F476487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 706 | 332 | 584 | 425 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0009358|Ga0395899_0009358_308_1717 |
| Length | 469 |
| Sequence | VSEKVKNASEFVNPQKGRTARIEPSPTNAGGAEPHSAPRPHYGYAMSNTEPFFTQTLADRDAPVRAAVLRELERQQSQVELIASENIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCEFVDEVEALAIERVKRLFGAGYANVQPHSGAQANGSVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNAVQYGVSRDTMLIDYGQIEALAAEHRPSLIIAGFSAYPRALDFARFRAIADSVGAKLMVDMAHIAGIVAAGRHPNPIEHAHVVTSTTHKTLRGPRGGFVLTNDEDIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALDDGFKGYIDRVLANAQALGAVLREGGVDLVTGGTDNHLLLVDLRPKGLKGTQVETALERAGITCNKNGIPFDTEKPTVTSGIRLGTPAGTTRGFGVAQFEQIGRLILEVFEALTRHPEGDAQTEQRVRREIFALCERFPIY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 4 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 5 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 6 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 7 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 8 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 9 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 10 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 11 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 12 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 13 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 14 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 15 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 16 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 17 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 18 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 19 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 20 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 21 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 22 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 23 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 24 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 25 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 26 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 27 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 28 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 29 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 30 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 31 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 32 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 33 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 34 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 35 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 36 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 37 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 38 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 39 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 40 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 41 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 42 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 43 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 44 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 45 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 46 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 47 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 48 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 49 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 50 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 51 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 52 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 53 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 54 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 55 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 56 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 57 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 58 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 59 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 60 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 61 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 62 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 63 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 64 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 65 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 66 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 67 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 68 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 69 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 70 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 71 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 72 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 73 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 74 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 75 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 76 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 77 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 78 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 79 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 80 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 81 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 82 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 83 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 84 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 85 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 86 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 87 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 88 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 89 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 90 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 91 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 93 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 94 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 95 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 96 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 98 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 100 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 101 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 102 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 193 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 194 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 202 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 281 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 309 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 315 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 316 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 317 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 318 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 319 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 320 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 321 | 8015556637 | Bdellovibrio reynosensis LBG001 | Isolate | Rhizosphere |
| 322 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 323 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 324 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 325 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 326 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 327 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 328 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 329 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 330 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 331 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 332 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.29 |
| Metatranscriptomes | 0.57 |
| Isolates | 17.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.88 |
| Nodule | 3.97 |
| Rhizoplane | 5.95 |
| Rhizosphere | 61.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000031 | 3300001979 | Bacteria | 46967 |
| 2 | JGI24740J21852_10000333 | 3300001979 | Bacteria | 19977 |
| 3 | JGI24740J21852_10011891 | 3300001979 | Bacteria | 3300 |
| 4 | JGI24739J22299_10001631 | 3300001989 | Bacteria | 8513 |
| 5 | JGI24739J22299_10002527 | 3300001989 | Bacteria | 7049 |
| 6 | JGI24739J22299_10006381 | 3300001989 | Bacteria | 4453 |
| 7 | JGI24737J22298_10009927 | 3300001990 | Bacteria | 3151 |
| 8 | JGI24735J21928_10020765 | 3300002067 | Bacteria | 2010 |
| 9 | JGI25156J39149_1000366 | 3300002705 | Bacteria | 29011 |
| 10 | JGI25156J39149_1000389 | 3300002705 | Bacteria | 27572 |
| 11 | JGI25156J39149_1000562 | 3300002705 | Bacteria | 21189 |
| 12 | JGI25156J39149_1000718 | 3300002705 | Bacteria | 17623 |
| 13 | JGI25156J39149_1003583 | 3300002705 | Bacteria | 5021 |
| 14 | JGI25156J39149_1004983 | 3300002705 | Bacteria | 3922 |
| 15 | JGI25162J39368_1000052 | 3300002737 | Bacteria | 152144 |
| 16 | JGI25154J39366_1000271 | 3300002738 | Bacteria | 32100 |
| 17 | JGI25151J46595_10005206 | 3300003187 | Bacteria | 6745 |
| 18 | JGI25165J46597_1000105 | 3300003214 | Bacteria | 152144 |
| 19 | JGI25165J46597_1000717 | 3300003214 | Bacteria | 26046 |
| 20 | JGI25160J50197_1000138 | 3300003354 | Bacteria | 65562 |
| 21 | Ga0055538_1000043 | 3300003751 | Bacteria | 152144 |
| 22 | Ga0055538_1000219 | 3300003751 | Bacteria | 33042 |
| 23 | Ga0055539_1000057 | 3300003752 | Bacteria | 152144 |
| 24 | Ga0055539_1000233 | 3300003752 | Bacteria | 38473 |
| 25 | Ga0055533_1000064 | 3300003756 | Bacteria | 169672 |
| 26 | Ga0055533_1000071 | 3300003756 | Bacteria | 152144 |
| 27 | Ga0055533_1000247 | 3300003756 | Bacteria | 33939 |
| 28 | Ga0055533_1000317 | 3300003756 | Bacteria | 22873 |
| 29 | Ga0055533_1001095 | 3300003756 | Bacteria | 7758 |
| 30 | Ga0055532_1000013 | 3300003758 | Bacteria | 380677 |
| 31 | Ga0055532_1000245 | 3300003758 | Bacteria | 39120 |
| 32 | Ga0055525_1000085 | 3300003759 | Bacteria | 152144 |
| 33 | Ga0055525_1000318 | 3300003759 | Bacteria | 38473 |
| 34 | Ga0055527_1000010 | 3300003760 | Bacteria | 380677 |
| 35 | Ga0055527_1000260 | 3300003760 | Bacteria | 32074 |
| 36 | Ga0055527_1000468 | 3300003760 | Bacteria | 15486 |
| 37 | Ga0055527_1000470 | 3300003760 | Bacteria | 15436 |
| 38 | Ga0055535_1000010 | 3300003761 | Bacteria | 380677 |
| 39 | Ga0055535_1000431 | 3300003761 | Bacteria | 39120 |
| 40 | Ga0055535_1001162 | 3300003761 | Bacteria | 15486 |
| 41 | Ga0055535_1001166 | 3300003761 | Bacteria | 15436 |
| 42 | Ga0055542_1000016 | 3300003762 | Bacteria | 380677 |
| 43 | Ga0055542_1000990 | 3300003762 | Bacteria | 18375 |
| 44 | Ga0055542_1001151 | 3300003762 | Bacteria | 15486 |
| 45 | Ga0055542_1003283 | 3300003762 | Bacteria | 4496 |
| 46 | Ga0055529_1000012 | 3300003763 | Bacteria | 380677 |
| 47 | Ga0055529_1000517 | 3300003763 | Bacteria | 33886 |
| 48 | Ga0055529_1000670 | 3300003763 | Bacteria | 23836 |
| 49 | Ga0055529_1000746 | 3300003763 | Bacteria | 21012 |
| 50 | Ga0055528_1002297 | 3300003790 | Bacteria | 10350 |
| 51 | Ga0055541_1000044 | 3300003841 | Bacteria | 152144 |
| 52 | Ga0055541_1000113 | 3300003841 | Bacteria | 58560 |
| 53 | Ga0055541_1000160 | 3300003841 | Bacteria | 33042 |
| 54 | Ga0065165_1000810 | 3300005262 | Bacteria | 41615 |
| 55 | Ga0065165_1001078 | 3300005262 | Bacteria | 32546 |
| 56 | Ga0070658_10003407 | 3300005327 | Bacteria | 13079 |
| 57 | Ga0070658_10017930 | 3300005327 | Bacteria | 5662 |
| 58 | Ga0070658_10048516 | 3300005327 | Bacteria | 3438 |
| 59 | Ga0070658_10056707 | 3300005327 | Bacteria | 3185 |
| 60 | Ga0070683_100191065 | 3300005329 | Bacteria | 1944 |
| 61 | Ga0070660_100000006 | 3300005339 | Bacteria | 166714 |
| 62 | Ga0070660_100000507 | 3300005339 | Bacteria | 26032 |
| 63 | Ga0070661_100000348 | 3300005344 | Bacteria | 36613 |
| 64 | Ga0070659_100000082 | 3300005366 | Bacteria | 71707 |
| 65 | Ga0070659_100002151 | 3300005366 | Bacteria | 14041 |
