria 479396
267 Ga0395901_0000081 3300038443 Bacteria 130244
268 Ga0395901_0000157 3300038443 Bacteria 88435
269 Ga0395901_0015476 3300038443 Bacteria 7767
270 Ga0395901_0046848 3300038443 Bacteria 4491
271 Ga0395901_0075354 3300038443 Bacteria 3519
272 Ga0436361_0501535 3300039447 Bacteria 5182
273 Ga0439448_0000277 3300042005 Bacteria 11224
274 Ga0466969_0000088 3300044656 Bacteria 47596
275 Ga0466969_0002473 3300044656 Bacteria 9865
276 Ga0466969_0018108 3300044656 Bacteria 3674
277 Ga0466969_0022794 3300044656 Bacteria 3229
278 Ga0466965_0001437 3300044683 Bacteria 9611
279 Ga0466965_0002491 3300044683 Bacteria 7836
280 Ga0466965_0008150 3300044683 Bacteria 4839
281 Ga0466966_0000009 3300044684 Bacteria 150954
282 Ga0466966_0001052 3300044684 Bacteria 17607
283 Ga0466966_0002581 3300044684 Bacteria 11874
284 Ga0466966_0002666 3300044684 Bacteria 11694
285 Ga0466966_0010696 3300044684 Bacteria 6100
286 Ga0466961_0000665 3300044693 Bacteria 21692
287 Ga0466961_0004003 3300044693 Bacteria 9224
288 Ga0466961_0005937 3300044693 Bacteria 7738
289 Ga0466961_0007719 3300044693 Bacteria 6850
290 Ga0466961_0008980 3300044693 Bacteria 6377
291 Ga0466961_0028566 3300044693 Bacteria 3586
292 Ga0466963_0002186 3300044694 Bacteria 10812
293 Ga0466963_0011644 3300044694 Bacteria 5357
294 Ga0466963_0106362 3300044694 Bacteria 1924
295 Ga0466964_0007498 3300044706 Bacteria 4083
296 Ga0466964_0032652 3300044706 Bacteria 2069
297 Ga0466971_0000802 3300044719 Bacteria 12685
298 Ga0466971_0000889 3300044719 Bacteria 12226
299 Ga0466971_0058805 3300044719 Bacteria 1735
300 Ga0466970_0018084 3300044765 Bacteria 3647
301 Ga0466970_0030551 3300044765 Bacteria 2841
302 Ga0466957_0002453 3300044842 Bacteria 9961
303 Ga0466957_0002727 3300044842 Bacteria 9551
304 Ga0466959_0001627 3300045049 Bacteria 13866
305 Ga0466959_0013774 3300045049 Bacteria 5871
306 Ga0466959_0047382 3300045049 Bacteria 3161
307 Ga0466959_0090733 3300045049 Bacteria 2194
308 Ga0466958_0009929 3300045836 Bacteria 5317
309 Ga0466958_0033906 3300045836 Bacteria 3043
310 Ga0466958_0035276 3300045836 Bacteria 2987
311 Ga0495592_0041197 3300046454 Bacteria 3461
312 Ga0495592_0067689 3300046454 Bacteria 2609
313 Ga0495603_0000432 3300046455 Bacteria 23157
314 Ga0495603_0004703 3300046455 Bacteria 8150
315 Ga0495603_0017808 3300046455 Bacteria 4300
316 Ga0495603_0023243 3300046455 Bacteria 3753
317 Ga0495603_0044916 3300046455 Bacteria 2636
318 Ga0495603_0083251 3300046455 Bacteria 1874
319 Ga0495590_0006265 3300046457 Bacteria 4657
320 Ga0495591_016152 3300046458 Bacteria 2612
321 Ga0495629_0000137 3300046459 Bacteria 64048
322 Ga0495629_0000347 3300046459 Bacteria 39466
323 Ga0495629_0000758 3300046459 Bacteria 26094
324 Ga0495629_0004710 3300046459 Bacteria 10227
325 Ga0495629_0010287 3300046459 Bacteria 6813
326 Ga0495638_0041726 3300046460 Bacteria 2901
327 Ga0495638_0153937 3300046460 Bacteria 1332
328 Ga0495641_0052581 3300046461 Bacteria 1856
329 Ga0495651_0021068 3300046462 Bacteria 5063
330 Ga0495651_0077536 3300046462 Bacteria 2515
331 Ga0495651_0129351 3300046462 Bacteria 1845
332 Ga0495653_0016732 3300046463 Bacteria 5968
333 Ga0495653_0031831 3300046463 Bacteria 4191
334 Ga0495653_0042704 3300046463 Bacteria 3529
335 Ga0495653_0102067 3300046463 Bacteria 2076
336 Ga0495653_0105652 3300046463 Bacteria 2032
337 Ga0495650_0000226 3300046471 Bacteria 115930
338 Ga0495650_0001557 3300046471 Bacteria 21647
339 Ga0495650_0023006 3300046471 Bacteria 2976
340 Ga0495650_0043016 3300046471 Bacteria 1920
341 Ga0495580_0002469 3300046472 Bacteria 16138
342 Ga0495580_0005277 3300046472 Bacteria 10731
343 Ga0495580_0010665 3300046472 Bacteria 7138
344 Ga0495580_0011546 3300046472 Bacteria 6832
345 Ga0495580_0016508 3300046472 Bacteria 5538
346 Ga0495580_0027162 3300046472 Bacteria 4166
347 Ga0495580_0032626 3300046472 Bacteria 3756
348 Ga0495580_0110289 3300046472 Bacteria 1911
349 Ga0495582_0003427 3300046473 Bacteria 8931
350 Ga0495582_0016330 3300046473 Bacteria 4067
351 Ga0495582_0037686 3300046473 Bacteria 2659
352 Ga0495582_0074436 3300046473 Bacteria 1880
353 Ga0495605_0001460 3300046474 Bacteria 15450
354 Ga0495605_0014706 3300046474 Bacteria 4278
355 Ga0495639_0098240 3300046475 Bacteria 1380
356 Ga0495662_0088412 3300046476 Bacteria 1509
357 Ga0495596_0011323 3300046500 Bacteria 3852
358 Ga0495596_0040977 3300046500 Bacteria 1827
359 Ga0495607_0112677 3300046501 Bacteria 1440
360 Ga0495583_0010285 3300046506 Bacteria 5474
361 Ga0495583_0025118 3300046506 Bacteria 2981
362 Ga0495606_0000066 3300046507 Bacteria 181028
363 Ga0495606_0011252 3300046507 Bacteria 7322
364 Ga0495606_0027111 3300046507 Bacteria 4068
365 Ga0495606_0041979 3300046507 Bacteria 3063
366 Ga0495606_0048529 3300046507 Bacteria 2791
367 Ga0495608_0025099 3300046511 Bacteria 4070
368 Ga0495610_0000745 3300046512 Bacteria 30877
369 Ga0495616_0032089 3300046513 Bacteria 2747
370 Ga0495618_0006257 3300046514 Bacteria 7224
371 Ga0495618_0012697 3300046514 Bacteria 5119
372 Ga0495618_0106703 3300046514 Bacteria 1793
373 Ga0495620_0009291 3300046515 Bacteria 5235
374 Ga0495628_0000137 3300046516 Bacteria 62400
375 Ga0495628_0006690 3300046516 Bacteria 10051
376 Ga0495628_0012413 3300046516 Bacteria 7186
377 Ga0495628_0039092 3300046516 Bacteria 3795
378 Ga0495628_0146128 3300046516 Bacteria 1802
379 Ga0495628_0159712 3300046516 Bacteria 1713
380 Ga0495630_0031819 3300046517 Bacteria 3929
381 Ga0495630_0033475 3300046517 Bacteria 3833
382 Ga0495648_0032651 3300046524 Bacteria 3412
383 Ga0495648_0065198 3300046524 Bacteria 2142
384 Ga0495648_0069447 3300046524 Bacteria 2050
385 Ga0495666_0006163 3300046526 Bacteria 6033
386 Ga0495666_0007979 3300046526 Bacteria 5301
387 Ga0495666_0015305 3300046526 Bacteria 3819
388 Ga0495642_0000414 3300046528 Bacteria 22851
389 Ga0495642_0004007 3300046528 Bacteria 5757
390 Ga0495642_0036471 3300046528 Bacteria 1987
391 Ga0495642_0058902 3300046528 Bacteria 1591
392 Ga0495652_0002204 3300046529 Bacteria 20452
393 Ga0495652_0006929 3300046529 Bacteria 10486
394 Ga0495652_0028672 3300046529 Bacteria 4895
395 Ga0495652_0113038 3300046529 Bacteria 2180
396 Ga0495652_0163685 3300046529 Bacteria 1724
397 Ga0495665_0004525 3300046531 Bacteria 7504
398 Ga0495665_0012093 3300046531 Bacteria 4672
399 Ga0495665_0020916 3300046531 Bacteria 3515
400 Ga0495665_0031143 3300046531 Bacteria 2855
401 Ga0495665_0033039 3300046531 Bacteria 2767
402 Ga0495640_0009812 3300046533 Bacteria 7432
403 Ga0495640_0031426 3300046533 Bacteria 3789
404 Ga0495640_0033955 3300046533 Bacteria 3622
405 Ga0495586_0033197 3300046535 Bacteria 2770
406 Ga0495586_0040132 3300046535 Bacteria 2517
407 Ga0495586_0086126 3300046535 Bacteria 1731
408 Ga0495587_0037065 3300046536 Bacteria 2930
409 Ga0495645_0000199 3300046543 Bacteria 42823
410 Ga0495645_0004719 3300046543 Bacteria 9313
411 Ga0495645_0007467 3300046543 Bacteria 7610
412 Ga0495645_0065787 3300046543 Bacteria 2622
413 Ga0495645_0129632 3300046543 Bacteria 1768
414 Ga0495622_0000287 3300046557 Bacteria 38482
415 Ga0495667_0097216 3300046559 Bacteria 1906
416 Ga0495634_0030733 3300046642 Bacteria 3705
417 Ga0495635_0019299 3300046663 Bacteria 4754
418 Ga0495635_0111480 3300046663 Bacteria 1869
419 Ga0495661_0013584 3300046665 Bacteria 5466
420 Ga0495588_0046604 3300046674 Bacteria 2224
421 Ga0495599_0000974 3300046678 Bacteria 16022
422 Ga0495599_0007611 3300046678 Bacteria 6577