| 66 | Ga0070659_100040921 | 3300005366 | Bacteria | 3622 |
| 67 | Ga0070659_100094113 | 3300005366 | Bacteria | 2405 |
| 68 | Ga0070711_100000008 | 3300005439 | Bacteria | 180012 |
| 69 | Ga0070711_100018442 | 3300005439 | Bacteria | 4457 |
| 70 | Ga0070663_100000069 | 3300005455 | Bacteria | 44710 |
| 71 | Ga0070663_100000075 | 3300005455 | Bacteria | 43381 |
| 72 | Ga0070663_100062773 | 3300005455 | Bacteria | 2680 |
| 73 | Ga0070681_10001701 | 3300005458 | Bacteria | 19683 |
| 74 | Ga0070679_100048109 | 3300005530 | Bacteria | 4250 |
| 75 | Ga0070679_100100214 | 3300005530 | Bacteria | 2884 |
| 76 | Ga0068855_100040376 | 3300005563 | Bacteria | 5539 |
| 77 | Ga0070664_100000191 | 3300005564 | Bacteria | 43340 |
| 78 | Ga0068857_100009953 | 3300005577 | Bacteria | 8255 |
| 79 | Ga0068856_100000504 | 3300005614 | Bacteria | 43340 |
| 80 | Ga0068856_100062220 | 3300005614 | Bacteria | 3686 |
| 81 | Ga0068856_100076217 | 3300005614 | Bacteria | 3323 |
| 82 | Ga0068852_100015182 | 3300005616 | Bacteria | 5961 |
| 83 | Ga0105251_10000043 | 3300009011 | Bacteria | 113848 |
| 84 | Ga0105251_10000127 | 3300009011 | Bacteria | 76233 |
| 85 | Ga0105250_10015150 | 3300009092 | Bacteria | 3158 |
| 86 | Ga0105240_10004374 | 3300009093 | Bacteria | 21565 |
| 87 | Ga0105240_10066046 | 3300009093 | Bacteria | 4490 |
| 88 | Ga0105240_10142600 | 3300009093 | Bacteria | 2863 |
| 89 | Ga0105240_10154226 | 3300009093 | Bacteria | 2733 |
| 90 | Ga0105240_10256948 | 3300009093 | Bacteria | 2017 |
| 91 | Ga0105240_10362086 | 3300009093 | Bacteria | 1642 |
| 92 | Ga0105237_10175134 | 3300009545 | Bacteria | 2146 |
| 93 | Ga0105239_10002079 | 3300010375 | Bacteria | 25954 |
| 94 | Ga0105239_10003831 | 3300010375 | Bacteria | 18277 |
| 95 | Ga0157373_10000358 | 3300013100 | Bacteria | 36729 |
| 96 | Ga0157373_10002832 | 3300013100 | Bacteria | 13112 |
| 97 | Ga0157371_10000608 | 3300013102 | Bacteria | 42626 |
| 98 | Ga0157371_10008084 | 3300013102 | Bacteria | 8411 |
| 99 | Ga0157370_10000690 | 3300013104 | Bacteria | 42091 |
| 100 | Ga0157370_10000852 | 3300013104 | Bacteria | 38700 |
| 101 | Ga0157370_10001717 | 3300013104 | Bacteria | 26975 |
| 102 | Ga0157369_10000120 | 3300013105 | Bacteria | 111290 |
| 103 | Ga0157369_10000743 | 3300013105 | Bacteria | 42070 |
| 104 | Ga0157369_10003555 | 3300013105 | Bacteria | 18512 |
| 105 | Ga0157369_10130895 | 3300013105 | Bacteria | 2659 |
| 106 | Ga0157374_10000976 | 3300013296 | Bacteria | 24794 |
| 107 | Ga0157372_10000519 | 3300013307 | Bacteria | 42478 |
| 108 | Ga0157372_10003761 | 3300013307 | Bacteria | 16301 |
| 109 | Ga0157375_10010236 | 3300013308 | Bacteria | 8249 |
| 110 | Ga0182008_10025257 | 3300014497 | Bacteria | 3017 |
| 111 | Ga0182006_1001401 | 3300015261 | Bacteria | 14627 |
| 112 | Ga0182007_10000795 | 3300015262 | Bacteria | 17642 |
| 113 | Ga0182007_10003364 | 3300015262 | Bacteria | 7557 |
| 114 | Ga0182007_10004520 | 3300015262 | Bacteria | 6289 |
| 115 | Ga0182007_10030545 | 3300015262 | Bacteria | 1840 |
| 116 | Ga0183361_10061 | 3300016635 | Bacteria | 3339 |
| 117 | Ga0224712_10000332 | 3300022467 | Bacteria | 8963 |
| 118 | Ga0209435_102220 | 3300025206 | Bacteria | 2306 |
| 119 | Ga0209435_104222 | 3300025206 | Bacteria | 1628 |
| 120 | Ga0209784_100069 | 3300025224 | Bacteria | 152424 |
| 121 | Ga0209784_100215 | 3300025224 | Bacteria | 39580 |
| 122 | Ga0209784_100567 | 3300025224 | Bacteria | 12794 |
| 123 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 124 | Ga0209566_100083 | 3300025225 | Bacteria | 152424 |
| 125 | Ga0209566_100161 | 3300025225 | Bacteria | 75269 |
| 126 | Ga0209566_100215 | 3300025225 | Bacteria | 58348 |
| 127 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 128 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 129 | Ga0209674_100106 | 3300025226 | Bacteria | 152424 |
| 130 | Ga0209674_100157 | 3300025226 | Bacteria | 91077 |
| 131 | Ga0209674_100183 | 3300025226 | Bacteria | 71751 |
| 132 | Ga0209674_100271 | 3300025226 | Bacteria | 39580 |
| 133 | Ga0209674_102503 | 3300025226 | Bacteria | 3905 |
| 134 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 135 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 136 | Ga0209672_100066 | 3300025228 | Bacteria | 189828 |
| 137 | Ga0209672_100188 | 3300025228 | Bacteria | 50151 |
| 138 | Ga0209672_100234 | 3300025228 | Bacteria | 42161 |
| 139 | Ga0209672_100439 | 3300025228 | Bacteria | 23788 |
| 140 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 141 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 142 | Ga0209147_100084 | 3300025229 | Bacteria | 189828 |
| 143 | Ga0209147_100295 | 3300025229 | Bacteria | 42161 |
| 144 | Ga0209563_100100 | 3300025230 | Bacteria | 152424 |
| 145 | Ga0209563_100181 | 3300025230 | Bacteria | 39580 |
| 146 | Ga0209563_101061 | 3300025230 | Bacteria | 7950 |
| 147 | Ga0209437_100156 | 3300025233 | Bacteria | 152424 |
| 148 | Ga0209258_100042 | 3300025242 | Bacteria | 380729 |
| 149 | Ga0209258_100084 | 3300025242 | Bacteria | 244783 |
| 150 | Ga0209258_100117 | 3300025242 | Bacteria | 189828 |
| 151 | Ga0209258_100477 | 3300025242 | Bacteria | 42161 |
| 152 | Ga0209646_1000046 | 3300025246 | Bacteria | 332737 |
| 153 | Ga0209026_1003728 | 3300025250 | Bacteria | 4852 |
| 154 | Ga0209677_100061 | 3300025253 | Bacteria | 152424 |
| 155 | Ga0209677_100230 | 3300025253 | Bacteria | 39580 |
| 156 | Ga0209677_102128 | 3300025253 | Bacteria | 7768 |
| 157 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 158 | Ga0209148_1000148 | 3300025254 | Bacteria | 159642 |
| 159 | Ga0209148_1000187 | 3300025254 | Bacteria | 117659 |
| 160 | Ga0209148_1000785 | 3300025254 | Bacteria | 23584 |
| 161 | Ga0209148_1003392 | 3300025254 | Bacteria | 4445 |
| 162 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 163 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 164 | Ga0209759_1000210 | 3300025256 | Bacteria | 90325 |
| 165 | Ga0209759_1000363 | 3300025256 | Bacteria | 57937 |
| 166 | Ga0209759_1000587 | 3300025256 | Bacteria | 35659 |
| 167 | Ga0209759_1003547 | 3300025256 | Bacteria | 6177 |
| 168 | Ga0209759_1006120 | 3300025256 | Bacteria | 4096 |
| 169 | Ga0209759_1011323 | 3300025256 | Bacteria | 2542 |
| 170 | Ga0209759_1020077 | 3300025256 | Bacteria | 1564 |
| 171 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 172 | Ga0209233_1000165 | 3300025261 | Bacteria | 152424 |
| 173 | Ga0209565_1009103 | 3300025263 | Bacteria | 2552 |
| 174 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 175 | Ga0209455_1000110 | 3300025272 | Bacteria | 189828 |
| 176 | Ga0209455_1000362 | 3300025272 | Bacteria | 42161 |
| 177 | Ga0209455_1001376 | 3300025272 | Bacteria | 11110 |
| 178 | Ga0209673_1000057 | 3300025273 | Bacteria | 270150 |
| 179 | Ga0209130_1004039 | 3300025284 | Bacteria | 5826 |
| 180 | Ga0209130_1009846 | 3300025284 | Bacteria | 2682 |
| 181 | Ga0209025_1000123 | 3300025294 | Bacteria | 204125 |
| 182 | Ga0209564_1004896 | 3300025295 | Bacteria | 7944 |
| 183 | Ga0207426_1000018 | 3300025302 | Bacteria | 566740 |
| 184 | Ga0207426_1000152 | 3300025302 | Bacteria | 183514 |
| 185 | Ga0207713_1000240 | 3300025735 | Bacteria | 73219 |
| 186 | Ga0207713_1000302 | 3300025735 | Bacteria | 56383 |
| 187 | Ga0207647_10001027 | 3300025904 | Bacteria | 21661 |
| 188 | Ga0207647_10003472 | 3300025904 | Bacteria | 11821 |
| 189 | Ga0207647_10035914 | 3300025904 | Bacteria | 3153 |
| 190 | Ga0207705_10003789 | 3300025909 | Bacteria | 11515 |
| 191 | Ga0207705_10052350 | 3300025909 | Bacteria | 2939 |
| 192 | Ga0207707_10000098 | 3300025912 | Bacteria | 87035 |
| 193 | Ga0207695_10001113 | 3300025913 | Bacteria | 46732 |
| 194 | Ga0207695_10006823 | 3300025913 | Bacteria | 14704 |
| 195 | Ga0207695_10036944 | 3300025913 | Bacteria | 5274 |
| 196 | Ga0207695_10048057 | 3300025913 | Bacteria | 4509 |
| 197 | Ga0207695_10102080 | 3300025913 | Bacteria | 2862 |
| 198 | Ga0207695_10114130 | 3300025913 | Bacteria | 2677 |
| 199 | Ga0207663_10000023 | 3300025916 | Bacteria | 120745 |
| 200 | Ga0207663_10013832 | 3300025916 | Bacteria | 4399 |
| 201 | Ga0207660_10079740 | 3300025917 | Bacteria | 2402 |
| 202 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 203 | Ga0207657_10000885 | 3300025919 | Bacteria | 31657 |
| 204 | Ga0207657_10206949 | 3300025919 | Bacteria | 1576 |
| 205 | Ga0207649_10000326 | 3300025920 | Bacteria | 36079 |
| 206 | Ga0207694_10019179 | 3300025924 | Bacteria | 5170 |
| 207 | Ga0207664_10001839 | 3300025929 | Bacteria | 13993 |
| 208 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 209 | Ga0207690_10000380 | 3300025932 | Bacteria | 29474 |
| 210 | Ga0207690_10076393 | 3300025932 | Bacteria | 2326 |
| 211 | Ga0207706_10088231 | 3300025933 | Bacteria | 2727 |
| 212 | Ga0207711_10030210 | 3300025941 | Bacteria | 4570 |
| 213 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 214 | Ga0207667_10006579 | 3300025949 | Bacteria | 14061 |
| 215 | Ga0207667_10006899 | 3300025949 | Bacteria | 13718 |
| 216 | Ga0207667_10030915 | 3300025949 | Bacteria | 5786 |
| 217 | Ga0207667_10058573 | 3300025949 | Bacteria | 4039 |
| 218 | Ga0207667_10073993 | 3300025949 | Bacteria | 3539 |
| 219 | Ga0207667_10228092 | 3300025949 | Bacteria | 1907 |
| 220 | Ga0207668_10118111 | 3300025972 | Bacteria | 2003 |
| 221 | Ga0207678_10000319 | 3300026067 | Bacteria | 43404 |
| 222 | Ga0207678_10001465 | 3300026067 | Bacteria | 21657 |
| 223 | Ga0207678_10008540 | 3300026067 | Bacteria | 9025 |
| 224 | Ga0207702_10000504 | 3300026078 | Bacteria | 44031 |
| 225 | Ga0207702_10049899 | 3300026078 | Bacteria | 3532 |
| 226 | Ga0207674_10004306 | 3300026116 | Bacteria | 17162 |
| 227 | Ga0207698_10019094 | 3300026142 | Bacteria | 4684 |
| 228 | Ga0207698_10071541 | 3300026142 | Bacteria | 2752 |
| 229 | Ga0209371_1000076 | 3300027312 | Bacteria | 195166 |
| 230 | Ga0265318_10013761 | 3300028577 | Bacteria | 3408 |
| 231 | Ga0265338_10001766 | 3300028800 | Bacteria | 34128 |
| 232 | Ga0265338_10019124 | 3300028800 | Bacteria | 7290 |
| 233 | Ga0268256_1000087 | 3300030500 | Bacteria | 157659 |
| 234 | Ga0268256_1005103 | 3300030500 | Bacteria | 5238 |
| 235 | Ga0265320_10033832 | 3300031240 | Bacteria | 2606 |
| 236 | Ga0307408_100004532 | 3300031548 | Bacteria | 9417 |
| 237 | Ga0265313_10008523 | 3300031595 | Bacteria | 6797 |
| 238 | Ga0265314_10006743 | 3300031711 | Bacteria | 10083 |
| 239 | Ga0307412_10000095 | 3300031911 | Bacteria | 75002 |
| 240 | Ga0395899_0000023 | 3300037312 | Bacteria | 367159 |
| 241 | Ga0395899_0000241 | 3300037312 | Bacteria | 72826 |
| 242 | Ga0395899_0006229 | 3300037312 | Bacteria | 9242 |
| 243 | Ga0395899_0009358 | 3300037312 | Bacteria | 7526 |
| 244 | Ga0395899_0074250 | 3300037312 | Bacteria | 2484 |
| 245 | Ga0395899_0082115 | 3300037312 | Bacteria | 2344 |
| 246 | Ga0395900_0000019 | 3300037418 | Bacteria | 357240 |
| 247 | Ga0395900_0000265 | 3300037418 | Bacteria | 81381 |
| 248 | Ga0395900_0000633 | 3300037418 | Bacteria | 47354 |
| 249 | Ga0395900_0001069 | 3300037418 | Bacteria | 34842 |
| 250 | Ga0395900_0032838 | 3300037418 | Bacteria | 5338 |
| 251 | Ga0395900_0101315 | 3300037418 | Bacteria | 2958 |
| 252 | Ga0395900_0170678 | 3300037418 | Bacteria | 2215 |
| 253 | Ga0395900_0216467 | 3300037418 | Bacteria | 1932 |
| 254 | Ga0395898_0000016 | 3300037466 | Bacteria | 435585 |
| 255 | Ga0395898_0001705 | 3300037466 | Bacteria | 29237 |
| 256 | Ga0395898_0063824 | 3300037466 | Bacteria | 3574 |
| 257 | Ga0395898_0113022 | 3300037466 | Bacteria | 2602 |
| 258 | Ga0395898_0127450 | 3300037466 | Bacteria | 2438 |
| 259 | Ga0395905_0000009 | 3300037471 | Bacteria | 488729 |
| 260 | Ga0395905_0000048 | 3300037471 | Bacteria | 236537 |
| 261 | Ga0395905_0000144 | 3300037471 | Bacteria | 117622 |
| 262 | Ga0395905_0001161 | 3300037471 | Bacteria | 32913 |
| 263 | Ga0395905_0033555 | 3300037471 | Bacteria | 4821 |
| 264 | Ga0395905_0048375 | 3300037471 | Bacteria | 3985 |
| 265 | Ga0395905_0077844 | 3300037471 | Bacteria | 3107 |
| 266 | Ga0395901_0000009 | 3300038443 | Bacteria | 479396 |
| 267 | Ga0395901_0000081 | 3300038443 | Bacteria | 130244 |
| 268 | Ga0395901_0000157 | 3300038443 | Bacteria | 88435 |
| 269 | Ga0395901_0015476 | 3300038443 | Bacteria | 7767 |
| 270 | Ga0395901_0046848 | 3300038443 | Bacteria | 4491 |
| 271 | Ga0395901_0075354 | 3300038443 | Bacteria | 3519 |
| 272 | Ga0436361_0501535 | 3300039447 | Bacteria | 5182 |
| 273 | Ga0439448_0000277 | 3300042005 | Bacteria | 11224 |
| 274 | Ga0466969_0000088 | 3300044656 | Bacteria | 47596 |
| 275 | Ga0466969_0002473 | 3300044656 | Bacteria | 9865 |
| 276 | Ga0466969_0018108 | 3300044656 | Bacteria | 3674 |
| 277 | Ga0466969_0022794 | 3300044656 | Bacteria | 3229 |
| 278 | Ga0466965_0001437 | 3300044683 | Bacteria | 9611 |
| 279 | Ga0466965_0002491 | 3300044683 | Bacteria | 7836 |
| 280 | Ga0466965_0008150 | 3300044683 | Bacteria | 4839 |
| 281 | Ga0466966_0000009 | 3300044684 | Bacteria | 150954 |
| 282 | Ga0466966_0001052 | 3300044684 | Bacteria | 17607 |
| 283 | Ga0466966_0002581 | 3300044684 | Bacteria | 11874 |
| 284 | Ga0466966_0002666 | 3300044684 | Bacteria | 11694 |
| 285 | Ga0466966_0010696 | 3300044684 | Bacteria | 6100 |
| 286 | Ga0466961_0000665 | 3300044693 | Bacteria | 21692 |
| 287 | Ga0466961_0004003 | 3300044693 | Bacteria | 9224 |
| 288 | Ga0466961_0005937 | 3300044693 | Bacteria | 7738 |
| 289 | Ga0466961_0007719 | 3300044693 | Bacteria | 6850 |
| 290 | Ga0466961_0008980 | 3300044693 | Bacteria | 6377 |
| 291 | Ga0466961_0028566 | 3300044693 | Bacteria | 3586 |
| 292 | Ga0466963_0002186 | 3300044694 | Bacteria | 10812 |
| 293 | Ga0466963_0011644 | 3300044694 | Bacteria | 5357 |
| 294 | Ga0466963_0106362 | 3300044694 | Bacteria | 1924 |
| 295 | Ga0466964_0007498 | 3300044706 | Bacteria | 4083 |
| 296 | Ga0466964_0032652 | 3300044706 | Bacteria | 2069 |
| 297 | Ga0466971_0000802 | 3300044719 | Bacteria | 12685 |
| 298 | Ga0466971_0000889 | 3300044719 | Bacteria | 12226 |
| 299 | Ga0466971_0058805 | 3300044719 | Bacteria | 1735 |
| 300 | Ga0466970_0018084 | 3300044765 | Bacteria | 3647 |
| 301 | Ga0466970_0030551 | 3300044765 | Bacteria | 2841 |
| 302 | Ga0466957_0002453 | 3300044842 | Bacteria | 9961 |
| 303 | Ga0466957_0002727 | 3300044842 | Bacteria | 9551 |
| 304 | Ga0466959_0001627 | 3300045049 | Bacteria | 13866 |
| 305 | Ga0466959_0013774 | 3300045049 | Bacteria | 5871 |
| 306 | Ga0466959_0047382 | 3300045049 | Bacteria | 3161 |
| 307 | Ga0466959_0090733 | 3300045049 | Bacteria | 2194 |
| 308 | Ga0466958_0009929 | 3300045836 | Bacteria | 5317 |
| 309 | Ga0466958_0033906 | 3300045836 | Bacteria | 3043 |
| 310 | Ga0466958_0035276 | 3300045836 | Bacteria | 2987 |
| 311 | Ga0495592_0041197 | 3300046454 | Bacteria | 3461 |
| 312 | Ga0495592_0067689 | 3300046454 | Bacteria | 2609 |
| 313 | Ga0495603_0000432 | 3300046455 | Bacteria | 23157 |
| 314 | Ga0495603_0004703 | 3300046455 | Bacteria | 8150 |
| 315 | Ga0495603_0017808 | 3300046455 | Bacteria | 4300 |
| 316 | Ga0495603_0023243 | 3300046455 | Bacteria | 3753 |
| 317 | Ga0495603_0044916 | 3300046455 | Bacteria | 2636 |
| 318 | Ga0495603_0083251 | 3300046455 | Bacteria | 1874 |
| 319 | Ga0495590_0006265 | 3300046457 | Bacteria | 4657 |
| 320 | Ga0495591_016152 | 3300046458 | Bacteria | 2612 |
| 321 | Ga0495629_0000137 | 3300046459 | Bacteria | 64048 |
| 322 | Ga0495629_0000347 | 3300046459 | Bacteria | 39466 |
| 323 | Ga0495629_0000758 | 3300046459 | Bacteria | 26094 |
| 324 | Ga0495629_0004710 | 3300046459 | Bacteria | 10227 |
| 325 | Ga0495629_0010287 | 3300046459 | Bacteria | 6813 |
| 326 | Ga0495638_0041726 | 3300046460 | Bacteria | 2901 |
| 327 | Ga0495638_0153937 | 3300046460 | Bacteria | 1332 |
| 328 | Ga0495641_0052581 | 3300046461 | Bacteria | 1856 |
| 329 | Ga0495651_0021068 | 3300046462 | Bacteria | 5063 |
| 330 | Ga0495651_0077536 | 3300046462 | Bacteria | 2515 |
| 331 | Ga0495651_0129351 | 3300046462 | Bacteria | 1845 |
| 332 | Ga0495653_0016732 | 3300046463 | Bacteria | 5968 |
| 333 | Ga0495653_0031831 | 3300046463 | Bacteria | 4191 |
| 334 | Ga0495653_0042704 | 3300046463 | Bacteria | 3529 |
| 335 | Ga0495653_0102067 | 3300046463 | Bacteria | 2076 |
| 336 | Ga0495653_0105652 | 3300046463 | Bacteria | 2032 |
| 337 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 338 | Ga0495650_0001557 | 3300046471 | Bacteria | 21647 |
| 339 | Ga0495650_0023006 | 3300046471 | Bacteria | 2976 |
| 340 | Ga0495650_0043016 | 3300046471 | Bacteria | 1920 |
| 341 | Ga0495580_0002469 | 3300046472 | Bacteria | 16138 |
| 342 | Ga0495580_0005277 | 3300046472 | Bacteria | 10731 |
| 343 | Ga0495580_0010665 | 3300046472 | Bacteria | 7138 |
| 344 | Ga0495580_0011546 | 3300046472 | Bacteria | 6832 |
| 345 | Ga0495580_0016508 | 3300046472 | Bacteria | 5538 |
| 346 | Ga0495580_0027162 | 3300046472 | Bacteria | 4166 |
| 347 | Ga0495580_0032626 | 3300046472 | Bacteria | 3756 |
| 348 | Ga0495580_0110289 | 3300046472 | Bacteria | 1911 |
| 349 | Ga0495582_0003427 | 3300046473 | Bacteria | 8931 |
| 350 | Ga0495582_0016330 | 3300046473 | Bacteria | 4067 |
| 351 | Ga0495582_0037686 | 3300046473 | Bacteria | 2659 |
| 352 | Ga0495582_0074436 | 3300046473 | Bacteria | 1880 |
| 353 | Ga0495605_0001460 | 3300046474 | Bacteria | 15450 |
| 354 | Ga0495605_0014706 | 3300046474 | Bacteria | 4278 |
| 355 | Ga0495639_0098240 | 3300046475 | Bacteria | 1380 |
| 356 | Ga0495662_0088412 | 3300046476 | Bacteria | 1509 |
| 357 | Ga0495596_0011323 | 3300046500 | Bacteria | 3852 |
| 358 | Ga0495596_0040977 | 3300046500 | Bacteria | 1827 |
| 359 | Ga0495607_0112677 | 3300046501 | Bacteria | 1440 |
| 360 | Ga0495583_0010285 | 3300046506 | Bacteria | 5474 |
| 361 | Ga0495583_0025118 | 3300046506 | Bacteria | 2981 |
| 362 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 363 | Ga0495606_0011252 | 3300046507 | Bacteria | 7322 |
| 364 | Ga0495606_0027111 | 3300046507 | Bacteria | 4068 |
| 365 | Ga0495606_0041979 | 3300046507 | Bacteria | 3063 |
| 366 | Ga0495606_0048529 | 3300046507 | Bacteria | 2791 |
| 367 | Ga0495608_0025099 | 3300046511 | Bacteria | 4070 |
| 368 | Ga0495610_0000745 | 3300046512 | Bacteria | 30877 |
| 369 | Ga0495616_0032089 | 3300046513 | Bacteria | 2747 |
| 370 | Ga0495618_0006257 | 3300046514 | Bacteria | 7224 |
| 371 | Ga0495618_0012697 | 3300046514 | Bacteria | 5119 |
| 372 | Ga0495618_0106703 | 3300046514 | Bacteria | 1793 |
| 373 | Ga0495620_0009291 | 3300046515 | Bacteria | 5235 |
| 374 | Ga0495628_0000137 | 3300046516 | Bacteria | 62400 |
| 375 | Ga0495628_0006690 | 3300046516 | Bacteria | 10051 |
| 376 | Ga0495628_0012413 | 3300046516 | Bacteria | 7186 |
| 377 | Ga0495628_0039092 | 3300046516 | Bacteria | 3795 |
| 378 | Ga0495628_0146128 | 3300046516 | Bacteria | 1802 |
| 379 | Ga0495628_0159712 | 3300046516 | Bacteria | 1713 |
| 380 | Ga0495630_0031819 | 3300046517 | Bacteria | 3929 |
| 381 | Ga0495630_0033475 | 3300046517 | Bacteria | 3833 |
| 382 | Ga0495648_0032651 | 3300046524 | Bacteria | 3412 |
| 383 | Ga0495648_0065198 | 3300046524 | Bacteria | 2142 |
| 384 | Ga0495648_0069447 | 3300046524 | Bacteria | 2050 |
| 385 | Ga0495666_0006163 | 3300046526 | Bacteria | 6033 |
| 386 | Ga0495666_0007979 | 3300046526 | Bacteria | 5301 |
| 387 | Ga0495666_0015305 | 3300046526 | Bacteria | 3819 |
| 388 | Ga0495642_0000414 | 3300046528 | Bacteria | 22851 |
| 389 | Ga0495642_0004007 | 3300046528 | Bacteria | 5757 |
| 390 | Ga0495642_0036471 | 3300046528 | Bacteria | 1987 |
| 391 | Ga0495642_0058902 | 3300046528 | Bacteria | 1591 |
| 392 | Ga0495652_0002204 | 3300046529 | Bacteria | 20452 |
| 393 | Ga0495652_0006929 | 3300046529 | Bacteria | 10486 |
| 394 | Ga0495652_0028672 | 3300046529 | Bacteria | 4895 |
| 395 | Ga0495652_0113038 | 3300046529 | Bacteria | 2180 |
| 396 | Ga0495652_0163685 | 3300046529 | Bacteria | 1724 |
| 397 | Ga0495665_0004525 | 3300046531 | Bacteria | 7504 |
| 398 | Ga0495665_0012093 | 3300046531 | Bacteria | 4672 |
| 399 | Ga0495665_0020916 | 3300046531 | Bacteria | 3515 |
| 400 | Ga0495665_0031143 | 3300046531 | Bacteria | 2855 |
| 401 | Ga0495665_0033039 | 3300046531 | Bacteria | 2767 |
| 402 | Ga0495640_0009812 | 3300046533 | Bacteria | 7432 |
| 403 | Ga0495640_0031426 | 3300046533 | Bacteria | 3789 |
| 404 | Ga0495640_0033955 | 3300046533 | Bacteria | 3622 |
| 405 | Ga0495586_0033197 | 3300046535 | Bacteria | 2770 |
| 406 | Ga0495586_0040132 | 3300046535 | Bacteria | 2517 |
| 407 | Ga0495586_0086126 | 3300046535 | Bacteria | 1731 |
| 408 | Ga0495587_0037065 | 3300046536 | Bacteria | 2930 |
| 409 | Ga0495645_0000199 | 3300046543 | Bacteria | 42823 |
| 410 | Ga0495645_0004719 | 3300046543 | Bacteria | 9313 |
| 411 | Ga0495645_0007467 | 3300046543 | Bacteria | 7610 |
| 412 | Ga0495645_0065787 | 3300046543 | Bacteria | 2622 |
| 413 | Ga0495645_0129632 | 3300046543 | Bacteria | 1768 |
| 414 | Ga0495622_0000287 | 3300046557 | Bacteria | 38482 |
| 415 | Ga0495667_0097216 | 3300046559 | Bacteria | 1906 |
| 416 | Ga0495634_0030733 | 3300046642 | Bacteria | 3705 |
| 417 | Ga0495635_0019299 | 3300046663 | Bacteria | 4754 |
| 418 | Ga0495635_0111480 | 3300046663 | Bacteria | 1869 |
| 419 | Ga0495661_0013584 | 3300046665 | Bacteria | 5466 |
| 420 | Ga0495588_0046604 | 3300046674 | Bacteria | 2224 |
| 421 | Ga0495599_0000974 | 3300046678 | Bacteria | 16022 |
| 422 | Ga0495599_0007611 | 3300046678 | Bacteria | 6577 |
| 423 | Ga0495599_0059721 | 3300046678 | Bacteria | 2385 |
| 424 | Ga0495623_0018295 | 3300046679 | Bacteria | 4525 |
| 425 | Ga0495646_0005768 | 3300046680 | Bacteria | 7852 |
| 426 | Ga0495646_0013419 | 3300046680 | Bacteria | 5209 |
| 427 | Ga0495646_0068824 | 3300046680 | Bacteria | 2089 |
| 428 | Ga0495669_0009043 | 3300046684 | Bacteria | 4198 |
| 429 | Ga0495613_0016752 | 3300046689 | Bacteria | 5457 |
| 430 | Ga0495613_0052563 | 3300046689 | Bacteria | 3000 |
| 431 | Ga0495613_0065291 | 3300046689 | Bacteria | 2660 |
| 432 | Ga0495624_0002935 | 3300046690 | Bacteria | 12761 |
| 433 | Ga0495624_0007690 | 3300046690 | Bacteria | 7559 |
| 434 | Ga0495624_0009295 | 3300046690 | Bacteria | 6810 |
| 435 | Ga0495624_0040062 | 3300046690 | Bacteria | 3001 |
| 436 | Ga0495624_0085892 | 3300046690 | Bacteria | 1943 |
| 437 | Ga0495671_0025478 | 3300046692 | Bacteria | 3074 |
| 438 | Ga0495649_0004871 | 3300046694 | Bacteria | 8674 |
| 439 | Ga0495649_0011631 | 3300046694 | Bacteria | 5156 |
| 440 | Ga0495589_0020527 | 3300046794 | Bacteria | 3378 |
| 441 | Ga0495589_0034978 | 3300046794 | Bacteria | 2520 |
| 442 | Ga0495589_0084239 | 3300046794 | Bacteria | 1545 |
| 443 | Ga0495600_0002755 | 3300046809 | Bacteria | 10182 |
| 444 | Ga0495600_0041504 | 3300046809 | Bacteria | 2998 |
| 445 | Ga0495581_0006112 | 3300047315 | Bacteria | 6979 |
| 446 | Ga0495604_0002589 | 3300047317 | Bacteria | 14489 |
| 447 | Ga0495604_0026260 | 3300047317 | Bacteria | 4637 |
| 448 | Ga0495604_0165128 | 3300047317 | Bacteria | 1561 |
| 449 | Ga0495674_0010307 | 3300047319 | Bacteria | 8849 |
| 450 | Ga0495674_0013082 | 3300047319 | Bacteria | 7807 |
| 451 | Ga0495674_0027005 | 3300047319 | Bacteria | 5250 |
| 452 | Ga0495674_0068948 | 3300047319 | Bacteria | 3059 |
| 453 | Ga0495674_0075082 | 3300047319 | Bacteria | 2909 |
| 454 | Ga0495672_0001027 | 3300047320 | Bacteria | 28668 |
| 455 | Ga0495672_0001926 | 3300047320 | Bacteria | 19623 |
| 456 | Ga0495672_0039454 | 3300047320 | Bacteria | 2870 |
| 457 | Ga0495676_0054518 | 3300047321 | Bacteria | 3178 |
| 458 | Ga0495676_0083231 | 3300047321 | Bacteria | 2418 |
| 459 | Ga0495680_0023547 | 3300047322 | Bacteria | 5117 |
| 460 | Ga0495680_0027997 | 3300047322 | Bacteria | 4624 |