423 Ga0495599_0059721 3300046678 Bacteria 2385
424 Ga0495623_0018295 3300046679 Bacteria 4525
425 Ga0495646_0005768 3300046680 Bacteria 7852
426 Ga0495646_0013419 3300046680 Bacteria 5209
427 Ga0495646_0068824 3300046680 Bacteria 2089
428 Ga0495669_0009043 3300046684 Bacteria 4198
429 Ga0495613_0016752 3300046689 Bacteria 5457
430 Ga0495613_0052563 3300046689 Bacteria 3000
431 Ga0495613_0065291 3300046689 Bacteria 2660
432 Ga0495624_0002935 3300046690 Bacteria 12761
433 Ga0495624_0007690 3300046690 Bacteria 7559
434 Ga0495624_0009295 3300046690 Bacteria 6810
435 Ga0495624_0040062 3300046690 Bacteria 3001
436 Ga0495624_0085892 3300046690 Bacteria 1943
437 Ga0495671_0025478 3300046692 Bacteria 3074
438 Ga0495649_0004871 3300046694 Bacteria 8674
439 Ga0495649_0011631 3300046694 Bacteria 5156
440 Ga0495589_0020527 3300046794 Bacteria 3378
441 Ga0495589_0034978 3300046794 Bacteria 2520
442 Ga0495589_0084239 3300046794 Bacteria 1545
443 Ga0495600_0002755 3300046809 Bacteria 10182
444 Ga0495600_0041504 3300046809 Bacteria 2998
445 Ga0495581_0006112 3300047315 Bacteria 6979
446 Ga0495604_0002589 3300047317 Bacteria 14489
447 Ga0495604_0026260 3300047317 Bacteria 4637
448 Ga0495604_0165128 3300047317 Bacteria 1561
449 Ga0495674_0010307 3300047319 Bacteria 8849
450 Ga0495674_0013082 3300047319 Bacteria 7807
451 Ga0495674_0027005 3300047319 Bacteria 5250
452 Ga0495674_0068948 3300047319 Bacteria 3059
453 Ga0495674_0075082 3300047319 Bacteria 2909
454 Ga0495672_0001027 3300047320 Bacteria 28668
455 Ga0495672_0001926 3300047320 Bacteria 19623
456 Ga0495672_0039454 3300047320 Bacteria 2870
457 Ga0495676_0054518 3300047321 Bacteria 3178
458 Ga0495676_0083231 3300047321 Bacteria 2418
459 Ga0495680_0023547 3300047322 Bacteria 5117
460 Ga0495680_0027997 3300047322 Bacteria 4624
461 Ga0495680_0068214 3300047322 Bacteria 2718
462 Ga0495680_0079995 3300047322 Bacteria 2470
463 Ga0495683_0001001 3300047323 Bacteria 19747
464 Ga0495683_0026531 3300047323 Bacteria 2965
465 Ga0495683_0032946 3300047323 Bacteria 2638
466 Ga0495687_000005 3300047443 Bacteria 610401
467 Ga0495687_000021 3300047443 Bacteria 334681
468 Ga0495687_003872 3300047443 Bacteria 10509
469 Ga0495687_007444 3300047443 Bacteria 6445
470 Ga0495687_008078 3300047443 Bacteria 6080
471 Ga0495687_025058 3300047443 Bacteria 2826
472 Ga0495687_045002 3300047443 Bacteria 1914
473 Ga0495675_0118482 3300047444 Bacteria 1649
474 Ga0495679_000013 3300047446 Bacteria 313222
475 Ga0495679_000885 3300047446 Bacteria 18761
476 Ga0495679_009825 3300047446 Bacteria 3798
477 Ga0495673_0018628 3300047469 Bacteria 3496
478 Ga0495673_0026075 3300047469 Bacteria 2799
479 Ga0495686_0000081 3300047472 Bacteria 201295
480 Ga0495593_0005939 3300047673 Bacteria 7193
481 Ga0495593_0008969 3300047673 Bacteria 5805
482 Ga0495593_0026977 3300047673 Bacteria 3165
483 Ga0495593_0036021 3300047673 Bacteria 2684
484 Ga0495593_0059737 3300047673 Bacteria 1997
485 Ga0495602_0005107 3300048088 Bacteria 13752
486 Ga0495602_0021462 3300048088 Bacteria 6355
487 Ga0495602_0143927 3300048088 Bacteria 1883
488 Ga0495614_0010574 3300048089 Bacteria 4069
489 Ga0495614_0017139 3300048089 Bacteria 3147
490 Ga0495626_0009632 3300048091 Bacteria 5212
491 Ga0496100_0000378 3300048903 Bacteria 21717
492 Ga0496100_0000628 3300048903 Bacteria 16749
493 Ga0496100_0189151 3300048903 Bacteria 1493
494 Ga0496101_0000204 3300048904 Bacteria 45284
495 Ga0496101_0000412 3300048904 Bacteria 27673
496 Ga0496101_0053512 3300048904 Bacteria 2913
497 Ga0496101_0103806 3300048904 Bacteria 2131
498 Ga0496102_0000298 3300048905 Bacteria 63657
499 Ga0496102_0001948 3300048905 Bacteria 17797
500 Ga0496102_0017679 3300048905 Bacteria 6250
501 Ga0496103_0000253 3300048906 Bacteria 51430
502 Ga0496103_0018032 3300048906 Bacteria 4230
503 Ga0496104_0007649 3300048907 Bacteria 9566
504 Ga0496104_0047706 3300048907 Bacteria 4037
505 Ga0496104_0059412 3300048907 Bacteria 3620
506 Ga0496104_0062090 3300048907 Bacteria 3543
507 Ga0496104_0079598 3300048907 Bacteria 3124
508 Ga0496105_0008358 3300048908 Bacteria 8042
509 Ga0496105_0044120 3300048908 Bacteria 3676
510 Ga0496105_0066437 3300048908 Bacteria 2977
511 Ga0496105_0227523 3300048908 Bacteria 1516
512 Ga0496106_0197317 3300048909 Bacteria 1601
513 Ga0496107_0029899 3300048910 Bacteria 3880
514 Ga0496107_0059471 3300048910 Bacteria 2765
515 Ga0496107_0078328 3300048910 Bacteria 2408
516 Ga0496110_0000857 3300048913 Bacteria 21461
517 Ga0496110_0035868 3300048913 Bacteria 4306
518 Ga0496110_0125994 3300048913 Bacteria 2311
519 Ga0496110_0155613 3300048913 Bacteria 2071
520 Ga0496110_0220248 3300048913 Bacteria 1726
521 Ga0496112_0004494 3300048915 Bacteria 11838
522 Ga0496113_0042818 3300048916 Bacteria 3347
523 Ga0496114_0000299 3300048917 Bacteria 36473
524 Ga0496114_0012267 3300048917 Bacteria 6858
525 Ga0496115_0087343 3300048918 Bacteria 2545
526 Ga0496115_0259141 3300048918 Bacteria 1430
527 Ga0496116_0024193 3300048919 Bacteria 4498
528 Ga0496117_0000171 3300048920 Bacteria 135051
529 Ga0496117_0003808 3300048920 Bacteria 17184
530 Ga0496117_0003944 3300048920 Bacteria 16784
531 Ga0496117_0010066 3300048920 Bacteria 8686
532 Ga0496117_0015912 3300048920 Bacteria 6373
533 Ga0496117_0016201 3300048920 Bacteria 6300
534 Ga0496118_0000276 3300048921 Bacteria 90379
535 Ga0496118_0001274 3300048921 Bacteria 38638
536 Ga0496118_0001751 3300048921 Bacteria 31501
537 Ga0496118_0004406 3300048921 Bacteria 16720
538 Ga0496118_0013254 3300048921 Bacteria 7818
539 Ga0496118_0022028 3300048921 Bacteria 5587
540 Ga0496121_0001129 3300048924 Bacteria 46851
541 Ga0496121_0005700 3300048924 Bacteria 15826
542 Ga0496121_0005701 3300048924 Bacteria 15822
543 Ga0496121_0023755 3300048924 Bacteria 5890
544 Ga0496121_0049892 3300048924 Bacteria 3542
545 Ga0496122_0047498 3300048925 Bacteria 3314
546 Ga0496124_0000003 3300048927 Bacteria 1300161
547 Ga0496126_0004750 3300048929 Bacteria 16019
548 Ga0496126_0007120 3300048929 Bacteria 12321
549 Ga0495678_023955 3300049459 Bacteria 2644
550 Ga0501032_0011514 3300049569 Bacteria 6354
551 Ga0501034_0000326 3300049571 Bacteria 83622
552 Ga0501034_0008301 3300049571 Bacteria 10992
553 Ga0501034_0016737 3300049571 Bacteria 7518
554 Ga0501034_0081321 3300049571 Bacteria 3242
555 Ga0501034_0167184 3300049571 Bacteria 2168
556 Ga0501034_0299448 3300049571 Bacteria 1545
557 Ga0501037_0000230 3300049573 Bacteria 48351
558 Ga0501037_0031473 3300049573 Bacteria 3917
559 Ga0501038_0011745 3300049574 Bacteria 7990
560 Ga0501039_0000219 3300049575 Bacteria 41841
561 Ga0501040_0010040 3300049576 Bacteria 6183
562 Ga0501043_0000025 3300049579 Bacteria 149850
563 Ga0501043_0006291 3300049579 Bacteria 9534
564 Ga0501047_0077543 3300049581 Bacteria 3196
565 Ga0501073_0001040 3300049589 Bacteria 20052
566 Ga0501080_0009567 3300049742 Bacteria 8848
567 Ga0501083_0101466 3300049744 Bacteria 1897
568 Ga0501035_0128535 3300049822 Bacteria 2210
569 Ga0501044_0001836 3300049823 Bacteria 24727
570 Ga0501044_0076547 3300049823 Bacteria 3395
571 Ga0501045_0089574 3300049824 Bacteria 2273
572 Ga0500595_000593 3300053119 Bacteria 21550
573 Ga0500574_002716 3300053141 Bacteria 2975
574 Ga0500616_0014806 3300053153 Bacteria 4472
575 Ga0500619_000553 3300053154 Bacteria 6389
576 Ga0587083_0011409 3300059505 Bacteria 1465
577 Ga0587067_006924 3300059640 Bacteria 1602
578 Ga0587072_003250 3300059643 Bacteria 2266
579 Ga0501082_0000003 3300060353 Bacteria 170684