| 461 | Ga0495680_0068214 | 3300047322 | Bacteria | 2718 |
| 462 | Ga0495680_0079995 | 3300047322 | Bacteria | 2470 |
| 463 | Ga0495683_0001001 | 3300047323 | Bacteria | 19747 |
| 464 | Ga0495683_0026531 | 3300047323 | Bacteria | 2965 |
| 465 | Ga0495683_0032946 | 3300047323 | Bacteria | 2638 |
| 466 | Ga0495687_000005 | 3300047443 | Bacteria | 610401 |
| 467 | Ga0495687_000021 | 3300047443 | Bacteria | 334681 |
| 468 | Ga0495687_003872 | 3300047443 | Bacteria | 10509 |
| 469 | Ga0495687_007444 | 3300047443 | Bacteria | 6445 |
| 470 | Ga0495687_008078 | 3300047443 | Bacteria | 6080 |
| 471 | Ga0495687_025058 | 3300047443 | Bacteria | 2826 |
| 472 | Ga0495687_045002 | 3300047443 | Bacteria | 1914 |
| 473 | Ga0495675_0118482 | 3300047444 | Bacteria | 1649 |
| 474 | Ga0495679_000013 | 3300047446 | Bacteria | 313222 |
| 475 | Ga0495679_000885 | 3300047446 | Bacteria | 18761 |
| 476 | Ga0495679_009825 | 3300047446 | Bacteria | 3798 |
| 477 | Ga0495673_0018628 | 3300047469 | Bacteria | 3496 |
| 478 | Ga0495673_0026075 | 3300047469 | Bacteria | 2799 |
| 479 | Ga0495686_0000081 | 3300047472 | Bacteria | 201295 |
| 480 | Ga0495593_0005939 | 3300047673 | Bacteria | 7193 |
| 481 | Ga0495593_0008969 | 3300047673 | Bacteria | 5805 |
| 482 | Ga0495593_0026977 | 3300047673 | Bacteria | 3165 |
| 483 | Ga0495593_0036021 | 3300047673 | Bacteria | 2684 |
| 484 | Ga0495593_0059737 | 3300047673 | Bacteria | 1997 |
| 485 | Ga0495602_0005107 | 3300048088 | Bacteria | 13752 |
| 486 | Ga0495602_0021462 | 3300048088 | Bacteria | 6355 |
| 487 | Ga0495602_0143927 | 3300048088 | Bacteria | 1883 |
| 488 | Ga0495614_0010574 | 3300048089 | Bacteria | 4069 |
| 489 | Ga0495614_0017139 | 3300048089 | Bacteria | 3147 |
| 490 | Ga0495626_0009632 | 3300048091 | Bacteria | 5212 |
| 491 | Ga0496100_0000378 | 3300048903 | Bacteria | 21717 |
| 492 | Ga0496100_0000628 | 3300048903 | Bacteria | 16749 |
| 493 | Ga0496100_0189151 | 3300048903 | Bacteria | 1493 |
| 494 | Ga0496101_0000204 | 3300048904 | Bacteria | 45284 |
| 495 | Ga0496101_0000412 | 3300048904 | Bacteria | 27673 |
| 496 | Ga0496101_0053512 | 3300048904 | Bacteria | 2913 |
| 497 | Ga0496101_0103806 | 3300048904 | Bacteria | 2131 |
| 498 | Ga0496102_0000298 | 3300048905 | Bacteria | 63657 |
| 499 | Ga0496102_0001948 | 3300048905 | Bacteria | 17797 |
| 500 | Ga0496102_0017679 | 3300048905 | Bacteria | 6250 |
| 501 | Ga0496103_0000253 | 3300048906 | Bacteria | 51430 |
| 502 | Ga0496103_0018032 | 3300048906 | Bacteria | 4230 |
| 503 | Ga0496104_0007649 | 3300048907 | Bacteria | 9566 |
| 504 | Ga0496104_0047706 | 3300048907 | Bacteria | 4037 |
| 505 | Ga0496104_0059412 | 3300048907 | Bacteria | 3620 |
| 506 | Ga0496104_0062090 | 3300048907 | Bacteria | 3543 |
| 507 | Ga0496104_0079598 | 3300048907 | Bacteria | 3124 |
| 508 | Ga0496105_0008358 | 3300048908 | Bacteria | 8042 |
| 509 | Ga0496105_0044120 | 3300048908 | Bacteria | 3676 |
| 510 | Ga0496105_0066437 | 3300048908 | Bacteria | 2977 |
| 511 | Ga0496105_0227523 | 3300048908 | Bacteria | 1516 |
| 512 | Ga0496106_0197317 | 3300048909 | Bacteria | 1601 |
| 513 | Ga0496107_0029899 | 3300048910 | Bacteria | 3880 |
| 514 | Ga0496107_0059471 | 3300048910 | Bacteria | 2765 |
| 515 | Ga0496107_0078328 | 3300048910 | Bacteria | 2408 |
| 516 | Ga0496110_0000857 | 3300048913 | Bacteria | 21461 |
| 517 | Ga0496110_0035868 | 3300048913 | Bacteria | 4306 |
| 518 | Ga0496110_0125994 | 3300048913 | Bacteria | 2311 |
| 519 | Ga0496110_0155613 | 3300048913 | Bacteria | 2071 |
| 520 | Ga0496110_0220248 | 3300048913 | Bacteria | 1726 |
| 521 | Ga0496112_0004494 | 3300048915 | Bacteria | 11838 |
| 522 | Ga0496113_0042818 | 3300048916 | Bacteria | 3347 |
| 523 | Ga0496114_0000299 | 3300048917 | Bacteria | 36473 |
| 524 | Ga0496114_0012267 | 3300048917 | Bacteria | 6858 |
| 525 | Ga0496115_0087343 | 3300048918 | Bacteria | 2545 |
| 526 | Ga0496115_0259141 | 3300048918 | Bacteria | 1430 |
| 527 | Ga0496116_0024193 | 3300048919 | Bacteria | 4498 |
| 528 | Ga0496117_0000171 | 3300048920 | Bacteria | 135051 |
| 529 | Ga0496117_0003808 | 3300048920 | Bacteria | 17184 |
| 530 | Ga0496117_0003944 | 3300048920 | Bacteria | 16784 |
| 531 | Ga0496117_0010066 | 3300048920 | Bacteria | 8686 |
| 532 | Ga0496117_0015912 | 3300048920 | Bacteria | 6373 |
| 533 | Ga0496117_0016201 | 3300048920 | Bacteria | 6300 |
| 534 | Ga0496118_0000276 | 3300048921 | Bacteria | 90379 |
| 535 | Ga0496118_0001274 | 3300048921 | Bacteria | 38638 |
| 536 | Ga0496118_0001751 | 3300048921 | Bacteria | 31501 |
| 537 | Ga0496118_0004406 | 3300048921 | Bacteria | 16720 |
| 538 | Ga0496118_0013254 | 3300048921 | Bacteria | 7818 |
| 539 | Ga0496118_0022028 | 3300048921 | Bacteria | 5587 |
| 540 | Ga0496121_0001129 | 3300048924 | Bacteria | 46851 |
| 541 | Ga0496121_0005700 | 3300048924 | Bacteria | 15826 |
| 542 | Ga0496121_0005701 | 3300048924 | Bacteria | 15822 |
| 543 | Ga0496121_0023755 | 3300048924 | Bacteria | 5890 |
| 544 | Ga0496121_0049892 | 3300048924 | Bacteria | 3542 |
| 545 | Ga0496122_0047498 | 3300048925 | Bacteria | 3314 |
| 546 | Ga0496124_0000003 | 3300048927 | Bacteria | 1300161 |
| 547 | Ga0496126_0004750 | 3300048929 | Bacteria | 16019 |
| 548 | Ga0496126_0007120 | 3300048929 | Bacteria | 12321 |
| 549 | Ga0495678_023955 | 3300049459 | Bacteria | 2644 |
| 550 | Ga0501032_0011514 | 3300049569 | Bacteria | 6354 |
| 551 | Ga0501034_0000326 | 3300049571 | Bacteria | 83622 |
| 552 | Ga0501034_0008301 | 3300049571 | Bacteria | 10992 |
| 553 | Ga0501034_0016737 | 3300049571 | Bacteria | 7518 |
| 554 | Ga0501034_0081321 | 3300049571 | Bacteria | 3242 |
| 555 | Ga0501034_0167184 | 3300049571 | Bacteria | 2168 |
| 556 | Ga0501034_0299448 | 3300049571 | Bacteria | 1545 |
| 557 | Ga0501037_0000230 | 3300049573 | Bacteria | 48351 |
| 558 | Ga0501037_0031473 | 3300049573 | Bacteria | 3917 |
| 559 | Ga0501038_0011745 | 3300049574 | Bacteria | 7990 |
| 560 | Ga0501039_0000219 | 3300049575 | Bacteria | 41841 |
| 561 | Ga0501040_0010040 | 3300049576 | Bacteria | 6183 |
| 562 | Ga0501043_0000025 | 3300049579 | Bacteria | 149850 |
| 563 | Ga0501043_0006291 | 3300049579 | Bacteria | 9534 |
| 564 | Ga0501047_0077543 | 3300049581 | Bacteria | 3196 |
| 565 | Ga0501073_0001040 | 3300049589 | Bacteria | 20052 |
| 566 | Ga0501080_0009567 | 3300049742 | Bacteria | 8848 |
| 567 | Ga0501083_0101466 | 3300049744 | Bacteria | 1897 |
| 568 | Ga0501035_0128535 | 3300049822 | Bacteria | 2210 |
| 569 | Ga0501044_0001836 | 3300049823 | Bacteria | 24727 |
| 570 | Ga0501044_0076547 | 3300049823 | Bacteria | 3395 |
| 571 | Ga0501045_0089574 | 3300049824 | Bacteria | 2273 |
| 572 | Ga0500595_000593 | 3300053119 | Bacteria | 21550 |
| 573 | Ga0500574_002716 | 3300053141 | Bacteria | 2975 |
| 574 | Ga0500616_0014806 | 3300053153 | Bacteria | 4472 |
| 575 | Ga0500619_000553 | 3300053154 | Bacteria | 6389 |
| 576 | Ga0587083_0011409 | 3300059505 | Bacteria | 1465 |
| 577 | Ga0587067_006924 | 3300059640 | Bacteria | 1602 |
| 578 | Ga0587072_003250 | 3300059643 | Bacteria | 2266 |
| 579 | Ga0501082_0000003 | 3300060353 | Bacteria | 170684 |
| 580 | Ga0501082_0108693 | 3300060353 | Bacteria | 2400 |
| 581 | Ga0466962_0002106 | 3300061719 | Bacteria | 9409 |
| 582 | Ga0466962_0003684 | 3300061719 | Bacteria | 7303 |
| 583 | Ga0466962_0004737 | 3300061719 | Bacteria | 6537 |
| 584 | Ga0530510_0003134 | 3300061734 | Bacteria | 11352 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046463 | Ga0495653_0042704 | Ga0495653_0042704_12_1151 | 372 |
| 2 | 3300046460 | Ga0495638_0041726 | Ga0495638_0041726_779_2107 | 378 |
| 3 | iso_pu_bacteria | 2921643360 | 2921653919 | 378 |
| 4 | 3300046680 | Ga0495646_0068824 | Ga0495646_0068824_694_1833 | 379 |
| 5 | iso_pu_bacteria | 2904615490 | 2904617637 | 382 |
| 6 | 3300048913 | Ga0496110_0155613 | Ga0496110_0155613_891_2051 | 383 |
| 7 | 3300049569 | Ga0501032_0011514 | Ga0501032_0011514_635_1846 | 396 |
| 8 | 3300053153 | Ga0500616_0014806 | Ga0500616_0014806_1016_2344 | 396 |
| 9 | iso_pu_bacteria | 2858438669 | 2858440781 | 403 |
| 10 | iso_pu_bacteria | 2928519762 | 2928520291 | 403 |
| 11 | 3300037418 | Ga0395900_0101315 | Ga0395900_0101315_1723_2943 | 406 |
| 12 | 3300046689 | Ga0495613_0065291 | Ga0495613_0065291_1007_2230 | 407 |
| 13 | 3300047673 | Ga0495593_0059737 | Ga0495593_0059737_523_1773 | 408 |
| 14 | 3300046535 | Ga0495586_0040132 | Ga0495586_0040132_376_1629 | 409 |
| 15 | 3300048907 | Ga0496104_0007649 | Ga0496104_0007649_3523_4767 | 409 |
| 16 | 3300048908 | Ga0496105_0066437 | Ga0496105_0066437_1173_2417 | 409 |
| 17 | 3300048910 | Ga0496107_0078328 | Ga0496107_0078328_149_1393 | 409 |
| 18 | 3300061734 | Ga0530510_0003134 | Ga0530510_0003134_2352_3614 | 409 |
| 19 | 3300005439 | Ga0070711_100000008 | Ga0070711_100000008115 | 410 |
| 20 | 3300005439 | Ga0070711_100018442 | Ga0070711_1000184421 | 410 |
| 21 | 3300005530 | Ga0070679_100048109 | Ga0070679_1000481092 | 410 |
| 22 | 3300025916 | Ga0207663_10000023 | Ga0207663_100000237 | 410 |
| 23 | 3300025916 | Ga0207663_10013832 | Ga0207663_100138325 | 410 |
| 24 | 3300037471 | Ga0395905_0001161 | Ga0395905_0001161_20089_21330 | 410 |
| 25 | 3300048913 | Ga0496110_0000857 | Ga0496110_0000857_3033_4265 | 410 |
| 26 | 3300048927 | Ga0496124_0000003 | Ga0496124_0000003_1155775_1157007 | 410 |
| 27 | 3300049573 | Ga0501037_0000230 | Ga0501037_0000230_11706_12965 | 410 |
| 28 | 3300049575 | Ga0501039_0000219 | Ga0501039_0000219_11698_12957 | 410 |
| 29 | 3300049576 | Ga0501040_0010040 | Ga0501040_0010040_1989_3248 | 410 |
| 30 | 3300049579 | Ga0501043_0000025 | Ga0501043_0000025_111917_113176 | 410 |
| 31 | 3300049824 | Ga0501045_0089574 | Ga0501045_0089574_415_1674 | 410 |
| 32 | iso_pu_bacteria | 8015556637 | 8015557332 | 410 |
| 33 | 3300005458 | Ga0070681_10001701 | Ga0070681_100017013 | 411 |
| 34 | 3300005530 | Ga0070679_100100214 | Ga0070679_1001002142 | 411 |
| 35 | 3300025912 | Ga0207707_10000098 | Ga0207707_1000009857 | 411 |
| 36 | 3300025917 | Ga0207660_10079740 | Ga0207660_100797402 | 411 |
| 37 | 3300025949 | Ga0207667_10073993 | Ga0207667_100739933 | 411 |
| 38 | 3300025949 | Ga0207667_10228092 | Ga0207667_102280922 | 411 |
| 39 | 3300028577 | Ga0265318_10013761 | Ga0265318_100137613 | 411 |
| 40 | 3300028800 | Ga0265338_10001766 | Ga0265338_100017667 | 411 |
| 41 | 3300028800 | Ga0265338_10019124 | Ga0265338_100191243 | 411 |
| 42 | 3300031240 | Ga0265320_10033832 | Ga0265320_100338322 | 411 |
| 43 | 3300031595 | Ga0265313_10008523 | Ga0265313_100085234 | 411 |
| 44 | 3300031711 | Ga0265314_10006743 | Ga0265314_100067434 | 411 |
| 45 | 3300046455 | Ga0495603_0017808 | Ga0495603_0017808_2600_3874 | 411 |
| 46 | 3300046472 | Ga0495580_0032626 | Ga0495580_0032626_450_1724 | 411 |
| 47 | 3300046516 | Ga0495628_0146128 | Ga0495628_0146128_450_1724 | 411 |
| 48 | 3300046524 | Ga0495648_0032651 | Ga0495648_0032651_1024_2298 | 411 |
| 49 | 3300046531 | Ga0495665_0020916 | Ga0495665_0020916_883_2157 | 411 |
| 50 | 3300046533 | Ga0495640_0031426 | Ga0495640_0031426_481_1755 | 411 |
| 51 | 3300046535 | Ga0495586_0033197 | Ga0495586_0033197_1123_2397 | 411 |
| 52 | 3300046689 | Ga0495613_0016752 | Ga0495613_0016752_2444_3718 | 411 |
| 53 | 3300046690 | Ga0495624_0002935 | Ga0495624_0002935_8012_9286 | 411 |
| 54 | 3300047315 | Ga0495581_0006112 | Ga0495581_0006112_3291_4565 | 411 |
| 55 | 3300047319 | Ga0495674_0027005 | Ga0495674_0027005_852_2126 | 411 |
| 56 | 3300047446 | Ga0495679_009825 | Ga0495679_009825_2151_3425 | 411 |
| 57 | 3300047673 | Ga0495593_0008969 | Ga0495593_0008969_2372_3646 | 411 |
| 58 | 3300048089 | Ga0495614_0017139 | Ga0495614_0017139_133_1407 | 411 |
| 59 | 3300049571 | Ga0501034_0000326 | Ga0501034_0000326_38895_40163 | 411 |
| 60 | 3300049571 | Ga0501034_0008301 | Ga0501034_0008301_2416_3684 | 411 |