580 Ga0501082_0108693 3300060353 Bacteria 2400
581 Ga0466962_0002106 3300061719 Bacteria 9409
582 Ga0466962_0003684 3300061719 Bacteria 7303
583 Ga0466962_0004737 3300061719 Bacteria 6537
584 Ga0530510_0003134 3300061734 Bacteria 11352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0042704 Ga0495653_0042704_12_1151 372
2 3300046460 Ga0495638_0041726 Ga0495638_0041726_779_2107 378
3 iso_pu_bacteria 2921643360 2921653919 378
4 3300046680 Ga0495646_0068824 Ga0495646_0068824_694_1833 379
5 iso_pu_bacteria 2904615490 2904617637 382
6 3300048913 Ga0496110_0155613 Ga0496110_0155613_891_2051 383
7 3300049569 Ga0501032_0011514 Ga0501032_0011514_635_1846 396
8 3300053153 Ga0500616_0014806 Ga0500616_0014806_1016_2344 396
9 iso_pu_bacteria 2858438669 2858440781 403
10 iso_pu_bacteria 2928519762 2928520291 403
11 3300037418 Ga0395900_0101315 Ga0395900_0101315_1723_2943 406
12 3300046689 Ga0495613_0065291 Ga0495613_0065291_1007_2230 407
13 3300047673 Ga0495593_0059737 Ga0495593_0059737_523_1773 408
14 3300046535 Ga0495586_0040132 Ga0495586_0040132_376_1629 409
15 3300048907 Ga0496104_0007649 Ga0496104_0007649_3523_4767 409
16 3300048908 Ga0496105_0066437 Ga0496105_0066437_1173_2417 409
17 3300048910 Ga0496107_0078328 Ga0496107_0078328_149_1393 409
18 3300061734 Ga0530510_0003134 Ga0530510_0003134_2352_3614 409
19 3300005439 Ga0070711_100000008 Ga0070711_100000008115 410
20 3300005439 Ga0070711_100018442 Ga0070711_1000184421 410
21 3300005530 Ga0070679_100048109 Ga0070679_1000481092 410
22 3300025916 Ga0207663_10000023 Ga0207663_100000237 410
23 3300025916 Ga0207663_10013832 Ga0207663_100138325 410
24 3300037471 Ga0395905_0001161 Ga0395905_0001161_20089_21330 410
25 3300048913 Ga0496110_0000857 Ga0496110_0000857_3033_4265 410
26 3300048927 Ga0496124_0000003 Ga0496124_0000003_1155775_1157007 410
27 3300049573 Ga0501037_0000230 Ga0501037_0000230_11706_12965 410
28 3300049575 Ga0501039_0000219 Ga0501039_0000219_11698_12957 410
29 3300049576 Ga0501040_0010040 Ga0501040_0010040_1989_3248 410
30 3300049579 Ga0501043_0000025 Ga0501043_0000025_111917_113176 410
31 3300049824 Ga0501045_0089574 Ga0501045_0089574_415_1674 410
32 iso_pu_bacteria 8015556637 8015557332 410
33 3300005458 Ga0070681_10001701 Ga0070681_100017013 411
34 3300005530 Ga0070679_100100214 Ga0070679_1001002142 411
35 3300025912 Ga0207707_10000098 Ga0207707_1000009857 411
36 3300025917 Ga0207660_10079740 Ga0207660_100797402 411
37 3300025949 Ga0207667_10073993 Ga0207667_100739933 411
38 3300025949 Ga0207667_10228092 Ga0207667_102280922 411
39 3300028577 Ga0265318_10013761 Ga0265318_100137613 411
40 3300028800 Ga0265338_10001766 Ga0265338_100017667 411
41 3300028800 Ga0265338_10019124 Ga0265338_100191243 411
42 3300031240 Ga0265320_10033832 Ga0265320_100338322 411
43 3300031595 Ga0265313_10008523 Ga0265313_100085234 411
44 3300031711 Ga0265314_10006743 Ga0265314_100067434 411
45 3300046455 Ga0495603_0017808 Ga0495603_0017808_2600_3874 411
46 3300046472 Ga0495580_0032626 Ga0495580_0032626_450_1724 411
47 3300046516 Ga0495628_0146128 Ga0495628_0146128_450_1724 411
48 3300046524 Ga0495648_0032651 Ga0495648_0032651_1024_2298 411
49 3300046531 Ga0495665_0020916 Ga0495665_0020916_883_2157 411
50 3300046533 Ga0495640_0031426 Ga0495640_0031426_481_1755 411
51 3300046535 Ga0495586_0033197 Ga0495586_0033197_1123_2397 411
52 3300046689 Ga0495613_0016752 Ga0495613_0016752_2444_3718 411
53 3300046690 Ga0495624_0002935 Ga0495624_0002935_8012_9286 411
54 3300047315 Ga0495581_0006112 Ga0495581_0006112_3291_4565 411
55 3300047319 Ga0495674_0027005 Ga0495674_0027005_852_2126 411
56 3300047446 Ga0495679_009825 Ga0495679_009825_2151_3425 411
57 3300047673 Ga0495593_0008969 Ga0495593_0008969_2372_3646 411
58 3300048089 Ga0495614_0017139 Ga0495614_0017139_133_1407 411
59 3300049571 Ga0501034_0000326 Ga0501034_0000326_38895_40163 411
60 3300049571 Ga0501034_0008301 Ga0501034_0008301_2416_3684 411
61 3300049571 Ga0501034_0016737 Ga0501034_0016737_5069_6337 411
62 3300049571 Ga0501034_0167184 Ga0501034_0167184_40_1308 411
63 3300049571 Ga0501034_0299448 Ga0501034_0299448_86_1354 411
64 3300049573 Ga0501037_0031473 Ga0501037_0031473_1719_2987 411
65 3300060353 Ga0501082_0000003 Ga0501082_0000003_158227_159495 411
66 iso_pu_bacteria 2617270889 2617916900 411
67 iso_pu_bacteria 2913939268 2913940681 411
68 iso_pu_bacteria 642555144 642604099 411
69 3300005329 Ga0070683_100191065 Ga0070683_1001910651 412
70 3300046543 Ga0495645_0065787 Ga0495645_0065787_493_1767 412
71 3300048913 Ga0496110_0220248 Ga0496110_0220248_55_1314 412
72 3300049571 Ga0501034_0081321 Ga0501034_0081321_1645_2910 412
73 iso_pu_bacteria 2901300506 2901309054 414
74 3300047322 Ga0495680_0068214 Ga0495680_0068214_332_1603 415
75 3300046536 Ga0495587_0037065 Ga0495587_0037065_234_1556 417
76 3300048918 Ga0496115_0259141 Ga0496115_0259141_11_1273 418
77 iso_pu_bacteria 2818991436 2819544288 418
78 iso_pu_bacteria 2501025501 2501069941 420
79 iso_pu_bacteria 2501025504 2501412067 420
80 iso_pu_bacteria 2508501125 2509127723 420
81 iso_pu_bacteria 2510065045 2510249403 420
82 iso_pu_bacteria 2510917014 2511101061 420
83 iso_pu_bacteria 2510917015 2511107195 420
84 iso_pu_bacteria 2513237082 2513554943 420
85 iso_pu_bacteria 2513237082 2513555170 420
86 iso_pu_bacteria 2513237083 2513563058 420
87 iso_pu_bacteria 2513237083 2513566141 420
88 iso_pu_bacteria 2513237151 2513962915 420
89 iso_pu_bacteria 2513237165 2514045206 420
90 iso_pu_bacteria 2513237166 2514049670 420
91 iso_pu_bacteria 2513237166 2514052735 420
92 iso_pu_bacteria 2515154122 2515680022 420
93 iso_pu_bacteria 2515154122 2515682827 420
94 iso_pu_bacteria 2515154123 2515688110 420
95 iso_pu_bacteria 2515154123 2515692270 420
96 iso_pu_bacteria 2515154189 2516019133 420
97 iso_pu_bacteria 2515154189 2516021963 420
98 iso_pu_bacteria 2519103095 2519460330 420
99 iso_pu_bacteria 2526164713 2527076403 420
100 iso_pu_bacteria 2562617112 2563056717 420
101 iso_pu_bacteria 2562617112 2563057240 420
102 iso_pu_bacteria 2599185178 2599448561 420
103 iso_pu_bacteria 2599185239 2599741301 420
104 iso_pu_bacteria 2599185240 2599747287 420
105 iso_pu_bacteria 2599185355 2600209088 420
106 iso_pu_bacteria 2675903129 2676745116 420
107 iso_pu_bacteria 2711768613 2713474066 420
108 iso_pu_bacteria 2711768613 2713481272 420
109 iso_pu_bacteria 2718217991 2719642190 420
110 iso_pu_bacteria 2738541296 2738824179 420
111 iso_pu_bacteria 2738541298 2738836946 420
112 iso_pu_bacteria 2738541306 2738878477 420
113 iso_pu_bacteria 2738543002 2739190149 420
114 iso_pu_bacteria 2738543008 2739225070 420
115 iso_pu_bacteria 2744054900 2746084746 420
116 iso_pu_bacteria 2744054901 2746093089 420
117 iso_pu_bacteria 2751185846 2753568203 420
118 iso_pu_bacteria 2751185846 2753570486 420
119 iso_pu_bacteria 2791355137 2792835469 420
120 iso_pu_bacteria 2791355137 2792839348 420
121 iso_pu_bacteria 2816332253 2817257877 420
122 iso_pu_bacteria 2816332256 2817281732 420
123 iso_pu_bacteria 2816332286 2817456013 420
124 iso_pu_bacteria 2818991450 2819620092 420
125 iso_pu_bacteria 2818991450 2819622426 420
126 iso_pu_bacteria 2818991452 2819635219 420
127 iso_pu_bacteria 2842324504 2842332516 420
128 iso_pu_bacteria 2842348783 2842356919 420
129 iso_pu_bacteria 2842454564 2842461383 420
130 iso_pu_bacteria 2856287931 2856289818 420
131 iso_pu_bacteria 2857357740 2857363142 420
132 iso_pu_bacteria 2863421361 2863424369 420