| 61 | 3300049571 | Ga0501034_0016737 | Ga0501034_0016737_5069_6337 | 411 |
| 62 | 3300049571 | Ga0501034_0167184 | Ga0501034_0167184_40_1308 | 411 |
| 63 | 3300049571 | Ga0501034_0299448 | Ga0501034_0299448_86_1354 | 411 |
| 64 | 3300049573 | Ga0501037_0031473 | Ga0501037_0031473_1719_2987 | 411 |
| 65 | 3300060353 | Ga0501082_0000003 | Ga0501082_0000003_158227_159495 | 411 |
| 66 | iso_pu_bacteria | 2617270889 | 2617916900 | 411 |
| 67 | iso_pu_bacteria | 2913939268 | 2913940681 | 411 |
| 68 | iso_pu_bacteria | 642555144 | 642604099 | 411 |
| 69 | 3300005329 | Ga0070683_100191065 | Ga0070683_1001910651 | 412 |
| 70 | 3300046543 | Ga0495645_0065787 | Ga0495645_0065787_493_1767 | 412 |
| 71 | 3300048913 | Ga0496110_0220248 | Ga0496110_0220248_55_1314 | 412 |
| 72 | 3300049571 | Ga0501034_0081321 | Ga0501034_0081321_1645_2910 | 412 |
| 73 | iso_pu_bacteria | 2901300506 | 2901309054 | 414 |
| 74 | 3300047322 | Ga0495680_0068214 | Ga0495680_0068214_332_1603 | 415 |
| 75 | 3300046536 | Ga0495587_0037065 | Ga0495587_0037065_234_1556 | 417 |
| 76 | 3300048918 | Ga0496115_0259141 | Ga0496115_0259141_11_1273 | 418 |
| 77 | iso_pu_bacteria | 2818991436 | 2819544288 | 418 |
| 78 | iso_pu_bacteria | 2501025501 | 2501069941 | 420 |
| 79 | iso_pu_bacteria | 2501025504 | 2501412067 | 420 |
| 80 | iso_pu_bacteria | 2508501125 | 2509127723 | 420 |
| 81 | iso_pu_bacteria | 2510065045 | 2510249403 | 420 |
| 82 | iso_pu_bacteria | 2510917014 | 2511101061 | 420 |
| 83 | iso_pu_bacteria | 2510917015 | 2511107195 | 420 |
| 84 | iso_pu_bacteria | 2513237082 | 2513554943 | 420 |
| 85 | iso_pu_bacteria | 2513237082 | 2513555170 | 420 |
| 86 | iso_pu_bacteria | 2513237083 | 2513563058 | 420 |
| 87 | iso_pu_bacteria | 2513237083 | 2513566141 | 420 |
| 88 | iso_pu_bacteria | 2513237151 | 2513962915 | 420 |
| 89 | iso_pu_bacteria | 2513237165 | 2514045206 | 420 |
| 90 | iso_pu_bacteria | 2513237166 | 2514049670 | 420 |
| 91 | iso_pu_bacteria | 2513237166 | 2514052735 | 420 |
| 92 | iso_pu_bacteria | 2515154122 | 2515680022 | 420 |
| 93 | iso_pu_bacteria | 2515154122 | 2515682827 | 420 |
| 94 | iso_pu_bacteria | 2515154123 | 2515688110 | 420 |
| 95 | iso_pu_bacteria | 2515154123 | 2515692270 | 420 |
| 96 | iso_pu_bacteria | 2515154189 | 2516019133 | 420 |
| 97 | iso_pu_bacteria | 2515154189 | 2516021963 | 420 |
| 98 | iso_pu_bacteria | 2519103095 | 2519460330 | 420 |
| 99 | iso_pu_bacteria | 2526164713 | 2527076403 | 420 |
| 100 | iso_pu_bacteria | 2562617112 | 2563056717 | 420 |
| 101 | iso_pu_bacteria | 2562617112 | 2563057240 | 420 |
| 102 | iso_pu_bacteria | 2599185178 | 2599448561 | 420 |
| 103 | iso_pu_bacteria | 2599185239 | 2599741301 | 420 |
| 104 | iso_pu_bacteria | 2599185240 | 2599747287 | 420 |
| 105 | iso_pu_bacteria | 2599185355 | 2600209088 | 420 |
| 106 | iso_pu_bacteria | 2675903129 | 2676745116 | 420 |
| 107 | iso_pu_bacteria | 2711768613 | 2713474066 | 420 |
| 108 | iso_pu_bacteria | 2711768613 | 2713481272 | 420 |
| 109 | iso_pu_bacteria | 2718217991 | 2719642190 | 420 |
| 110 | iso_pu_bacteria | 2738541296 | 2738824179 | 420 |
| 111 | iso_pu_bacteria | 2738541298 | 2738836946 | 420 |
| 112 | iso_pu_bacteria | 2738541306 | 2738878477 | 420 |
| 113 | iso_pu_bacteria | 2738543002 | 2739190149 | 420 |
| 114 | iso_pu_bacteria | 2738543008 | 2739225070 | 420 |
| 115 | iso_pu_bacteria | 2744054900 | 2746084746 | 420 |
| 116 | iso_pu_bacteria | 2744054901 | 2746093089 | 420 |
| 117 | iso_pu_bacteria | 2751185846 | 2753568203 | 420 |
| 118 | iso_pu_bacteria | 2751185846 | 2753570486 | 420 |
| 119 | iso_pu_bacteria | 2791355137 | 2792835469 | 420 |
| 120 | iso_pu_bacteria | 2791355137 | 2792839348 | 420 |
| 121 | iso_pu_bacteria | 2816332253 | 2817257877 | 420 |
| 122 | iso_pu_bacteria | 2816332256 | 2817281732 | 420 |
| 123 | iso_pu_bacteria | 2816332286 | 2817456013 | 420 |
| 124 | iso_pu_bacteria | 2818991450 | 2819620092 | 420 |
| 125 | iso_pu_bacteria | 2818991450 | 2819622426 | 420 |
| 126 | iso_pu_bacteria | 2818991452 | 2819635219 | 420 |
| 127 | iso_pu_bacteria | 2842324504 | 2842332516 | 420 |
| 128 | iso_pu_bacteria | 2842348783 | 2842356919 | 420 |
| 129 | iso_pu_bacteria | 2842454564 | 2842461383 | 420 |
| 130 | iso_pu_bacteria | 2856287931 | 2856289818 | 420 |
| 131 | iso_pu_bacteria | 2857357740 | 2857363142 | 420 |
| 132 | iso_pu_bacteria | 2863421361 | 2863424369 | 420 |
| 133 | iso_pu_bacteria | 2870068957 | 2870073540 | 420 |
| 134 | iso_pu_bacteria | 2883087390 | 2883087757 | 420 |
| 135 | iso_pu_bacteria | 2883087390 | 2883089277 | 420 |
| 136 | iso_pu_bacteria | 2885270888 | 2885275279 | 420 |
| 137 | iso_pu_bacteria | 2885270888 | 2885279546 | 420 |
| 138 | iso_pu_bacteria | 2900634093 | 2900640598 | 420 |
| 139 | iso_pu_bacteria | 2900634093 | 2900641057 | 420 |
| 140 | iso_pu_bacteria | 2900634093 | 2900643067 | 420 |
| 141 | iso_pu_bacteria | 2902682994 | 2902684362 | 420 |
| 142 | iso_pu_bacteria | 2902682994 | 2902688728 | 420 |
| 143 | iso_pu_bacteria | 2904483920 | 2904485102 | 420 |
| 144 | iso_pu_bacteria | 2904483920 | 2904485782 | 420 |
| 145 | iso_pu_bacteria | 2904564687 | 2904567535 | 420 |
| 146 | iso_pu_bacteria | 2904571731 | 2904574580 | 420 |
| 147 | iso_pu_bacteria | 2919527303 | 2919530827 | 420 |
| 148 | iso_pu_bacteria | 2919527303 | 2919532564 | 420 |
| 149 | iso_pu_bacteria | 2928108538 | 2928110350 | 420 |
| 150 | iso_pu_bacteria | 2928108538 | 2928111851 | 420 |
| 151 | iso_pu_bacteria | 2928135762 | 2928138516 | 420 |
| 152 | iso_pu_bacteria | 2928135762 | 2928139090 | 420 |
| 153 | iso_pu_bacteria | 2928157003 | 2928158375 | 420 |
| 154 | iso_pu_bacteria | 2928163908 | 2928167415 | 420 |
| 155 | iso_pu_bacteria | 2928170801 | 2928177040 | 420 |
| 156 | iso_pu_bacteria | 2928503688 | 2928505422 | 420 |
| 157 | iso_pu_bacteria | 2928503688 | 2928508788 | 420 |
| 158 | iso_pu_bacteria | 2928536128 | 2928540304 | 420 |
| 159 | iso_pu_bacteria | 2945934425 | 2945939274 | 420 |
| 160 | iso_pu_bacteria | 2981990288 | 2981991838 | 420 |
| 161 | iso_pu_bacteria | 2990703756 | 2990706613 | 420 |
| 162 | iso_pu_bacteria | 641736151 | 642426489 | 420 |
| 163 | iso_pu_bacteria | 641736154 | 642414209 | 420 |
| 164 | iso_pu_bacteria | 642555112 | 642595093 | 420 |
| 165 | iso_pu_bacteria | 642555112 | 642598522 | 420 |
| 166 | iso_pu_bacteria | 642555113 | 642616154 | 420 |
| 167 | iso_pu_bacteria | 8003955200 | 8003956189 | 420 |
| 168 | iso_pu_bacteria | 8003955200 | 8003959141 | 420 |
| 169 | iso_pu_bacteria | 8018845410 | 8018850234 | 420 |
| 170 | iso_pu_bacteria | 8020807995 | 8020812225 | 420 |
| 171 | iso_pu_bacteria | 8020938398 | 8020941189 | 420 |
| 172 | iso_pu_bacteria | 8020945358 | 8020946708 | 420 |
| 173 | iso_pu_bacteria | 8020953355 | 8020958319 | 420 |
| 174 | iso_pu_bacteria | 8021120328 | 8021123896 | 420 |
| 175 | iso_pu_bacteria | 8040167225 | 8040170744 | 420 |
| 176 | iso_pu_bacteria | 8040173305 | 8040176949 | 420 |
| 177 | iso_pu_bacteria | 8055266321 | 8055271601 | 420 |
| 178 | iso_pu_bacteria | 8055266321 | 8055272677 | 420 |
| 179 | iso_pu_bacteria | 8055301274 | 8055306581 | 420 |
| 180 | 3300002737 | JGI25162J39368_1000052 | JGI25162J39368_100005285 | 422 |
| 181 | 3300003214 | JGI25165J46597_1000105 | JGI25165J46597_100010567 | 422 |
| 182 | 3300003751 | Ga0055538_1000043 | Ga0055538_100004367 | 422 |
| 183 | 3300003752 | Ga0055539_1000057 | Ga0055539_100005767 | 422 |
| 184 | 3300003756 | Ga0055533_1000071 | Ga0055533_100007167 | 422 |
| 185 | 3300003759 | Ga0055525_1000085 | Ga0055525_100008567 | 422 |
| 186 | 3300003841 | Ga0055541_1000044 | Ga0055541_100004485 | 422 |
| 187 | 3300005327 | Ga0070658_10048516 | Ga0070658_100485164 | 422 |
| 188 | 3300005366 | Ga0070659_100094113 | Ga0070659_1000941132 | 422 |
| 189 | 3300014497 | Ga0182008_10025257 | Ga0182008_100252572 | 422 |
| 190 | 3300015262 | Ga0182007_10003364 | Ga0182007_100033644 | 422 |
| 191 | 3300025224 | Ga0209784_100069 | Ga0209784_10006969 | 422 |
| 192 | 3300025225 | Ga0209566_100083 | Ga0209566_10008369 | 422 |
| 193 | 3300025226 | Ga0209674_100106 | Ga0209674_10010669 | 422 |
| 194 | 3300025230 | Ga0209563_100100 | Ga0209563_10010069 | 422 |
| 195 | 3300025233 | Ga0209437_100156 | Ga0209437_10015669 | 422 |
| 196 | 3300025253 | Ga0209677_100061 | Ga0209677_10006169 | 422 |
| 197 | 3300025261 | Ga0209233_1000165 | Ga0209233_100016569 | 422 |
| 198 | 3300025909 | Ga0207705_10052350 | Ga0207705_100523501 | 422 |
| 199 | 3300025933 | Ga0207706_10088231 | Ga0207706_100882313 | 422 |
| 200 | 3300026142 | Ga0207698_10071541 | Ga0207698_100715413 | 422 |
| 201 | 3300037312 | Ga0395899_0006229 | Ga0395899_0006229_3661_4932 | 422 |
| 202 | 3300037312 | Ga0395899_0074250 | Ga0395899_0074250_993_2264 | 422 |
| 203 | 3300037471 | Ga0395905_0000144 | Ga0395905_0000144_59683_60954 | 422 |
| 204 | 3300037471 | Ga0395905_0048375 | Ga0395905_0048375_2033_3304 | 422 |
| 205 | 3300038443 | Ga0395901_0046848 | Ga0395901_0046848_1586_2857 | 422 |
| 206 | 3300046454 | Ga0495592_0067689 | Ga0495592_0067689_611_1879 | 422 |
| 207 | 3300046463 | Ga0495653_0016732 | Ga0495653_0016732_2836_4104 | 422 |
| 208 | 3300046471 | Ga0495650_0000226 | Ga0495650_0000226_26859_28130 | 422 |
| 209 | 3300046507 | Ga0495606_0000066 | Ga0495606_0000066_36812_38083 | 422 |
| 210 | 3300046514 | Ga0495618_0006257 | Ga0495618_0006257_2006_3274 | 422 |
| 211 | 3300046516 | Ga0495628_0000137 | Ga0495628_0000137_50454_51722 | 422 |
| 212 | 3300046516 | Ga0495628_0039092 | Ga0495628_0039092_463_1731 | 422 |
| 213 | 3300046524 | Ga0495648_0069447 | Ga0495648_0069447_195_1466 | 422 |
| 214 | 3300046528 | Ga0495642_0036471 | Ga0495642_0036471_527_1798 | 422 |
| 215 | 3300046529 | Ga0495652_0002204 | Ga0495652_0002204_6475_7743 | 422 |
| 216 | 3300046529 | Ga0495652_0006929 | Ga0495652_0006929_162_1430 | 422 |
| 217 | 3300046529 | Ga0495652_0028672 | Ga0495652_0028672_2188_3456 | 422 |
| 218 | 3300046543 | Ga0495645_0007467 | Ga0495645_0007467_2933_4201 | 422 |
| 219 | 3300046543 | Ga0495645_0129632 | Ga0495645_0129632_408_1676 | 422 |
| 220 | 3300046678 | Ga0495599_0000974 | Ga0495599_0000974_9589_10857 | 422 |
| 221 | 3300046679 | Ga0495623_0018295 | Ga0495623_0018295_1312_2580 | 422 |
| 222 | 3300046680 | Ga0495646_0013419 | Ga0495646_0013419_2244_3512 | 422 |
| 223 | 3300046690 | Ga0495624_0085892 | Ga0495624_0085892_152_1420 | 422 |
| 224 | 3300046809 | Ga0495600_0002755 | Ga0495600_0002755_8792_10060 | 422 |
| 225 | 3300047317 | Ga0495604_0002589 | Ga0495604_0002589_752_2020 | 422 |
| 226 | 3300048088 | Ga0495602_0021462 | Ga0495602_0021462_2836_4104 | 422 |
| 227 | 3300049823 | Ga0501044_0001836 | Ga0501044_0001836_9625_10914 | 422 |
| 228 | 3300053119 | Ga0500595_000593 | Ga0500595_000593_10901_12169 | 422 |
| 229 | 3300053141 | Ga0500574_002716 | Ga0500574_002716_213_1481 | 422 |
| 230 | 3300053154 | Ga0500619_000553 | Ga0500619_000553_716_1984 | 422 |
| 231 | 3300001989 | JGI24739J22299_10006381 | JGI24739J22299_100063812 | 423 |
| 232 | 3300002705 | JGI25156J39149_1000718 | JGI25156J39149_10007189 | 423 |
| 233 | 3300003354 | JGI25160J50197_1000138 | JGI25160J50197_100013817 | 423 |
| 234 | 3300003756 | Ga0055533_1000317 | Ga0055533_100031711 | 423 |
| 235 | 3300005262 | Ga0065165_1001078 | Ga0065165_100107822 | 423 |
| 236 | 3300009011 | Ga0105251_10000043 | Ga0105251_1000004355 | 423 |
| 237 | 3300015262 | Ga0182007_10004520 | Ga0182007_100045201 | 423 |
| 238 | 3300025206 | Ga0209435_102220 | Ga0209435_1022202 | 423 |
| 239 | 3300025226 | Ga0209674_100157 | Ga0209674_10015745 | 423 |
| 240 | 3300025228 | Ga0209672_100188 | Ga0209672_10018812 | 423 |
| 241 | 3300025256 | Ga0209759_1000363 | Ga0209759_100036349 | 423 |
| 242 | 3300025284 | Ga0209130_1009846 | Ga0209130_10098462 | 423 |
| 243 | 3300025302 | Ga0207426_1000018 | Ga0207426_1000018366 | 423 |