133 iso_pu_bacteria 2870068957 2870073540 420
134 iso_pu_bacteria 2883087390 2883087757 420
135 iso_pu_bacteria 2883087390 2883089277 420
136 iso_pu_bacteria 2885270888 2885275279 420
137 iso_pu_bacteria 2885270888 2885279546 420
138 iso_pu_bacteria 2900634093 2900640598 420
139 iso_pu_bacteria 2900634093 2900641057 420
140 iso_pu_bacteria 2900634093 2900643067 420
141 iso_pu_bacteria 2902682994 2902684362 420
142 iso_pu_bacteria 2902682994 2902688728 420
143 iso_pu_bacteria 2904483920 2904485102 420
144 iso_pu_bacteria 2904483920 2904485782 420
145 iso_pu_bacteria 2904564687 2904567535 420
146 iso_pu_bacteria 2904571731 2904574580 420
147 iso_pu_bacteria 2919527303 2919530827 420
148 iso_pu_bacteria 2919527303 2919532564 420
149 iso_pu_bacteria 2928108538 2928110350 420
150 iso_pu_bacteria 2928108538 2928111851 420
151 iso_pu_bacteria 2928135762 2928138516 420
152 iso_pu_bacteria 2928135762 2928139090 420
153 iso_pu_bacteria 2928157003 2928158375 420
154 iso_pu_bacteria 2928163908 2928167415 420
155 iso_pu_bacteria 2928170801 2928177040 420
156 iso_pu_bacteria 2928503688 2928505422 420
157 iso_pu_bacteria 2928503688 2928508788 420
158 iso_pu_bacteria 2928536128 2928540304 420
159 iso_pu_bacteria 2945934425 2945939274 420
160 iso_pu_bacteria 2981990288 2981991838 420
161 iso_pu_bacteria 2990703756 2990706613 420
162 iso_pu_bacteria 641736151 642426489 420
163 iso_pu_bacteria 641736154 642414209 420
164 iso_pu_bacteria 642555112 642595093 420
165 iso_pu_bacteria 642555112 642598522 420
166 iso_pu_bacteria 642555113 642616154 420
167 iso_pu_bacteria 8003955200 8003956189 420
168 iso_pu_bacteria 8003955200 8003959141 420
169 iso_pu_bacteria 8018845410 8018850234 420
170 iso_pu_bacteria 8020807995 8020812225 420
171 iso_pu_bacteria 8020938398 8020941189 420
172 iso_pu_bacteria 8020945358 8020946708 420
173 iso_pu_bacteria 8020953355 8020958319 420
174 iso_pu_bacteria 8021120328 8021123896 420
175 iso_pu_bacteria 8040167225 8040170744 420
176 iso_pu_bacteria 8040173305 8040176949 420
177 iso_pu_bacteria 8055266321 8055271601 420
178 iso_pu_bacteria 8055266321 8055272677 420
179 iso_pu_bacteria 8055301274 8055306581 420
180 3300002737 JGI25162J39368_1000052 JGI25162J39368_100005285 422
181 3300003214 JGI25165J46597_1000105 JGI25165J46597_100010567 422
182 3300003751 Ga0055538_1000043 Ga0055538_100004367 422
183 3300003752 Ga0055539_1000057 Ga0055539_100005767 422
184 3300003756 Ga0055533_1000071 Ga0055533_100007167 422
185 3300003759 Ga0055525_1000085 Ga0055525_100008567 422
186 3300003841 Ga0055541_1000044 Ga0055541_100004485 422
187 3300005327 Ga0070658_10048516 Ga0070658_100485164 422
188 3300005366 Ga0070659_100094113 Ga0070659_1000941132 422
189 3300014497 Ga0182008_10025257 Ga0182008_100252572 422
190 3300015262 Ga0182007_10003364 Ga0182007_100033644 422
191 3300025224 Ga0209784_100069 Ga0209784_10006969 422
192 3300025225 Ga0209566_100083 Ga0209566_10008369 422
193 3300025226 Ga0209674_100106 Ga0209674_10010669 422
194 3300025230 Ga0209563_100100 Ga0209563_10010069 422
195 3300025233 Ga0209437_100156 Ga0209437_10015669 422
196 3300025253 Ga0209677_100061 Ga0209677_10006169 422
197 3300025261 Ga0209233_1000165 Ga0209233_100016569 422
198 3300025909 Ga0207705_10052350 Ga0207705_100523501 422
199 3300025933 Ga0207706_10088231 Ga0207706_100882313 422
200 3300026142 Ga0207698_10071541 Ga0207698_100715413 422
201 3300037312 Ga0395899_0006229 Ga0395899_0006229_3661_4932 422
202 3300037312 Ga0395899_0074250 Ga0395899_0074250_993_2264 422
203 3300037471 Ga0395905_0000144 Ga0395905_0000144_59683_60954 422
204 3300037471 Ga0395905_0048375 Ga0395905_0048375_2033_3304 422
205 3300038443 Ga0395901_0046848 Ga0395901_0046848_1586_2857 422
206 3300046454 Ga0495592_0067689 Ga0495592_0067689_611_1879 422
207 3300046463 Ga0495653_0016732 Ga0495653_0016732_2836_4104 422
208 3300046471 Ga0495650_0000226 Ga0495650_0000226_26859_28130 422
209 3300046507 Ga0495606_0000066 Ga0495606_0000066_36812_38083 422
210 3300046514 Ga0495618_0006257 Ga0495618_0006257_2006_3274 422
211 3300046516 Ga0495628_0000137 Ga0495628_0000137_50454_51722 422
212 3300046516 Ga0495628_0039092 Ga0495628_0039092_463_1731 422
213 3300046524 Ga0495648_0069447 Ga0495648_0069447_195_1466 422
214 3300046528 Ga0495642_0036471 Ga0495642_0036471_527_1798 422
215 3300046529 Ga0495652_0002204 Ga0495652_0002204_6475_7743 422
216 3300046529 Ga0495652_0006929 Ga0495652_0006929_162_1430 422
217 3300046529 Ga0495652_0028672 Ga0495652_0028672_2188_3456 422
218 3300046543 Ga0495645_0007467 Ga0495645_0007467_2933_4201 422
219 3300046543 Ga0495645_0129632 Ga0495645_0129632_408_1676 422
220 3300046678 Ga0495599_0000974 Ga0495599_0000974_9589_10857 422
221 3300046679 Ga0495623_0018295 Ga0495623_0018295_1312_2580 422
222 3300046680 Ga0495646_0013419 Ga0495646_0013419_2244_3512 422
223 3300046690 Ga0495624_0085892 Ga0495624_0085892_152_1420 422
224 3300046809 Ga0495600_0002755 Ga0495600_0002755_8792_10060 422
225 3300047317 Ga0495604_0002589 Ga0495604_0002589_752_2020 422
226 3300048088 Ga0495602_0021462 Ga0495602_0021462_2836_4104 422
227 3300049823 Ga0501044_0001836 Ga0501044_0001836_9625_10914 422
228 3300053119 Ga0500595_000593 Ga0500595_000593_10901_12169 422
229 3300053141 Ga0500574_002716 Ga0500574_002716_213_1481 422
230 3300053154 Ga0500619_000553 Ga0500619_000553_716_1984 422
231 3300001989 JGI24739J22299_10006381 JGI24739J22299_100063812 423
232 3300002705 JGI25156J39149_1000718 JGI25156J39149_10007189 423
233 3300003354 JGI25160J50197_1000138 JGI25160J50197_100013817 423
234 3300003756 Ga0055533_1000317 Ga0055533_100031711 423
235 3300005262 Ga0065165_1001078 Ga0065165_100107822 423
236 3300009011 Ga0105251_10000043 Ga0105251_1000004355 423
237 3300015262 Ga0182007_10004520 Ga0182007_100045201 423
238 3300025206 Ga0209435_102220 Ga0209435_1022202 423
239 3300025226 Ga0209674_100157 Ga0209674_10015745 423
240 3300025228 Ga0209672_100188 Ga0209672_10018812 423
241 3300025256 Ga0209759_1000363 Ga0209759_100036349 423
242 3300025284 Ga0209130_1009846 Ga0209130_10098462 423
243 3300025302 Ga0207426_1000018 Ga0207426_1000018366 423
244 3300025735 Ga0207713_1000240 Ga0207713_100024063 423
245 3300025904 Ga0207647_10003472 Ga0207647_100034724 423
246 3300025913 Ga0207695_10114130 Ga0207695_101141302 423
247 3300025949 Ga0207667_10058573 Ga0207667_100585735 423
248 3300037312 Ga0395899_0000023 Ga0395899_0000023_344525_345820 423
249 3300037418 Ga0395900_0000019 Ga0395900_0000019_21340_22635 423
250 3300037418 Ga0395900_0000265 Ga0395900_0000265_38234_39529 423
251 3300037418 Ga0395900_0032838 Ga0395900_0032838_560_1855 423
252 3300037466 Ga0395898_0000016 Ga0395898_0000016_16489_17784 423
253 3300037466 Ga0395898_0127450 Ga0395898_0127450_906_2201 423
254 3300037471 Ga0395905_0000009 Ga0395905_0000009_380278_381573 423
255 3300037471 Ga0395905_0033555 Ga0395905_0033555_345_1640 423
256 3300038443 Ga0395901_0000009 Ga0395901_0000009_438416_439711 423
257 3300038443 Ga0395901_0015476 Ga0395901_0015476_4908_6203 423
258 3300039447 Ga0436361_0501535 Ga0436361_0501535_1419_2714 423
259 3300044656 Ga0466969_0002473 Ga0466969_0002473_7322_8617 423
260 3300044683 Ga0466965_0001437 Ga0466965_0001437_5736_7031 423
261 3300044684 Ga0466966_0001052 Ga0466966_0001052_16119_17414 423
262 3300044684 Ga0466966_0010696 Ga0466966_0010696_1617_2912 423
263 3300044693 Ga0466961_0007719 Ga0466961_0007719_3253_4548 423
264 3300044693 Ga0466961_0008980 Ga0466961_0008980_2289_3584 423
265 3300044706 Ga0466964_0007498 Ga0466964_0007498_1632_2927 423
266 3300044842 Ga0466957_0002727 Ga0466957_0002727_5374_6669 423
267 3300045049 Ga0466959_0013774 Ga0466959_0013774_4425_5720 423
268 3300045836 Ga0466958_0009929 Ga0466958_0009929_134_1429 423
269 3300046455 Ga0495603_0000432 Ga0495603_0000432_13174_14469 423
270 3300046455 Ga0495603_0023243 Ga0495603_0023243_204_1499 423
271 3300046459 Ga0495629_0000347 Ga0495629_0000347_8762_10057 423
272 3300046462 Ga0495651_0129351 Ga0495651_0129351_375_1670 423
273 3300046471 Ga0495650_0001557 Ga0495650_0001557_8782_10077 423
274 3300046472 Ga0495580_0002469 Ga0495580_0002469_1734_3029 423
275 3300046472 Ga0495580_0027162 Ga0495580_0027162_1607_2902 423
276 3300046473 Ga0495582_0003427 Ga0495582_0003427_6661_7956 423
277 3300046475 Ga0495639_0098240 Ga0495639_0098240_14_1309 423
278 3300046500 Ga0495596_0040977 Ga0495596_0040977_244_1539 423
279 3300046507 Ga0495606_0011252 Ga0495606_0011252_4463_5758 423
280 3300046524 Ga0495648_0065198 Ga0495648_0065198_389_1684 423
281 3300046528 Ga0495642_0000414 Ga0495642_0000414_21172_22467 423
282 3300046528 Ga0495642_0058902 Ga0495642_0058902_194_1489 423
283 3300046529 Ga0495652_0163685 Ga0495652_0163685_113_1408 423
284 3300046543 Ga0495645_0000199 Ga0495645_0000199_32747_34042 423
285 3300046663 Ga0495635_0111480 Ga0495635_0111480_138_1433 423
286 3300046674 Ga0495588_0046604 Ga0495588_0046604_688_1983 423
287 3300046689 Ga0495613_0052563 Ga0495613_0052563_365_1660 423
288 3300046694 Ga0495649_0011631 Ga0495649_0011631_2566_3861 423
289 3300047323 Ga0495683_0001001 Ga0495683_0001001_11110_12405 423
290 3300047443 Ga0495687_000005 Ga0495687_000005_361752_363047 423
291 3300047443 Ga0495687_003872 Ga0495687_003872_2502_3797 423
292 3300048091 Ga0495626_0009632 Ga0495626_0009632_3862_5157 423
293 3300048904 Ga0496101_0103806 Ga0496101_0103806_616_1911 423
294 3300048907 Ga0496104_0059412 Ga0496104_0059412_141_1436 423
295 3300048907 Ga0496104_0079598 Ga0496104_0079598_74_1369 423
296 3300048908 Ga0496105_0044120 Ga0496105_0044120_1848_3143 423
297 3300048908 Ga0496105_0227523 Ga0496105_0227523_93_1388 423
298 3300048917 Ga0496114_0000299 Ga0496114_0000299_6358_7653 423
299 3300048918 Ga0496115_0087343 Ga0496115_0087343_260_1555 423
300 3300048919 Ga0496116_0024193 Ga0496116_0024193_2629_3924 423
301 3300048920 Ga0496117_0016201 Ga0496117_0016201_805_2100 423
302 3300048921 Ga0496118_0001274 Ga0496118_0001274_30978_32273 423
303 3300049574 Ga0501038_0011745 Ga0501038_0011745_5516_6826 423
304 3300049579 Ga0501043_0006291 Ga0501043_0006291_7269_8579 423
305 3300049581 Ga0501047_0077543 Ga0501047_0077543_669_1979 423
306 3300049589 Ga0501073_0001040 Ga0501073_0001040_3006_4316 423
307 3300049742 Ga0501080_0009567 Ga0501080_0009567_5240_6550 423
308 3300049744 Ga0501083_0101466 Ga0501083_0101466_64_1374 423
309 3300049822 Ga0501035_0128535 Ga0501035_0128535_671_1981 423
310 3300049823 Ga0501044_0076547 Ga0501044_0076547_1274_2584 423
311 3300060353 Ga0501082_0108693 Ga0501082_0108693_332_1642 423
312 iso_pu_bacteria 2738541281 2738745255 423
313 iso_pu_bacteria 2738543032 2739354485 423
314 iso_pu_bacteria 2837678835 2837682581 423
315 iso_pu_bacteria 2889306138 2889310006 423
316 iso_pu_bacteria 2902330777 2902333925 423
317 iso_pu_bacteria 3003665799 3003669170 423
318 3300001979 JGI24740J21852_10000031 JGI24740J21852_1000003121 424
319 3300001979 JGI24740J21852_10000333 JGI24740J21852_100003332 424
320 3300001979 JGI24740J21852_10011891 JGI24740J21852_100118914 424
321 3300001989 JGI24739J22299_10001631 JGI24739J22299_100016313 424
322 3300001989 JGI24739J22299_10002527 JGI24739J22299_1000252711 424
323 3300001990 JGI24737J22298_10009927 JGI24737J22298_100099272 424
324 3300002067 JGI24735J21928_10020765 JGI24735J21928_100207652 424
325 3300002705 JGI25156J39149_1000366 JGI25156J39149_10003666 424
326 3300002705 JGI25156J39149_1000389 JGI25156J39149_100038923 424
327 3300002705 JGI25156J39149_1000562 JGI25156J39149_10005624 424
328 3300002705 JGI25156J39149_1003583 JGI25156J39149_10035834 424
329 3300002705 JGI25156J39149_1004983 JGI25156J39149_10049834 424
330 3300002738 JGI25154J39366_1000271 JGI25154J39366_100027121 424
331 3300003187 JGI25151J46595_10005206 JGI25151J46595_100052063 424
332 3300003214 JGI25165J46597_1000717 JGI25165J46597_100071719 424
333 3300003751 Ga0055538_1000219 Ga0055538_100021915 424
334 3300003752 Ga0055539_1000233 Ga0055539_100023316 424
335 3300003756 Ga0055533_1000064 Ga0055533_100006434 424
336 3300003756 Ga0055533_1000247 Ga0055533_100024715 424
337 3300003756 Ga0055533_1001095 Ga0055533_10010954 424
338 3300003758 Ga0055532_1000013 Ga0055532_1000013336 424
339 3300003758 Ga0055532_1000245 Ga0055532_100024514 424
340 3300003759 Ga0055525_1000318 Ga0055525_100031816 424
341 3300003760 Ga0055527_1000010 Ga0055527_100001035 424
342 3300003760 Ga0055527_1000260 Ga0055527_100026014 424
343 3300003760 Ga0055527_1000468 Ga0055527_10004682 424
344 3300003760 Ga0055527_1000470 Ga0055527_10004702 424
345 3300003761 Ga0055535_1000010 Ga0055535_1000010336 424
346 3300003761 Ga0055535_1000431 Ga0055535_100043114 424
347 3300003761 Ga0055535_1001162 Ga0055535_10011622 424
348 3300003761 Ga0055535_1001166 Ga0055535_10011662 424
349 3300003762 Ga0055542_1000016 Ga0055542_1000016336 424
350 3300003762 Ga0055542_1000990 Ga0055542_100099012 424
351 3300003762 Ga0055542_1001151 Ga0055542_10011512 424
352 3300003762 Ga0055542_1003283 Ga0055542_10032832 424
353 3300003763 Ga0055529_1000012 Ga0055529_1000012336 424
354 3300003763 Ga0055529_1000517 Ga0055529_100051714 424
355 3300003763 Ga0055529_1000670 Ga0055529_10006702 424
356 3300003763 Ga0055529_1000746 Ga0055529_100074617 424
357 3300003790 Ga0055528_1002297 Ga0055528_10022976 424
358 3300003841 Ga0055541_1000113 Ga0055541_100011328 424
359 3300003841 Ga0055541_1000160 Ga0055541_100016015 424
360 3300005262 Ga0065165_1000810 Ga0065165_10008109 424
361 3300005327 Ga0070658_10003407 Ga0070658_100034075 424
362 3300005327 Ga0070658_10017930 Ga0070658_100179302 424
363 3300005327 Ga0070658_10056707 Ga0070658_100567072 424
364 3300005339 Ga0070660_100000006 Ga0070660_10000000684 424
365 3300005339 Ga0070660_100000507 Ga0070660_10000050711 424
366 3300005344 Ga0070661_100000348 Ga0070661_10000034814 424
367 3300005366 Ga0070659_100000082 Ga0070659_1000000824 424
368 3300005366 Ga0070659_100002151 Ga0070659_1000021514 424
369 3300005366 Ga0070659_100040921 Ga0070659_1000409212 424
370 3300005455 Ga0070663_100000069 Ga0070663_1000000696 424
371 3300005455 Ga0070663_100000075 Ga0070663_10000007518 424
372 3300005455 Ga0070663_100062773 Ga0070663_1000627731 424
373 3300005563 Ga0068855_100040376 Ga0068855_1000403763 424
374 3300005564 Ga0070664_100000191 Ga0070664_10000019115 424
375 3300005577 Ga0068857_100009953 Ga0068857_1000099533 424
376 3300005614 Ga0068856_100000504 Ga0068856_10000050419 424
377 3300005614 Ga0068856_100062220 Ga0068856_1000622202 424
378 3300005614 Ga0068856_100076217 Ga0068856_1000762172 424
379 3300005616 Ga0068852_100015182 Ga0068852_1000151823 424
380 3300009011 Ga0105251_10000127 Ga0105251_1000012717 424
381 3300009092 Ga0105250_10015150 Ga0105250_100151503 424
382 3300009093 Ga0105240_10004374 Ga0105240_100043743 424
383 3300009093 Ga0105240_10066046 Ga0105240_100660464 424
384 3300009093 Ga0105240_10142600 Ga0105240_101426002 424