| 244 | 3300025735 | Ga0207713_1000240 | Ga0207713_100024063 | 423 |
| 245 | 3300025904 | Ga0207647_10003472 | Ga0207647_100034724 | 423 |
| 246 | 3300025913 | Ga0207695_10114130 | Ga0207695_101141302 | 423 |
| 247 | 3300025949 | Ga0207667_10058573 | Ga0207667_100585735 | 423 |
| 248 | 3300037312 | Ga0395899_0000023 | Ga0395899_0000023_344525_345820 | 423 |
| 249 | 3300037418 | Ga0395900_0000019 | Ga0395900_0000019_21340_22635 | 423 |
| 250 | 3300037418 | Ga0395900_0000265 | Ga0395900_0000265_38234_39529 | 423 |
| 251 | 3300037418 | Ga0395900_0032838 | Ga0395900_0032838_560_1855 | 423 |
| 252 | 3300037466 | Ga0395898_0000016 | Ga0395898_0000016_16489_17784 | 423 |
| 253 | 3300037466 | Ga0395898_0127450 | Ga0395898_0127450_906_2201 | 423 |
| 254 | 3300037471 | Ga0395905_0000009 | Ga0395905_0000009_380278_381573 | 423 |
| 255 | 3300037471 | Ga0395905_0033555 | Ga0395905_0033555_345_1640 | 423 |
| 256 | 3300038443 | Ga0395901_0000009 | Ga0395901_0000009_438416_439711 | 423 |
| 257 | 3300038443 | Ga0395901_0015476 | Ga0395901_0015476_4908_6203 | 423 |
| 258 | 3300039447 | Ga0436361_0501535 | Ga0436361_0501535_1419_2714 | 423 |
| 259 | 3300044656 | Ga0466969_0002473 | Ga0466969_0002473_7322_8617 | 423 |
| 260 | 3300044683 | Ga0466965_0001437 | Ga0466965_0001437_5736_7031 | 423 |
| 261 | 3300044684 | Ga0466966_0001052 | Ga0466966_0001052_16119_17414 | 423 |
| 262 | 3300044684 | Ga0466966_0010696 | Ga0466966_0010696_1617_2912 | 423 |
| 263 | 3300044693 | Ga0466961_0007719 | Ga0466961_0007719_3253_4548 | 423 |
| 264 | 3300044693 | Ga0466961_0008980 | Ga0466961_0008980_2289_3584 | 423 |
| 265 | 3300044706 | Ga0466964_0007498 | Ga0466964_0007498_1632_2927 | 423 |
| 266 | 3300044842 | Ga0466957_0002727 | Ga0466957_0002727_5374_6669 | 423 |
| 267 | 3300045049 | Ga0466959_0013774 | Ga0466959_0013774_4425_5720 | 423 |
| 268 | 3300045836 | Ga0466958_0009929 | Ga0466958_0009929_134_1429 | 423 |
| 269 | 3300046455 | Ga0495603_0000432 | Ga0495603_0000432_13174_14469 | 423 |
| 270 | 3300046455 | Ga0495603_0023243 | Ga0495603_0023243_204_1499 | 423 |
| 271 | 3300046459 | Ga0495629_0000347 | Ga0495629_0000347_8762_10057 | 423 |
| 272 | 3300046462 | Ga0495651_0129351 | Ga0495651_0129351_375_1670 | 423 |
| 273 | 3300046471 | Ga0495650_0001557 | Ga0495650_0001557_8782_10077 | 423 |
| 274 | 3300046472 | Ga0495580_0002469 | Ga0495580_0002469_1734_3029 | 423 |
| 275 | 3300046472 | Ga0495580_0027162 | Ga0495580_0027162_1607_2902 | 423 |
| 276 | 3300046473 | Ga0495582_0003427 | Ga0495582_0003427_6661_7956 | 423 |
| 277 | 3300046475 | Ga0495639_0098240 | Ga0495639_0098240_14_1309 | 423 |
| 278 | 3300046500 | Ga0495596_0040977 | Ga0495596_0040977_244_1539 | 423 |
| 279 | 3300046507 | Ga0495606_0011252 | Ga0495606_0011252_4463_5758 | 423 |
| 280 | 3300046524 | Ga0495648_0065198 | Ga0495648_0065198_389_1684 | 423 |
| 281 | 3300046528 | Ga0495642_0000414 | Ga0495642_0000414_21172_22467 | 423 |
| 282 | 3300046528 | Ga0495642_0058902 | Ga0495642_0058902_194_1489 | 423 |
| 283 | 3300046529 | Ga0495652_0163685 | Ga0495652_0163685_113_1408 | 423 |
| 284 | 3300046543 | Ga0495645_0000199 | Ga0495645_0000199_32747_34042 | 423 |
| 285 | 3300046663 | Ga0495635_0111480 | Ga0495635_0111480_138_1433 | 423 |
| 286 | 3300046674 | Ga0495588_0046604 | Ga0495588_0046604_688_1983 | 423 |
| 287 | 3300046689 | Ga0495613_0052563 | Ga0495613_0052563_365_1660 | 423 |
| 288 | 3300046694 | Ga0495649_0011631 | Ga0495649_0011631_2566_3861 | 423 |
| 289 | 3300047323 | Ga0495683_0001001 | Ga0495683_0001001_11110_12405 | 423 |
| 290 | 3300047443 | Ga0495687_000005 | Ga0495687_000005_361752_363047 | 423 |
| 291 | 3300047443 | Ga0495687_003872 | Ga0495687_003872_2502_3797 | 423 |
| 292 | 3300048091 | Ga0495626_0009632 | Ga0495626_0009632_3862_5157 | 423 |
| 293 | 3300048904 | Ga0496101_0103806 | Ga0496101_0103806_616_1911 | 423 |
| 294 | 3300048907 | Ga0496104_0059412 | Ga0496104_0059412_141_1436 | 423 |
| 295 | 3300048907 | Ga0496104_0079598 | Ga0496104_0079598_74_1369 | 423 |
| 296 | 3300048908 | Ga0496105_0044120 | Ga0496105_0044120_1848_3143 | 423 |
| 297 | 3300048908 | Ga0496105_0227523 | Ga0496105_0227523_93_1388 | 423 |
| 298 | 3300048917 | Ga0496114_0000299 | Ga0496114_0000299_6358_7653 | 423 |
| 299 | 3300048918 | Ga0496115_0087343 | Ga0496115_0087343_260_1555 | 423 |
| 300 | 3300048919 | Ga0496116_0024193 | Ga0496116_0024193_2629_3924 | 423 |
| 301 | 3300048920 | Ga0496117_0016201 | Ga0496117_0016201_805_2100 | 423 |
| 302 | 3300048921 | Ga0496118_0001274 | Ga0496118_0001274_30978_32273 | 423 |
| 303 | 3300049574 | Ga0501038_0011745 | Ga0501038_0011745_5516_6826 | 423 |
| 304 | 3300049579 | Ga0501043_0006291 | Ga0501043_0006291_7269_8579 | 423 |
| 305 | 3300049581 | Ga0501047_0077543 | Ga0501047_0077543_669_1979 | 423 |
| 306 | 3300049589 | Ga0501073_0001040 | Ga0501073_0001040_3006_4316 | 423 |
| 307 | 3300049742 | Ga0501080_0009567 | Ga0501080_0009567_5240_6550 | 423 |
| 308 | 3300049744 | Ga0501083_0101466 | Ga0501083_0101466_64_1374 | 423 |
| 309 | 3300049822 | Ga0501035_0128535 | Ga0501035_0128535_671_1981 | 423 |
| 310 | 3300049823 | Ga0501044_0076547 | Ga0501044_0076547_1274_2584 | 423 |
| 311 | 3300060353 | Ga0501082_0108693 | Ga0501082_0108693_332_1642 | 423 |
| 312 | iso_pu_bacteria | 2738541281 | 2738745255 | 423 |
| 313 | iso_pu_bacteria | 2738543032 | 2739354485 | 423 |
| 314 | iso_pu_bacteria | 2837678835 | 2837682581 | 423 |
| 315 | iso_pu_bacteria | 2889306138 | 2889310006 | 423 |
| 316 | iso_pu_bacteria | 2902330777 | 2902333925 | 423 |
| 317 | iso_pu_bacteria | 3003665799 | 3003669170 | 423 |
| 318 | 3300001979 | JGI24740J21852_10000031 | JGI24740J21852_1000003121 | 424 |
| 319 | 3300001979 | JGI24740J21852_10000333 | JGI24740J21852_100003332 | 424 |
| 320 | 3300001979 | JGI24740J21852_10011891 | JGI24740J21852_100118914 | 424 |
| 321 | 3300001989 | JGI24739J22299_10001631 | JGI24739J22299_100016313 | 424 |
| 322 | 3300001989 | JGI24739J22299_10002527 | JGI24739J22299_1000252711 | 424 |
| 323 | 3300001990 | JGI24737J22298_10009927 | JGI24737J22298_100099272 | 424 |
| 324 | 3300002067 | JGI24735J21928_10020765 | JGI24735J21928_100207652 | 424 |
| 325 | 3300002705 | JGI25156J39149_1000366 | JGI25156J39149_10003666 | 424 |
| 326 | 3300002705 | JGI25156J39149_1000389 | JGI25156J39149_100038923 | 424 |
| 327 | 3300002705 | JGI25156J39149_1000562 | JGI25156J39149_10005624 | 424 |
| 328 | 3300002705 | JGI25156J39149_1003583 | JGI25156J39149_10035834 | 424 |
| 329 | 3300002705 | JGI25156J39149_1004983 | JGI25156J39149_10049834 | 424 |
| 330 | 3300002738 | JGI25154J39366_1000271 | JGI25154J39366_100027121 | 424 |
| 331 | 3300003187 | JGI25151J46595_10005206 | JGI25151J46595_100052063 | 424 |
| 332 | 3300003214 | JGI25165J46597_1000717 | JGI25165J46597_100071719 | 424 |
| 333 | 3300003751 | Ga0055538_1000219 | Ga0055538_100021915 | 424 |
| 334 | 3300003752 | Ga0055539_1000233 | Ga0055539_100023316 | 424 |
| 335 | 3300003756 | Ga0055533_1000064 | Ga0055533_100006434 | 424 |
| 336 | 3300003756 | Ga0055533_1000247 | Ga0055533_100024715 | 424 |
| 337 | 3300003756 | Ga0055533_1001095 | Ga0055533_10010954 | 424 |
| 338 | 3300003758 | Ga0055532_1000013 | Ga0055532_1000013336 | 424 |
| 339 | 3300003758 | Ga0055532_1000245 | Ga0055532_100024514 | 424 |
| 340 | 3300003759 | Ga0055525_1000318 | Ga0055525_100031816 | 424 |
| 341 | 3300003760 | Ga0055527_1000010 | Ga0055527_100001035 | 424 |
| 342 | 3300003760 | Ga0055527_1000260 | Ga0055527_100026014 | 424 |
| 343 | 3300003760 | Ga0055527_1000468 | Ga0055527_10004682 | 424 |
| 344 | 3300003760 | Ga0055527_1000470 | Ga0055527_10004702 | 424 |
| 345 | 3300003761 | Ga0055535_1000010 | Ga0055535_1000010336 | 424 |
| 346 | 3300003761 | Ga0055535_1000431 | Ga0055535_100043114 | 424 |
| 347 | 3300003761 | Ga0055535_1001162 | Ga0055535_10011622 | 424 |
| 348 | 3300003761 | Ga0055535_1001166 | Ga0055535_10011662 | 424 |
| 349 | 3300003762 | Ga0055542_1000016 | Ga0055542_1000016336 | 424 |
| 350 | 3300003762 | Ga0055542_1000990 | Ga0055542_100099012 | 424 |
| 351 | 3300003762 | Ga0055542_1001151 | Ga0055542_10011512 | 424 |
| 352 | 3300003762 | Ga0055542_1003283 | Ga0055542_10032832 | 424 |
| 353 | 3300003763 | Ga0055529_1000012 | Ga0055529_1000012336 | 424 |
| 354 | 3300003763 | Ga0055529_1000517 | Ga0055529_100051714 | 424 |
| 355 | 3300003763 | Ga0055529_1000670 | Ga0055529_10006702 | 424 |
| 356 | 3300003763 | Ga0055529_1000746 | Ga0055529_100074617 | 424 |
| 357 | 3300003790 | Ga0055528_1002297 | Ga0055528_10022976 | 424 |
| 358 | 3300003841 | Ga0055541_1000113 | Ga0055541_100011328 | 424 |
| 359 | 3300003841 | Ga0055541_1000160 | Ga0055541_100016015 | 424 |
| 360 | 3300005262 | Ga0065165_1000810 | Ga0065165_10008109 | 424 |
| 361 | 3300005327 | Ga0070658_10003407 | Ga0070658_100034075 | 424 |
| 362 | 3300005327 | Ga0070658_10017930 | Ga0070658_100179302 | 424 |
| 363 | 3300005327 | Ga0070658_10056707 | Ga0070658_100567072 | 424 |
| 364 | 3300005339 | Ga0070660_100000006 | Ga0070660_10000000684 | 424 |
| 365 | 3300005339 | Ga0070660_100000507 | Ga0070660_10000050711 | 424 |
| 366 | 3300005344 | Ga0070661_100000348 | Ga0070661_10000034814 | 424 |
| 367 | 3300005366 | Ga0070659_100000082 | Ga0070659_1000000824 | 424 |
| 368 | 3300005366 | Ga0070659_100002151 | Ga0070659_1000021514 | 424 |
| 369 | 3300005366 | Ga0070659_100040921 | Ga0070659_1000409212 | 424 |
| 370 | 3300005455 | Ga0070663_100000069 | Ga0070663_1000000696 | 424 |
| 371 | 3300005455 | Ga0070663_100000075 | Ga0070663_10000007518 | 424 |
| 372 | 3300005455 | Ga0070663_100062773 | Ga0070663_1000627731 | 424 |
| 373 | 3300005563 | Ga0068855_100040376 | Ga0068855_1000403763 | 424 |
| 374 | 3300005564 | Ga0070664_100000191 | Ga0070664_10000019115 | 424 |
| 375 | 3300005577 | Ga0068857_100009953 | Ga0068857_1000099533 | 424 |
| 376 | 3300005614 | Ga0068856_100000504 | Ga0068856_10000050419 | 424 |
| 377 | 3300005614 | Ga0068856_100062220 | Ga0068856_1000622202 | 424 |
| 378 | 3300005614 | Ga0068856_100076217 | Ga0068856_1000762172 | 424 |
| 379 | 3300005616 | Ga0068852_100015182 | Ga0068852_1000151823 | 424 |
| 380 | 3300009011 | Ga0105251_10000127 | Ga0105251_1000012717 | 424 |
| 381 | 3300009092 | Ga0105250_10015150 | Ga0105250_100151503 | 424 |
| 382 | 3300009093 | Ga0105240_10004374 | Ga0105240_100043743 | 424 |
| 383 | 3300009093 | Ga0105240_10066046 | Ga0105240_100660464 | 424 |
| 384 | 3300009093 | Ga0105240_10142600 | Ga0105240_101426002 | 424 |
| 385 | 3300009093 | Ga0105240_10154226 | Ga0105240_101542263 | 424 |
| 386 | 3300009093 | Ga0105240_10256948 | Ga0105240_102569482 | 424 |
| 387 | 3300009093 | Ga0105240_10362086 | Ga0105240_103620862 | 424 |
| 388 | 3300009545 | Ga0105237_10175134 | Ga0105237_101751341 | 424 |
| 389 | 3300010375 | Ga0105239_10002079 | Ga0105239_1000207911 | 424 |
| 390 | 3300010375 | Ga0105239_10003831 | Ga0105239_1000383114 | 424 |
| 391 | 3300013100 | Ga0157373_10000358 | Ga0157373_1000035814 | 424 |
| 392 | 3300013100 | Ga0157373_10002832 | Ga0157373_100028329 | 424 |
| 393 | 3300013102 | Ga0157371_10000608 | Ga0157371_1000060818 | 424 |
| 394 | 3300013102 | Ga0157371_10008084 | Ga0157371_100080845 | 424 |
| 395 | 3300013104 | Ga0157370_10000690 | Ga0157370_1000069017 | 424 |
| 396 | 3300013104 | Ga0157370_10000852 | Ga0157370_1000085211 | 424 |
| 397 | 3300013104 | Ga0157370_10001717 | Ga0157370_1000171710 | 424 |
| 398 | 3300013105 | Ga0157369_10000120 | Ga0157369_1000012025 | 424 |
| 399 | 3300013105 | Ga0157369_10000743 | Ga0157369_1000074321 | 424 |
| 400 | 3300013105 | Ga0157369_10003555 | Ga0157369_1000355510 | 424 |
| 401 | 3300013105 | Ga0157369_10130895 | Ga0157369_101308951 | 424 |
| 402 | 3300013296 | Ga0157374_10000976 | Ga0157374_1000097614 | 424 |
| 403 | 3300013307 | Ga0157372_10000519 | Ga0157372_1000051920 | 424 |