385 3300009093 Ga0105240_10154226 Ga0105240_101542263 424
386 3300009093 Ga0105240_10256948 Ga0105240_102569482 424
387 3300009093 Ga0105240_10362086 Ga0105240_103620862 424
388 3300009545 Ga0105237_10175134 Ga0105237_101751341 424
389 3300010375 Ga0105239_10002079 Ga0105239_1000207911 424
390 3300010375 Ga0105239_10003831 Ga0105239_1000383114 424
391 3300013100 Ga0157373_10000358 Ga0157373_1000035814 424
392 3300013100 Ga0157373_10002832 Ga0157373_100028329 424
393 3300013102 Ga0157371_10000608 Ga0157371_1000060818 424
394 3300013102 Ga0157371_10008084 Ga0157371_100080845 424
395 3300013104 Ga0157370_10000690 Ga0157370_1000069017 424
396 3300013104 Ga0157370_10000852 Ga0157370_1000085211 424
397 3300013104 Ga0157370_10001717 Ga0157370_1000171710 424
398 3300013105 Ga0157369_10000120 Ga0157369_1000012025 424
399 3300013105 Ga0157369_10000743 Ga0157369_1000074321 424
400 3300013105 Ga0157369_10003555 Ga0157369_1000355510 424
401 3300013105 Ga0157369_10130895 Ga0157369_101308951 424
402 3300013296 Ga0157374_10000976 Ga0157374_1000097614 424
403 3300013307 Ga0157372_10000519 Ga0157372_1000051920 424
404 3300013307 Ga0157372_10003761 Ga0157372_1000376110 424
405 3300013308 Ga0157375_10010236 Ga0157375_100102366 424
406 3300015261 Ga0182006_1001401 Ga0182006_10014014 424
407 3300015262 Ga0182007_10000795 Ga0182007_1000079513 424
408 3300015262 Ga0182007_10030545 Ga0182007_100305451 424
409 3300016635 Ga0183361_10061 Ga0183361_100612 424
410 3300022467 Ga0224712_10000332 Ga0224712_100003324 424
411 3300025206 Ga0209435_104222 Ga0209435_1042222 424
412 3300025224 Ga0209784_100215 Ga0209784_10021515 424
413 3300025224 Ga0209784_100567 Ga0209784_1005673 424
414 3300025225 Ga0209566_100018 Ga0209566_100018376 424
415 3300025225 Ga0209566_100161 Ga0209566_10016130 424
416 3300025225 Ga0209566_100215 Ga0209566_10021527 424
417 3300025226 Ga0209674_100011 Ga0209674_10001132 424
418 3300025226 Ga0209674_100048 Ga0209674_100048286 424
419 3300025226 Ga0209674_100183 Ga0209674_10018343 424
420 3300025226 Ga0209674_100271 Ga0209674_10027115 424
421 3300025226 Ga0209674_102503 Ga0209674_1025032 424
422 3300025228 Ga0209672_100002 Ga0209672_10000232 424
423 3300025228 Ga0209672_100020 Ga0209672_100020163 424
424 3300025228 Ga0209672_100066 Ga0209672_100066103 424
425 3300025228 Ga0209672_100234 Ga0209672_10023418 424
426 3300025228 Ga0209672_100439 Ga0209672_10043917 424
427 3300025229 Ga0209147_100003 Ga0209147_10000332 424
428 3300025229 Ga0209147_100024 Ga0209147_100024163 424
429 3300025229 Ga0209147_100084 Ga0209147_10008464 424
430 3300025229 Ga0209147_100295 Ga0209147_10029515 424
431 3300025230 Ga0209563_100181 Ga0209563_10018115 424
432 3300025230 Ga0209563_101061 Ga0209563_1010612 424
433 3300025242 Ga0209258_100042 Ga0209258_100042328 424
434 3300025242 Ga0209258_100084 Ga0209258_100084163 424
435 3300025242 Ga0209258_100117 Ga0209258_10011764 424
436 3300025242 Ga0209258_100477 Ga0209258_10047715 424
437 3300025246 Ga0209646_1000046 Ga0209646_1000046253 424
438 3300025250 Ga0209026_1003728 Ga0209026_10037283 424
439 3300025253 Ga0209677_100230 Ga0209677_10023015 424
440 3300025253 Ga0209677_102128 Ga0209677_1021285 424
441 3300025254 Ga0209148_1000006 Ga0209148_100000632 424
442 3300025254 Ga0209148_1000148 Ga0209148_100014872 424
443 3300025254 Ga0209148_1000187 Ga0209148_100018761 424
444 3300025254 Ga0209148_1000785 Ga0209148_10007853 424
445 3300025254 Ga0209148_1003392 Ga0209148_10033921 424
446 3300025256 Ga0209759_1000002 Ga0209759_1000002891 424
447 3300025256 Ga0209759_1000032 Ga0209759_100003228 424
448 3300025256 Ga0209759_1000210 Ga0209759_100021032 424
449 3300025256 Ga0209759_1000587 Ga0209759_100058713 424
450 3300025256 Ga0209759_1003547 Ga0209759_10035474 424
451 3300025256 Ga0209759_1006120 Ga0209759_10061202 424
452 3300025256 Ga0209759_1011323 Ga0209759_10113232 424
453 3300025256 Ga0209759_1020077 Ga0209759_10200772 424
454 3300025261 Ga0209233_1000033 Ga0209233_1000033517 424
455 3300025263 Ga0209565_1009103 Ga0209565_10091032 424
456 3300025272 Ga0209455_1000003 Ga0209455_100000332 424
457 3300025272 Ga0209455_1000110 Ga0209455_100011064 424
458 3300025272 Ga0209455_1000362 Ga0209455_100036215 424
459 3300025272 Ga0209455_1001376 Ga0209455_10013762 424
460 3300025273 Ga0209673_1000057 Ga0209673_100005732 424
461 3300025284 Ga0209130_1004039 Ga0209130_10040392 424
462 3300025294 Ga0209025_1000123 Ga0209025_1000123141 424
463 3300025295 Ga0209564_1004896 Ga0209564_10048966 424
464 3300025302 Ga0207426_1000152 Ga0207426_1000152131 424
465 3300025735 Ga0207713_1000302 Ga0207713_100030216 424
466 3300025904 Ga0207647_10001027 Ga0207647_1000102716 424
467 3300025904 Ga0207647_10035914 Ga0207647_100359143 424
468 3300025909 Ga0207705_10003789 Ga0207705_100037895 424
469 3300025913 Ga0207695_10001113 Ga0207695_100011134 424
470 3300025913 Ga0207695_10006823 Ga0207695_1000682310 424
471 3300025913 Ga0207695_10036944 Ga0207695_100369443 424
472 3300025913 Ga0207695_10048057 Ga0207695_100480574 424
473 3300025913 Ga0207695_10102080 Ga0207695_101020802 424
474 3300025919 Ga0207657_10000003 Ga0207657_10000003168 424
475 3300025919 Ga0207657_10000885 Ga0207657_1000088520 424
476 3300025919 Ga0207657_10206949 Ga0207657_102069491 424
477 3300025920 Ga0207649_10000326 Ga0207649_1000032615 424
478 3300025924 Ga0207694_10019179 Ga0207694_100191793 424
479 3300025929 Ga0207664_10001839 Ga0207664_100018395 424
480 3300025932 Ga0207690_10000007 Ga0207690_10000007169 424
481 3300025932 Ga0207690_10000380 Ga0207690_1000038014 424
482 3300025932 Ga0207690_10076393 Ga0207690_100763932 424
483 3300025941 Ga0207711_10030210 Ga0207711_100302104 424
484 3300025945 Ga0207679_10000002 Ga0207679_1000000217 424
485 3300025949 Ga0207667_10006579 Ga0207667_100065798 424
486 3300025949 Ga0207667_10006899 Ga0207667_100068994 424
487 3300025949 Ga0207667_10030915 Ga0207667_100309152 424
488 3300025972 Ga0207668_10118111 Ga0207668_101181112 424
489 3300026067 Ga0207678_10000319 Ga0207678_1000031917 424
490 3300026067 Ga0207678_10001465 Ga0207678_100014652 424
491 3300026067 Ga0207678_10008540 Ga0207678_100085404 424
492 3300026078 Ga0207702_10000504 Ga0207702_1000050417 424
493 3300026078 Ga0207702_10049899 Ga0207702_100498994 424
494 3300026116 Ga0207674_10004306 Ga0207674_1000430612 424
495 3300026142 Ga0207698_10019094 Ga0207698_100190942 424
496 3300027312 Ga0209371_1000076 Ga0209371_100007610 424
497 3300030500 Ga0268256_1000087 Ga0268256_1000087127 424
498 3300030500 Ga0268256_1005103 Ga0268256_10051032 424
499 3300031548 Ga0307408_100004532 Ga0307408_1000045322 424
500 3300031911 Ga0307412_10000095 Ga0307412_1000009525 424
501 3300037312 Ga0395899_0000241 Ga0395899_0000241_35885_37159 424
502 3300037312 Ga0395899_0009358 Ga0395899_0009358_308_1717 424
503 3300037312 Ga0395899_0082115 Ga0395899_0082115_443_1717 424
504 3300037418 Ga0395900_0000633 Ga0395900_0000633_10413_11687 424
505 3300037418 Ga0395900_0001069 Ga0395900_0001069_16998_18329 424
506 3300037418 Ga0395900_0170678 Ga0395900_0170678_764_2038 424
507 3300037418 Ga0395900_0216467 Ga0395900_0216467_412_1686 424
508 3300037466 Ga0395898_0000016 Ga0395898_0000016_398647_399921 424
509 3300037466 Ga0395898_0001705 Ga0395898_0001705_4379_5653 424
510 3300037466 Ga0395898_0063824 Ga0395898_0063824_756_2030 424
511 3300037466 Ga0395898_0113022 Ga0395898_0113022_743_2017 424