| 404 | 3300013307 | Ga0157372_10003761 | Ga0157372_1000376110 | 424 |
| 405 | 3300013308 | Ga0157375_10010236 | Ga0157375_100102366 | 424 |
| 406 | 3300015261 | Ga0182006_1001401 | Ga0182006_10014014 | 424 |
| 407 | 3300015262 | Ga0182007_10000795 | Ga0182007_1000079513 | 424 |
| 408 | 3300015262 | Ga0182007_10030545 | Ga0182007_100305451 | 424 |
| 409 | 3300016635 | Ga0183361_10061 | Ga0183361_100612 | 424 |
| 410 | 3300022467 | Ga0224712_10000332 | Ga0224712_100003324 | 424 |
| 411 | 3300025206 | Ga0209435_104222 | Ga0209435_1042222 | 424 |
| 412 | 3300025224 | Ga0209784_100215 | Ga0209784_10021515 | 424 |
| 413 | 3300025224 | Ga0209784_100567 | Ga0209784_1005673 | 424 |
| 414 | 3300025225 | Ga0209566_100018 | Ga0209566_100018376 | 424 |
| 415 | 3300025225 | Ga0209566_100161 | Ga0209566_10016130 | 424 |
| 416 | 3300025225 | Ga0209566_100215 | Ga0209566_10021527 | 424 |
| 417 | 3300025226 | Ga0209674_100011 | Ga0209674_10001132 | 424 |
| 418 | 3300025226 | Ga0209674_100048 | Ga0209674_100048286 | 424 |
| 419 | 3300025226 | Ga0209674_100183 | Ga0209674_10018343 | 424 |
| 420 | 3300025226 | Ga0209674_100271 | Ga0209674_10027115 | 424 |
| 421 | 3300025226 | Ga0209674_102503 | Ga0209674_1025032 | 424 |
| 422 | 3300025228 | Ga0209672_100002 | Ga0209672_10000232 | 424 |
| 423 | 3300025228 | Ga0209672_100020 | Ga0209672_100020163 | 424 |
| 424 | 3300025228 | Ga0209672_100066 | Ga0209672_100066103 | 424 |
| 425 | 3300025228 | Ga0209672_100234 | Ga0209672_10023418 | 424 |
| 426 | 3300025228 | Ga0209672_100439 | Ga0209672_10043917 | 424 |
| 427 | 3300025229 | Ga0209147_100003 | Ga0209147_10000332 | 424 |
| 428 | 3300025229 | Ga0209147_100024 | Ga0209147_100024163 | 424 |
| 429 | 3300025229 | Ga0209147_100084 | Ga0209147_10008464 | 424 |
| 430 | 3300025229 | Ga0209147_100295 | Ga0209147_10029515 | 424 |
| 431 | 3300025230 | Ga0209563_100181 | Ga0209563_10018115 | 424 |
| 432 | 3300025230 | Ga0209563_101061 | Ga0209563_1010612 | 424 |
| 433 | 3300025242 | Ga0209258_100042 | Ga0209258_100042328 | 424 |
| 434 | 3300025242 | Ga0209258_100084 | Ga0209258_100084163 | 424 |
| 435 | 3300025242 | Ga0209258_100117 | Ga0209258_10011764 | 424 |
| 436 | 3300025242 | Ga0209258_100477 | Ga0209258_10047715 | 424 |
| 437 | 3300025246 | Ga0209646_1000046 | Ga0209646_1000046253 | 424 |
| 438 | 3300025250 | Ga0209026_1003728 | Ga0209026_10037283 | 424 |
| 439 | 3300025253 | Ga0209677_100230 | Ga0209677_10023015 | 424 |
| 440 | 3300025253 | Ga0209677_102128 | Ga0209677_1021285 | 424 |
| 441 | 3300025254 | Ga0209148_1000006 | Ga0209148_100000632 | 424 |
| 442 | 3300025254 | Ga0209148_1000148 | Ga0209148_100014872 | 424 |
| 443 | 3300025254 | Ga0209148_1000187 | Ga0209148_100018761 | 424 |
| 444 | 3300025254 | Ga0209148_1000785 | Ga0209148_10007853 | 424 |
| 445 | 3300025254 | Ga0209148_1003392 | Ga0209148_10033921 | 424 |
| 446 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002891 | 424 |
| 447 | 3300025256 | Ga0209759_1000032 | Ga0209759_100003228 | 424 |
| 448 | 3300025256 | Ga0209759_1000210 | Ga0209759_100021032 | 424 |
| 449 | 3300025256 | Ga0209759_1000587 | Ga0209759_100058713 | 424 |
| 450 | 3300025256 | Ga0209759_1003547 | Ga0209759_10035474 | 424 |
| 451 | 3300025256 | Ga0209759_1006120 | Ga0209759_10061202 | 424 |
| 452 | 3300025256 | Ga0209759_1011323 | Ga0209759_10113232 | 424 |
| 453 | 3300025256 | Ga0209759_1020077 | Ga0209759_10200772 | 424 |
| 454 | 3300025261 | Ga0209233_1000033 | Ga0209233_1000033517 | 424 |
| 455 | 3300025263 | Ga0209565_1009103 | Ga0209565_10091032 | 424 |
| 456 | 3300025272 | Ga0209455_1000003 | Ga0209455_100000332 | 424 |
| 457 | 3300025272 | Ga0209455_1000110 | Ga0209455_100011064 | 424 |
| 458 | 3300025272 | Ga0209455_1000362 | Ga0209455_100036215 | 424 |
| 459 | 3300025272 | Ga0209455_1001376 | Ga0209455_10013762 | 424 |
| 460 | 3300025273 | Ga0209673_1000057 | Ga0209673_100005732 | 424 |
| 461 | 3300025284 | Ga0209130_1004039 | Ga0209130_10040392 | 424 |
| 462 | 3300025294 | Ga0209025_1000123 | Ga0209025_1000123141 | 424 |
| 463 | 3300025295 | Ga0209564_1004896 | Ga0209564_10048966 | 424 |
| 464 | 3300025302 | Ga0207426_1000152 | Ga0207426_1000152131 | 424 |
| 465 | 3300025735 | Ga0207713_1000302 | Ga0207713_100030216 | 424 |
| 466 | 3300025904 | Ga0207647_10001027 | Ga0207647_1000102716 | 424 |
| 467 | 3300025904 | Ga0207647_10035914 | Ga0207647_100359143 | 424 |
| 468 | 3300025909 | Ga0207705_10003789 | Ga0207705_100037895 | 424 |
| 469 | 3300025913 | Ga0207695_10001113 | Ga0207695_100011134 | 424 |
| 470 | 3300025913 | Ga0207695_10006823 | Ga0207695_1000682310 | 424 |
| 471 | 3300025913 | Ga0207695_10036944 | Ga0207695_100369443 | 424 |
| 472 | 3300025913 | Ga0207695_10048057 | Ga0207695_100480574 | 424 |
| 473 | 3300025913 | Ga0207695_10102080 | Ga0207695_101020802 | 424 |
| 474 | 3300025919 | Ga0207657_10000003 | Ga0207657_10000003168 | 424 |
| 475 | 3300025919 | Ga0207657_10000885 | Ga0207657_1000088520 | 424 |
| 476 | 3300025919 | Ga0207657_10206949 | Ga0207657_102069491 | 424 |
| 477 | 3300025920 | Ga0207649_10000326 | Ga0207649_1000032615 | 424 |
| 478 | 3300025924 | Ga0207694_10019179 | Ga0207694_100191793 | 424 |
| 479 | 3300025929 | Ga0207664_10001839 | Ga0207664_100018395 | 424 |
| 480 | 3300025932 | Ga0207690_10000007 | Ga0207690_10000007169 | 424 |
| 481 | 3300025932 | Ga0207690_10000380 | Ga0207690_1000038014 | 424 |
| 482 | 3300025932 | Ga0207690_10076393 | Ga0207690_100763932 | 424 |
| 483 | 3300025941 | Ga0207711_10030210 | Ga0207711_100302104 | 424 |
| 484 | 3300025945 | Ga0207679_10000002 | Ga0207679_1000000217 | 424 |
| 485 | 3300025949 | Ga0207667_10006579 | Ga0207667_100065798 | 424 |
| 486 | 3300025949 | Ga0207667_10006899 | Ga0207667_100068994 | 424 |
| 487 | 3300025949 | Ga0207667_10030915 | Ga0207667_100309152 | 424 |
| 488 | 3300025972 | Ga0207668_10118111 | Ga0207668_101181112 | 424 |
| 489 | 3300026067 | Ga0207678_10000319 | Ga0207678_1000031917 | 424 |
| 490 | 3300026067 | Ga0207678_10001465 | Ga0207678_100014652 | 424 |
| 491 | 3300026067 | Ga0207678_10008540 | Ga0207678_100085404 | 424 |
| 492 | 3300026078 | Ga0207702_10000504 | Ga0207702_1000050417 | 424 |
| 493 | 3300026078 | Ga0207702_10049899 | Ga0207702_100498994 | 424 |
| 494 | 3300026116 | Ga0207674_10004306 | Ga0207674_1000430612 | 424 |
| 495 | 3300026142 | Ga0207698_10019094 | Ga0207698_100190942 | 424 |
| 496 | 3300027312 | Ga0209371_1000076 | Ga0209371_100007610 | 424 |
| 497 | 3300030500 | Ga0268256_1000087 | Ga0268256_1000087127 | 424 |
| 498 | 3300030500 | Ga0268256_1005103 | Ga0268256_10051032 | 424 |
| 499 | 3300031548 | Ga0307408_100004532 | Ga0307408_1000045322 | 424 |
| 500 | 3300031911 | Ga0307412_10000095 | Ga0307412_1000009525 | 424 |
| 501 | 3300037312 | Ga0395899_0000241 | Ga0395899_0000241_35885_37159 | 424 |
| 502 | 3300037312 | Ga0395899_0009358 | Ga0395899_0009358_308_1717 | 424 |
| 503 | 3300037312 | Ga0395899_0082115 | Ga0395899_0082115_443_1717 | 424 |
| 504 | 3300037418 | Ga0395900_0000633 | Ga0395900_0000633_10413_11687 | 424 |
| 505 | 3300037418 | Ga0395900_0001069 | Ga0395900_0001069_16998_18329 | 424 |
| 506 | 3300037418 | Ga0395900_0170678 | Ga0395900_0170678_764_2038 | 424 |
| 507 | 3300037418 | Ga0395900_0216467 | Ga0395900_0216467_412_1686 | 424 |
| 508 | 3300037466 | Ga0395898_0000016 | Ga0395898_0000016_398647_399921 | 424 |
| 509 | 3300037466 | Ga0395898_0001705 | Ga0395898_0001705_4379_5653 | 424 |
| 510 | 3300037466 | Ga0395898_0063824 | Ga0395898_0063824_756_2030 | 424 |
| 511 | 3300037466 | Ga0395898_0113022 | Ga0395898_0113022_743_2017 | 424 |
| 512 | 3300037471 | Ga0395905_0000048 | Ga0395905_0000048_179301_180575 | 424 |
| 513 | 3300037471 | Ga0395905_0077844 | Ga0395905_0077844_1242_2516 | 424 |
| 514 | 3300038443 | Ga0395901_0000081 | Ga0395901_0000081_105679_106953 | 424 |
| 515 | 3300038443 | Ga0395901_0000157 | Ga0395901_0000157_64360_65634 | 424 |
| 516 | 3300038443 | Ga0395901_0075354 | Ga0395901_0075354_743_2017 | 424 |
| 517 | 3300042005 | Ga0439448_0000277 | Ga0439448_0000277_2346_3620 | 424 |
| 518 | 3300044656 | Ga0466969_0000088 | Ga0466969_0000088_22382_23656 | 424 |
| 519 | 3300044656 | Ga0466969_0018108 | Ga0466969_0018108_487_1761 | 424 |
| 520 | 3300044656 | Ga0466969_0022794 | Ga0466969_0022794_1463_2749 | 424 |
| 521 | 3300044683 | Ga0466965_0002491 | Ga0466965_0002491_1408_2682 | 424 |
| 522 | 3300044683 | Ga0466965_0008150 | Ga0466965_0008150_2221_3495 | 424 |
| 523 | 3300044684 | Ga0466966_0000009 | Ga0466966_0000009_38648_39922 | 424 |
| 524 | 3300044684 | Ga0466966_0002581 | Ga0466966_0002581_225_1499 | 424 |
| 525 | 3300044684 | Ga0466966_0002666 | Ga0466966_0002666_8748_10022 | 424 |
| 526 | 3300044693 | Ga0466961_0000665 | Ga0466961_0000665_19929_21203 | 424 |
| 527 | 3300044693 | Ga0466961_0004003 | Ga0466961_0004003_4527_5801 | 424 |
| 528 | 3300044693 | Ga0466961_0005937 | Ga0466961_0005937_3223_4497 | 424 |
| 529 | 3300044693 | Ga0466961_0028566 | Ga0466961_0028566_1602_2888 | 424 |
| 530 | 3300044694 | Ga0466963_0002186 | Ga0466963_0002186_3734_5008 | 424 |
| 531 | 3300044694 | Ga0466963_0011644 | Ga0466963_0011644_726_2000 | 424 |
| 532 | 3300044694 | Ga0466963_0106362 | Ga0466963_0106362_494_1768 | 424 |
| 533 | 3300044706 | Ga0466964_0032652 | Ga0466964_0032652_521_1795 | 424 |
| 534 | 3300044719 | Ga0466971_0000802 | Ga0466971_0000802_1073_2347 | 424 |
| 535 | 3300044719 | Ga0466971_0000889 | Ga0466971_0000889_7530_8804 | 424 |
| 536 | 3300044719 | Ga0466971_0058805 | Ga0466971_0058805_115_1389 | 424 |
| 537 | 3300044765 | Ga0466970_0018084 | Ga0466970_0018084_1393_2667 | 424 |
| 538 | 3300044765 | Ga0466970_0030551 | Ga0466970_0030551_371_1657 | 424 |
| 539 | 3300044842 | Ga0466957_0002453 | Ga0466957_0002453_5176_6450 | 424 |
| 540 | 3300045049 | Ga0466959_0001627 | Ga0466959_0001627_5190_6464 | 424 |
| 541 | 3300045049 | Ga0466959_0047382 | Ga0466959_0047382_1401_2687 | 424 |
| 542 | 3300045049 | Ga0466959_0090733 | Ga0466959_0090733_453_1727 | 424 |
| 543 | 3300045836 | Ga0466958_0033906 | Ga0466958_0033906_486_1760 | 424 |
| 544 | 3300045836 | Ga0466958_0035276 | Ga0466958_0035276_470_1744 | 424 |
| 545 | 3300046454 | Ga0495592_0041197 | Ga0495592_0041197_1758_3032 | 424 |
| 546 | 3300046455 | Ga0495603_0004703 | Ga0495603_0004703_5751_7025 | 424 |
| 547 | 3300046455 | Ga0495603_0044916 | Ga0495603_0044916_79_1353 | 424 |
| 548 | 3300046455 | Ga0495603_0083251 | Ga0495603_0083251_220_1563 | 424 |
| 549 | 3300046457 | Ga0495590_0006265 | Ga0495590_0006265_1658_2932 | 424 |
| 550 | 3300046458 | Ga0495591_016152 | Ga0495591_016152_837_2180 | 424 |
| 551 | 3300046459 | Ga0495629_0000137 | Ga0495629_0000137_3250_4524 | 424 |
| 552 | 3300046459 | Ga0495629_0000758 | Ga0495629_0000758_3840_5114 | 424 |
| 553 | 3300046459 | Ga0495629_0004710 | Ga0495629_0004710_4256_5530 | 424 |
| 554 | 3300046459 | Ga0495629_0010287 | Ga0495629_0010287_4208_5551 | 424 |
| 555 | 3300046460 | Ga0495638_0153937 | Ga0495638_0153937_24_1310 | 424 |
| 556 | 3300046461 | Ga0495641_0052581 | Ga0495641_0052581_178_1452 | 424 |
| 557 | 3300046462 | Ga0495651_0021068 | Ga0495651_0021068_3537_4880 | 424 |
| 558 | 3300046462 | Ga0495651_0077536 | Ga0495651_0077536_841_2115 | 424 |
| 559 | 3300046463 | Ga0495653_0031831 | Ga0495653_0031831_388_1662 | 424 |
| 560 | 3300046463 | Ga0495653_0102067 | Ga0495653_0102067_51_1325 | 424 |
| 561 | 3300046463 | Ga0495653_0105652 | Ga0495653_0105652_319_1662 | 424 |
| 562 | 3300046471 | Ga0495650_0023006 | Ga0495650_0023006_338_1639 | 424 |
| 563 | 3300046471 | Ga0495650_0043016 | Ga0495650_0043016_443_1717 | 424 |
| 564 | 3300046472 | Ga0495580_0005277 | Ga0495580_0005277_7767_9068 | 424 |
| 565 | 3300046472 | Ga0495580_0010665 | Ga0495580_0010665_1764_3038 | 424 |
| 566 | 3300046472 | Ga0495580_0011546 | Ga0495580_0011546_4903_6177 | 424 |