512 3300037471 Ga0395905_0000048 Ga0395905_0000048_179301_180575 424
513 3300037471 Ga0395905_0077844 Ga0395905_0077844_1242_2516 424
514 3300038443 Ga0395901_0000081 Ga0395901_0000081_105679_106953 424
515 3300038443 Ga0395901_0000157 Ga0395901_0000157_64360_65634 424
516 3300038443 Ga0395901_0075354 Ga0395901_0075354_743_2017 424
517 3300042005 Ga0439448_0000277 Ga0439448_0000277_2346_3620 424
518 3300044656 Ga0466969_0000088 Ga0466969_0000088_22382_23656 424
519 3300044656 Ga0466969_0018108 Ga0466969_0018108_487_1761 424
520 3300044656 Ga0466969_0022794 Ga0466969_0022794_1463_2749 424
521 3300044683 Ga0466965_0002491 Ga0466965_0002491_1408_2682 424
522 3300044683 Ga0466965_0008150 Ga0466965_0008150_2221_3495 424
523 3300044684 Ga0466966_0000009 Ga0466966_0000009_38648_39922 424
524 3300044684 Ga0466966_0002581 Ga0466966_0002581_225_1499 424
525 3300044684 Ga0466966_0002666 Ga0466966_0002666_8748_10022 424
526 3300044693 Ga0466961_0000665 Ga0466961_0000665_19929_21203 424
527 3300044693 Ga0466961_0004003 Ga0466961_0004003_4527_5801 424
528 3300044693 Ga0466961_0005937 Ga0466961_0005937_3223_4497 424
529 3300044693 Ga0466961_0028566 Ga0466961_0028566_1602_2888 424
530 3300044694 Ga0466963_0002186 Ga0466963_0002186_3734_5008 424
531 3300044694 Ga0466963_0011644 Ga0466963_0011644_726_2000 424
532 3300044694 Ga0466963_0106362 Ga0466963_0106362_494_1768 424
533 3300044706 Ga0466964_0032652 Ga0466964_0032652_521_1795 424
534 3300044719 Ga0466971_0000802 Ga0466971_0000802_1073_2347 424
535 3300044719 Ga0466971_0000889 Ga0466971_0000889_7530_8804 424
536 3300044719 Ga0466971_0058805 Ga0466971_0058805_115_1389 424
537 3300044765 Ga0466970_0018084 Ga0466970_0018084_1393_2667 424
538 3300044765 Ga0466970_0030551 Ga0466970_0030551_371_1657 424
539 3300044842 Ga0466957_0002453 Ga0466957_0002453_5176_6450 424
540 3300045049 Ga0466959_0001627 Ga0466959_0001627_5190_6464 424
541 3300045049 Ga0466959_0047382 Ga0466959_0047382_1401_2687 424
542 3300045049 Ga0466959_0090733 Ga0466959_0090733_453_1727 424
543 3300045836 Ga0466958_0033906 Ga0466958_0033906_486_1760 424
544 3300045836 Ga0466958_0035276 Ga0466958_0035276_470_1744 424
545 3300046454 Ga0495592_0041197 Ga0495592_0041197_1758_3032 424
546 3300046455 Ga0495603_0004703 Ga0495603_0004703_5751_7025 424
547 3300046455 Ga0495603_0044916 Ga0495603_0044916_79_1353 424
548 3300046455 Ga0495603_0083251 Ga0495603_0083251_220_1563 424
549 3300046457 Ga0495590_0006265 Ga0495590_0006265_1658_2932 424
550 3300046458 Ga0495591_016152 Ga0495591_016152_837_2180 424
551 3300046459 Ga0495629_0000137 Ga0495629_0000137_3250_4524 424
552 3300046459 Ga0495629_0000758 Ga0495629_0000758_3840_5114 424
553 3300046459 Ga0495629_0004710 Ga0495629_0004710_4256_5530 424
554 3300046459 Ga0495629_0010287 Ga0495629_0010287_4208_5551 424
555 3300046460 Ga0495638_0153937 Ga0495638_0153937_24_1310 424
556 3300046461 Ga0495641_0052581 Ga0495641_0052581_178_1452 424
557 3300046462 Ga0495651_0021068 Ga0495651_0021068_3537_4880 424
558 3300046462 Ga0495651_0077536 Ga0495651_0077536_841_2115 424
559 3300046463 Ga0495653_0031831 Ga0495653_0031831_388_1662 424
560 3300046463 Ga0495653_0102067 Ga0495653_0102067_51_1325 424
561 3300046463 Ga0495653_0105652 Ga0495653_0105652_319_1662 424
562 3300046471 Ga0495650_0023006 Ga0495650_0023006_338_1639 424
563 3300046471 Ga0495650_0043016 Ga0495650_0043016_443_1717 424
564 3300046472 Ga0495580_0005277 Ga0495580_0005277_7767_9068 424
565 3300046472 Ga0495580_0010665 Ga0495580_0010665_1764_3038 424
566 3300046472 Ga0495580_0011546 Ga0495580_0011546_4903_6177 424
567 3300046472 Ga0495580_0016508 Ga0495580_0016508_1360_2634 424
568 3300046472 Ga0495580_0110289 Ga0495580_0110289_171_1445 424
569 3300046473 Ga0495582_0016330 Ga0495582_0016330_577_1851 424
570 3300046473 Ga0495582_0037686 Ga0495582_0037686_1254_2597 424
571 3300046473 Ga0495582_0074436 Ga0495582_0074436_285_1559 424
572 3300046474 Ga0495605_0001460 Ga0495605_0001460_2096_3370 424
573 3300046474 Ga0495605_0014706 Ga0495605_0014706_1736_3010 424
574 3300046476 Ga0495662_0088412 Ga0495662_0088412_225_1499 424
575 3300046500 Ga0495596_0011323 Ga0495596_0011323_2283_3557 424
576 3300046501 Ga0495607_0112677 Ga0495607_0112677_92_1366 424
577 3300046506 Ga0495583_0010285 Ga0495583_0010285_2381_3655 424
578 3300046506 Ga0495583_0025118 Ga0495583_0025118_232_1506 424
579 3300046507 Ga0495606_0027111 Ga0495606_0027111_655_1929 424
580 3300046507 Ga0495606_0041979 Ga0495606_0041979_458_1732 424
581 3300046507 Ga0495606_0048529 Ga0495606_0048529_506_1780 424
582 3300046511 Ga0495608_0025099 Ga0495608_0025099_1493_2767 424
583 3300046512 Ga0495610_0000745 Ga0495610_0000745_15507_16781 424
584 3300046513 Ga0495616_0032089 Ga0495616_0032089_428_1753 424
585 3300046514 Ga0495618_0012697 Ga0495618_0012697_2061_3404 424
586 3300046514 Ga0495618_0106703 Ga0495618_0106703_191_1465 424
587 3300046515 Ga0495620_0009291 Ga0495620_0009291_2412_3686 424
588 3300046516 Ga0495628_0006690 Ga0495628_0006690_6292_7581 424
589 3300046516 Ga0495628_0012413 Ga0495628_0012413_229_1503 424
590 3300046516 Ga0495628_0159712 Ga0495628_0159712_39_1313 424
591 3300046517 Ga0495630_0031819 Ga0495630_0031819_268_1542 424
592 3300046517 Ga0495630_0033475 Ga0495630_0033475_2034_3359 424
593 3300046526 Ga0495666_0006163 Ga0495666_0006163_295_1569 424
594 3300046526 Ga0495666_0007979 Ga0495666_0007979_517_1791 424
595 3300046526 Ga0495666_0015305 Ga0495666_0015305_64_1407 424
596 3300046528 Ga0495642_0004007 Ga0495642_0004007_876_2150 424
597 3300046529 Ga0495652_0113038 Ga0495652_0113038_430_1704 424
598 3300046531 Ga0495665_0004525 Ga0495665_0004525_55_1398 424
599 3300046531 Ga0495665_0012093 Ga0495665_0012093_2975_4249 424
600 3300046531 Ga0495665_0031143 Ga0495665_0031143_151_1455 424
601 3300046531 Ga0495665_0033039 Ga0495665_0033039_1301_2575 424
602 3300046533 Ga0495640_0009812 Ga0495640_0009812_2714_3988 424
603 3300046533 Ga0495640_0033955 Ga0495640_0033955_1026_2369 424
604 3300046535 Ga0495586_0086126 Ga0495586_0086126_126_1400 424
605 3300046543 Ga0495645_0004719 Ga0495645_0004719_7192_8466 424
606 3300046557 Ga0495622_0000287 Ga0495622_0000287_26302_27576 424
607 3300046559 Ga0495667_0097216 Ga0495667_0097216_415_1689 424
608 3300046642 Ga0495634_0030733 Ga0495634_0030733_1143_2486 424
609 3300046663 Ga0495635_0019299 Ga0495635_0019299_3186_4460 424
610 3300046665 Ga0495661_0013584 Ga0495661_0013584_4060_5403 424
611 3300046678 Ga0495599_0007611 Ga0495599_0007611_4012_5286 424
612 3300046678 Ga0495599_0059721 Ga0495599_0059721_469_1812 424
613 3300046680 Ga0495646_0005768 Ga0495646_0005768_751_2025 424
614 3300046684 Ga0495669_0009043 Ga0495669_0009043_2346_3620 424
615 3300046690 Ga0495624_0007690 Ga0495624_0007690_6074_7348 424
616 3300046690 Ga0495624_0009295 Ga0495624_0009295_4879_6153 424
617 3300046690 Ga0495624_0040062 Ga0495624_0040062_295_1569 424
618 3300046692 Ga0495671_0025478 Ga0495671_0025478_1267_2541 424
619 3300046694 Ga0495649_0004871 Ga0495649_0004871_2400_3674 424
620 3300046794 Ga0495589_0020527 Ga0495589_0020527_351_1625 424
621 3300046794 Ga0495589_0034978 Ga0495589_0034978_1147_2421 424
622 3300046794 Ga0495589_0084239 Ga0495589_0084239_87_1361 424
623 3300046809 Ga0495600_0041504 Ga0495600_0041504_189_1463 424
624 3300047317 Ga0495604_0026260 Ga0495604_0026260_1947_3290 424
625 3300047317 Ga0495604_0165128 Ga0495604_0165128_237_1511 424
626 3300047319 Ga0495674_0010307 Ga0495674_0010307_1331_2656 424
627 3300047319 Ga0495674_0013082 Ga0495674_0013082_3606_4895 424
628 3300047319 Ga0495674_0068948 Ga0495674_0068948_1328_2602 424
629 3300047319 Ga0495674_0075082 Ga0495674_0075082_1585_2859 424
630 3300047320 Ga0495672_0001027 Ga0495672_0001027_328_1617 424
631 3300047320 Ga0495672_0001926 Ga0495672_0001926_1505_2806 424
632 3300047320 Ga0495672_0039454 Ga0495672_0039454_1504_2778 424
633 3300047321 Ga0495676_0054518 Ga0495676_0054518_493_1836 424
634 3300047321 Ga0495676_0083231 Ga0495676_0083231_123_1397 424
635 3300047322 Ga0495680_0023547 Ga0495680_0023547_399_1673 424
636 3300047322 Ga0495680_0027997 Ga0495680_0027997_661_1935 424
637 3300047322 Ga0495680_0079995 Ga0495680_0079995_166_1509 424
638 3300047323 Ga0495683_0026531 Ga0495683_0026531_946_2220 424
639 3300047323 Ga0495683_0032946 Ga0495683_0032946_282_1556 424
640 3300047443 Ga0495687_000021 Ga0495687_000021_212613_213887 424
641 3300047443 Ga0495687_007444 Ga0495687_007444_1810_3084 424
642 3300047443 Ga0495687_008078 Ga0495687_008078_4713_5987 424
643 3300047443 Ga0495687_025058 Ga0495687_025058_25_1299 424
644 3300047443 Ga0495687_045002 Ga0495687_045002_323_1597 424
645 3300047444 Ga0495675_0118482 Ga0495675_0118482_164_1438 424
646 3300047446 Ga0495679_000013 Ga0495679_000013_303149_304423 424
647 3300047446 Ga0495679_000885 Ga0495679_000885_14387_15730 424
648 3300047469 Ga0495673_0018628 Ga0495673_0018628_2049_3350 424
649 3300047469 Ga0495673_0026075 Ga0495673_0026075_605_1879 424
650 3300047472 Ga0495686_0000081 Ga0495686_0000081_24269_25558 424
651 3300047673 Ga0495593_0005939 Ga0495593_0005939_3193_4536 424
652 3300047673 Ga0495593_0026977 Ga0495593_0026977_179_1453 424
653 3300047673 Ga0495593_0036021 Ga0495593_0036021_661_1935 424
654 3300048088 Ga0495602_0005107 Ga0495602_0005107_12019_13293 424
655 3300048088 Ga0495602_0143927 Ga0495602_0143927_557_1831 424
656 3300048089 Ga0495614_0010574 Ga0495614_0010574_532_1806 424
657 3300048903 Ga0496100_0000378 Ga0496100_0000378_4678_6003 424
658 3300048903 Ga0496100_0000628 Ga0496100_0000628_14226_15500 424
659 3300048903 Ga0496100_0189151 Ga0496100_0189151_16_1290 424
660 3300048904 Ga0496101_0000204 Ga0496101_0000204_28244_29569 424
661 3300048904 Ga0496101_0000412 Ga0496101_0000412_1109_2383 424
662 3300048904 Ga0496101_0053512 Ga0496101_0053512_419_1693 424
663 3300048905 Ga0496102_0000298 Ga0496102_0000298_15688_17013 424
664 3300048905 Ga0496102_0001948 Ga0496102_0001948_9683_10957 424
665 3300048905 Ga0496102_0017679 Ga0496102_0017679_4107_5381 424
666 3300048906 Ga0496103_0000253 Ga0496103_0000253_33048_34373 424
667 3300048906 Ga0496103_0018032 Ga0496103_0018032_1235_2509 424
668 3300048907 Ga0496104_0047706 Ga0496104_0047706_2151_3476 424
669 3300048907 Ga0496104_0062090 Ga0496104_0062090_488_1762 424
670 3300048908 Ga0496105_0008358 Ga0496105_0008358_647_1921 424
671 3300048909 Ga0496106_0197317 Ga0496106_0197317_142_1416 424
672 3300048910 Ga0496107_0029899 Ga0496107_0029899_1289_2584 424
673 3300048910 Ga0496107_0059471 Ga0496107_0059471_827_2101 424
674 3300048913 Ga0496110_0035868 Ga0496110_0035868_50_1351 424
675 3300048913 Ga0496110_0125994 Ga0496110_0125994_51_1325 424
676 3300048915 Ga0496112_0004494 Ga0496112_0004494_3063_4388 424
677 3300048916 Ga0496113_0042818 Ga0496113_0042818_851_2125 424
678 3300048917 Ga0496114_0012267 Ga0496114_0012267_3196_4470 424
679 3300048920 Ga0496117_0000171 Ga0496117_0000171_118011_119336 424
680 3300048920 Ga0496117_0003808 Ga0496117_0003808_5037_6311 424
681 3300048920 Ga0496117_0003944 Ga0496117_0003944_2305_3579 424
682 3300048920 Ga0496117_0010066 Ga0496117_0010066_4822_6096 424
683 3300048920 Ga0496117_0015912 Ga0496117_0015912_2528_3802 424
684 3300048921 Ga0496118_0000276 Ga0496118_0000276_73367_74692 424
685 3300048921 Ga0496118_0001751 Ga0496118_0001751_19267_20541 424
686 3300048921 Ga0496118_0004406 Ga0496118_0004406_5109_6383 424
687 3300048921 Ga0496118_0013254 Ga0496118_0013254_6119_7393 424
688 3300048921 Ga0496118_0022028 Ga0496118_0022028_2646_3920 424
689 3300048924 Ga0496121_0001129 Ga0496121_0001129_10318_11592 424
690 3300048924 Ga0496121_0005700 Ga0496121_0005700_11207_12532 424
691 3300048924 Ga0496121_0005701 Ga0496121_0005701_7665_8939 424
692 3300048924 Ga0496121_0023755 Ga0496121_0023755_2276_3550 424
693 3300048924 Ga0496121_0049892 Ga0496121_0049892_1235_2560 424
694 3300048925 Ga0496122_0047498 Ga0496122_0047498_404_1729 424
695 3300048929 Ga0496126_0004750 Ga0496126_0004750_3324_4598 424
696 3300048929 Ga0496126_0007120 Ga0496126_0007120_346_1620 424
697 3300049459 Ga0495678_023955 Ga0495678_023955_750_2024 424
698 3300059505 Ga0587083_0011409 Ga0587083_0011409_116_1390 424
699 3300059640 Ga0587067_006924 Ga0587067_006924_79_1353 424
700 3300059643 Ga0587072_003250 Ga0587072_003250_80_1354 424
701 3300061719 Ga0466962_0002106 Ga0466962_0002106_3359_4633 424
702 3300061719 Ga0466962_0003684 Ga0466962_0003684_5761_7035 424
703 3300061719 Ga0466962_0004737 Ga0466962_0004737_1211_2485 424
704 iso_pu_bacteria 2848297114 2848299738 424
705 iso_pu_bacteria 2917554339 2917555317 424
706 iso_pu_bacteria 8045864390 8045865848 424

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00464

SHMT

Serine hydroxymethyltransferase

57

434

0.99

PF01041

DegT_DnrJ_EryC1

DegT/DnrJ/EryC1/StrS aminotransferase family

183

327

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v3d-assembly1.cif.gz_A complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor 0.8933 16 423
2w7m-assembly1.cif.gz_A-2 crystal structure of y61absshmt obtained in the presence of glycine and 5-formyl tetrahydrofolate 0.8895 12 418
2vi9-assembly1.cif.gz_A crystal structure of s172absshmt glycine external aldimine 0.8893 12 418
6yrw-assembly2.cif.gz_B shmt from streptococcus thermophilus tyr55ser variant as internal aldimine and as non-covalent complex with d-ser 0.8889 16 424
2vmu-assembly1.cif.gz_A-2 crystal structure of y60absshmt crystallized in the presence of l- allo-thr 0.8887 12 418
ID Description Score Start End Superfamily
3n0lB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9705 284 424 3.90.1150.10
4msoB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9703 284 424 3.90.1150.10
2vgsA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.97 292 418 3.90.1150.10
4j5uB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9662 292 424 3.90.1150.10
4p3mB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.961 284 424 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A090T083-F1-model_v4 Serine hydroxymethyltransferase (EC 2.1.2.1) 0.9954 270 394 GO:0004372
GO:0005829
GO:0008168
GO:0019264
GO:0030170
GO:0032259
GO:0046653
AF-K2DFK8-F1-model_v4 Serine hydroxymethyltransferase-like domain-containing protein 0.9904 272 393 GO:0004372
GO:0005737
GO:0019264
GO:0030170
GO:0046653
AF-A0A358B0M0-F1-model_v4 Serine hydroxymethyltransferase (EC 2.1.2.1) 0.9903 278 424 GO:0004372
GO:0005829
GO:0008168
GO:0019264
GO:0030170
GO:0032259
GO:0046653
AF-F0GKV8-F1-model_v4 Serine hydroxymethyltransferase (EC 2.1.2.1) 0.9902 245 424 GO:0004372
GO:0005829
GO:0008168
GO:0019264
GO:0030170
GO:0032259
GO:0046653
AF-A0A378VW09-F1-model_v4 Serine hydroxymethyltransferase (EC 2.1.2.1) 0.99 82 246 GO:0004372
GO:0005829
GO:0006730
GO:0008168
GO:0019264
GO:0030170
GO:0032259
GO:0046653

Feature Viewer

pLDDT pTM Quality
93.33 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map