| 567 | 3300046472 | Ga0495580_0016508 | Ga0495580_0016508_1360_2634 | 424 |
| 568 | 3300046472 | Ga0495580_0110289 | Ga0495580_0110289_171_1445 | 424 |
| 569 | 3300046473 | Ga0495582_0016330 | Ga0495582_0016330_577_1851 | 424 |
| 570 | 3300046473 | Ga0495582_0037686 | Ga0495582_0037686_1254_2597 | 424 |
| 571 | 3300046473 | Ga0495582_0074436 | Ga0495582_0074436_285_1559 | 424 |
| 572 | 3300046474 | Ga0495605_0001460 | Ga0495605_0001460_2096_3370 | 424 |
| 573 | 3300046474 | Ga0495605_0014706 | Ga0495605_0014706_1736_3010 | 424 |
| 574 | 3300046476 | Ga0495662_0088412 | Ga0495662_0088412_225_1499 | 424 |
| 575 | 3300046500 | Ga0495596_0011323 | Ga0495596_0011323_2283_3557 | 424 |
| 576 | 3300046501 | Ga0495607_0112677 | Ga0495607_0112677_92_1366 | 424 |
| 577 | 3300046506 | Ga0495583_0010285 | Ga0495583_0010285_2381_3655 | 424 |
| 578 | 3300046506 | Ga0495583_0025118 | Ga0495583_0025118_232_1506 | 424 |
| 579 | 3300046507 | Ga0495606_0027111 | Ga0495606_0027111_655_1929 | 424 |
| 580 | 3300046507 | Ga0495606_0041979 | Ga0495606_0041979_458_1732 | 424 |
| 581 | 3300046507 | Ga0495606_0048529 | Ga0495606_0048529_506_1780 | 424 |
| 582 | 3300046511 | Ga0495608_0025099 | Ga0495608_0025099_1493_2767 | 424 |
| 583 | 3300046512 | Ga0495610_0000745 | Ga0495610_0000745_15507_16781 | 424 |
| 584 | 3300046513 | Ga0495616_0032089 | Ga0495616_0032089_428_1753 | 424 |
| 585 | 3300046514 | Ga0495618_0012697 | Ga0495618_0012697_2061_3404 | 424 |
| 586 | 3300046514 | Ga0495618_0106703 | Ga0495618_0106703_191_1465 | 424 |
| 587 | 3300046515 | Ga0495620_0009291 | Ga0495620_0009291_2412_3686 | 424 |
| 588 | 3300046516 | Ga0495628_0006690 | Ga0495628_0006690_6292_7581 | 424 |
| 589 | 3300046516 | Ga0495628_0012413 | Ga0495628_0012413_229_1503 | 424 |
| 590 | 3300046516 | Ga0495628_0159712 | Ga0495628_0159712_39_1313 | 424 |
| 591 | 3300046517 | Ga0495630_0031819 | Ga0495630_0031819_268_1542 | 424 |
| 592 | 3300046517 | Ga0495630_0033475 | Ga0495630_0033475_2034_3359 | 424 |
| 593 | 3300046526 | Ga0495666_0006163 | Ga0495666_0006163_295_1569 | 424 |
| 594 | 3300046526 | Ga0495666_0007979 | Ga0495666_0007979_517_1791 | 424 |
| 595 | 3300046526 | Ga0495666_0015305 | Ga0495666_0015305_64_1407 | 424 |
| 596 | 3300046528 | Ga0495642_0004007 | Ga0495642_0004007_876_2150 | 424 |
| 597 | 3300046529 | Ga0495652_0113038 | Ga0495652_0113038_430_1704 | 424 |
| 598 | 3300046531 | Ga0495665_0004525 | Ga0495665_0004525_55_1398 | 424 |
| 599 | 3300046531 | Ga0495665_0012093 | Ga0495665_0012093_2975_4249 | 424 |
| 600 | 3300046531 | Ga0495665_0031143 | Ga0495665_0031143_151_1455 | 424 |
| 601 | 3300046531 | Ga0495665_0033039 | Ga0495665_0033039_1301_2575 | 424 |
| 602 | 3300046533 | Ga0495640_0009812 | Ga0495640_0009812_2714_3988 | 424 |
| 603 | 3300046533 | Ga0495640_0033955 | Ga0495640_0033955_1026_2369 | 424 |
| 604 | 3300046535 | Ga0495586_0086126 | Ga0495586_0086126_126_1400 | 424 |
| 605 | 3300046543 | Ga0495645_0004719 | Ga0495645_0004719_7192_8466 | 424 |
| 606 | 3300046557 | Ga0495622_0000287 | Ga0495622_0000287_26302_27576 | 424 |
| 607 | 3300046559 | Ga0495667_0097216 | Ga0495667_0097216_415_1689 | 424 |
| 608 | 3300046642 | Ga0495634_0030733 | Ga0495634_0030733_1143_2486 | 424 |
| 609 | 3300046663 | Ga0495635_0019299 | Ga0495635_0019299_3186_4460 | 424 |
| 610 | 3300046665 | Ga0495661_0013584 | Ga0495661_0013584_4060_5403 | 424 |
| 611 | 3300046678 | Ga0495599_0007611 | Ga0495599_0007611_4012_5286 | 424 |
| 612 | 3300046678 | Ga0495599_0059721 | Ga0495599_0059721_469_1812 | 424 |
| 613 | 3300046680 | Ga0495646_0005768 | Ga0495646_0005768_751_2025 | 424 |
| 614 | 3300046684 | Ga0495669_0009043 | Ga0495669_0009043_2346_3620 | 424 |
| 615 | 3300046690 | Ga0495624_0007690 | Ga0495624_0007690_6074_7348 | 424 |
| 616 | 3300046690 | Ga0495624_0009295 | Ga0495624_0009295_4879_6153 | 424 |
| 617 | 3300046690 | Ga0495624_0040062 | Ga0495624_0040062_295_1569 | 424 |
| 618 | 3300046692 | Ga0495671_0025478 | Ga0495671_0025478_1267_2541 | 424 |
| 619 | 3300046694 | Ga0495649_0004871 | Ga0495649_0004871_2400_3674 | 424 |
| 620 | 3300046794 | Ga0495589_0020527 | Ga0495589_0020527_351_1625 | 424 |
| 621 | 3300046794 | Ga0495589_0034978 | Ga0495589_0034978_1147_2421 | 424 |
| 622 | 3300046794 | Ga0495589_0084239 | Ga0495589_0084239_87_1361 | 424 |
| 623 | 3300046809 | Ga0495600_0041504 | Ga0495600_0041504_189_1463 | 424 |
| 624 | 3300047317 | Ga0495604_0026260 | Ga0495604_0026260_1947_3290 | 424 |
| 625 | 3300047317 | Ga0495604_0165128 | Ga0495604_0165128_237_1511 | 424 |
| 626 | 3300047319 | Ga0495674_0010307 | Ga0495674_0010307_1331_2656 | 424 |
| 627 | 3300047319 | Ga0495674_0013082 | Ga0495674_0013082_3606_4895 | 424 |
| 628 | 3300047319 | Ga0495674_0068948 | Ga0495674_0068948_1328_2602 | 424 |
| 629 | 3300047319 | Ga0495674_0075082 | Ga0495674_0075082_1585_2859 | 424 |
| 630 | 3300047320 | Ga0495672_0001027 | Ga0495672_0001027_328_1617 | 424 |
| 631 | 3300047320 | Ga0495672_0001926 | Ga0495672_0001926_1505_2806 | 424 |
| 632 | 3300047320 | Ga0495672_0039454 | Ga0495672_0039454_1504_2778 | 424 |
| 633 | 3300047321 | Ga0495676_0054518 | Ga0495676_0054518_493_1836 | 424 |
| 634 | 3300047321 | Ga0495676_0083231 | Ga0495676_0083231_123_1397 | 424 |
| 635 | 3300047322 | Ga0495680_0023547 | Ga0495680_0023547_399_1673 | 424 |
| 636 | 3300047322 | Ga0495680_0027997 | Ga0495680_0027997_661_1935 | 424 |
| 637 | 3300047322 | Ga0495680_0079995 | Ga0495680_0079995_166_1509 | 424 |
| 638 | 3300047323 | Ga0495683_0026531 | Ga0495683_0026531_946_2220 | 424 |
| 639 | 3300047323 | Ga0495683_0032946 | Ga0495683_0032946_282_1556 | 424 |
| 640 | 3300047443 | Ga0495687_000021 | Ga0495687_000021_212613_213887 | 424 |
| 641 | 3300047443 | Ga0495687_007444 | Ga0495687_007444_1810_3084 | 424 |
| 642 | 3300047443 | Ga0495687_008078 | Ga0495687_008078_4713_5987 | 424 |
| 643 | 3300047443 | Ga0495687_025058 | Ga0495687_025058_25_1299 | 424 |
| 644 | 3300047443 | Ga0495687_045002 | Ga0495687_045002_323_1597 | 424 |
| 645 | 3300047444 | Ga0495675_0118482 | Ga0495675_0118482_164_1438 | 424 |
| 646 | 3300047446 | Ga0495679_000013 | Ga0495679_000013_303149_304423 | 424 |
| 647 | 3300047446 | Ga0495679_000885 | Ga0495679_000885_14387_15730 | 424 |
| 648 | 3300047469 | Ga0495673_0018628 | Ga0495673_0018628_2049_3350 | 424 |
| 649 | 3300047469 | Ga0495673_0026075 | Ga0495673_0026075_605_1879 | 424 |
| 650 | 3300047472 | Ga0495686_0000081 | Ga0495686_0000081_24269_25558 | 424 |
| 651 | 3300047673 | Ga0495593_0005939 | Ga0495593_0005939_3193_4536 | 424 |
| 652 | 3300047673 | Ga0495593_0026977 | Ga0495593_0026977_179_1453 | 424 |
| 653 | 3300047673 | Ga0495593_0036021 | Ga0495593_0036021_661_1935 | 424 |
| 654 | 3300048088 | Ga0495602_0005107 | Ga0495602_0005107_12019_13293 | 424 |
| 655 | 3300048088 | Ga0495602_0143927 | Ga0495602_0143927_557_1831 | 424 |
| 656 | 3300048089 | Ga0495614_0010574 | Ga0495614_0010574_532_1806 | 424 |
| 657 | 3300048903 | Ga0496100_0000378 | Ga0496100_0000378_4678_6003 | 424 |
| 658 | 3300048903 | Ga0496100_0000628 | Ga0496100_0000628_14226_15500 | 424 |
| 659 | 3300048903 | Ga0496100_0189151 | Ga0496100_0189151_16_1290 | 424 |
| 660 | 3300048904 | Ga0496101_0000204 | Ga0496101_0000204_28244_29569 | 424 |
| 661 | 3300048904 | Ga0496101_0000412 | Ga0496101_0000412_1109_2383 | 424 |
| 662 | 3300048904 | Ga0496101_0053512 | Ga0496101_0053512_419_1693 | 424 |
| 663 | 3300048905 | Ga0496102_0000298 | Ga0496102_0000298_15688_17013 | 424 |
| 664 | 3300048905 | Ga0496102_0001948 | Ga0496102_0001948_9683_10957 | 424 |
| 665 | 3300048905 | Ga0496102_0017679 | Ga0496102_0017679_4107_5381 | 424 |
| 666 | 3300048906 | Ga0496103_0000253 | Ga0496103_0000253_33048_34373 | 424 |
| 667 | 3300048906 | Ga0496103_0018032 | Ga0496103_0018032_1235_2509 | 424 |
| 668 | 3300048907 | Ga0496104_0047706 | Ga0496104_0047706_2151_3476 | 424 |
| 669 | 3300048907 | Ga0496104_0062090 | Ga0496104_0062090_488_1762 | 424 |
| 670 | 3300048908 | Ga0496105_0008358 | Ga0496105_0008358_647_1921 | 424 |
| 671 | 3300048909 | Ga0496106_0197317 | Ga0496106_0197317_142_1416 | 424 |
| 672 | 3300048910 | Ga0496107_0029899 | Ga0496107_0029899_1289_2584 | 424 |
| 673 | 3300048910 | Ga0496107_0059471 | Ga0496107_0059471_827_2101 | 424 |
| 674 | 3300048913 | Ga0496110_0035868 | Ga0496110_0035868_50_1351 | 424 |
| 675 | 3300048913 | Ga0496110_0125994 | Ga0496110_0125994_51_1325 | 424 |
| 676 | 3300048915 | Ga0496112_0004494 | Ga0496112_0004494_3063_4388 | 424 |
| 677 | 3300048916 | Ga0496113_0042818 | Ga0496113_0042818_851_2125 | 424 |
| 678 | 3300048917 | Ga0496114_0012267 | Ga0496114_0012267_3196_4470 | 424 |
| 679 | 3300048920 | Ga0496117_0000171 | Ga0496117_0000171_118011_119336 | 424 |
| 680 | 3300048920 | Ga0496117_0003808 | Ga0496117_0003808_5037_6311 | 424 |
| 681 | 3300048920 | Ga0496117_0003944 | Ga0496117_0003944_2305_3579 | 424 |
| 682 | 3300048920 | Ga0496117_0010066 | Ga0496117_0010066_4822_6096 | 424 |
| 683 | 3300048920 | Ga0496117_0015912 | Ga0496117_0015912_2528_3802 | 424 |
| 684 | 3300048921 | Ga0496118_0000276 | Ga0496118_0000276_73367_74692 | 424 |
| 685 | 3300048921 | Ga0496118_0001751 | Ga0496118_0001751_19267_20541 | 424 |
| 686 | 3300048921 | Ga0496118_0004406 | Ga0496118_0004406_5109_6383 | 424 |
| 687 | 3300048921 | Ga0496118_0013254 | Ga0496118_0013254_6119_7393 | 424 |
| 688 | 3300048921 | Ga0496118_0022028 | Ga0496118_0022028_2646_3920 | 424 |
| 689 | 3300048924 | Ga0496121_0001129 | Ga0496121_0001129_10318_11592 | 424 |
| 690 | 3300048924 | Ga0496121_0005700 | Ga0496121_0005700_11207_12532 | 424 |
| 691 | 3300048924 | Ga0496121_0005701 | Ga0496121_0005701_7665_8939 | 424 |
| 692 | 3300048924 | Ga0496121_0023755 | Ga0496121_0023755_2276_3550 | 424 |
| 693 | 3300048924 | Ga0496121_0049892 | Ga0496121_0049892_1235_2560 | 424 |
| 694 | 3300048925 | Ga0496122_0047498 | Ga0496122_0047498_404_1729 | 424 |
| 695 | 3300048929 | Ga0496126_0004750 | Ga0496126_0004750_3324_4598 | 424 |
| 696 | 3300048929 | Ga0496126_0007120 | Ga0496126_0007120_346_1620 | 424 |
| 697 | 3300049459 | Ga0495678_023955 | Ga0495678_023955_750_2024 | 424 |
| 698 | 3300059505 | Ga0587083_0011409 | Ga0587083_0011409_116_1390 | 424 |
| 699 | 3300059640 | Ga0587067_006924 | Ga0587067_006924_79_1353 | 424 |
| 700 | 3300059643 | Ga0587072_003250 | Ga0587072_003250_80_1354 | 424 |
| 701 | 3300061719 | Ga0466962_0002106 | Ga0466962_0002106_3359_4633 | 424 |
| 702 | 3300061719 | Ga0466962_0003684 | Ga0466962_0003684_5761_7035 | 424 |
| 703 | 3300061719 | Ga0466962_0004737 | Ga0466962_0004737_1211_2485 | 424 |
| 704 | iso_pu_bacteria | 2848297114 | 2848299738 | 424 |
| 705 | iso_pu_bacteria | 2917554339 | 2917555317 | 424 |
| 706 | iso_pu_bacteria | 8045864390 | 8045865848 | 424 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7v3d-assembly1.cif.gz_A | complex structure of serine hydroxymethyltransferase from enterococcus faecium and its inhibitor | 0.8933 | 16 | 423 |
| 2w7m-assembly1.cif.gz_A-2 | crystal structure of y61absshmt obtained in the presence of glycine and 5-formyl tetrahydrofolate | 0.8895 | 12 | 418 |
| 2vi9-assembly1.cif.gz_A | crystal structure of s172absshmt glycine external aldimine | 0.8893 | 12 | 418 |
| 6yrw-assembly2.cif.gz_B | shmt from streptococcus thermophilus tyr55ser variant as internal aldimine and as non-covalent complex with d-ser | 0.8889 | 16 | 424 |
| 2vmu-assembly1.cif.gz_A-2 | crystal structure of y60absshmt crystallized in the presence of l- allo-thr | 0.8887 | 12 | 418 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n0lB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9705 | 284 | 424 | 3.90.1150.10 |
| 4msoB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9703 | 284 | 424 | 3.90.1150.10 |
| 2vgsA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.97 | 292 | 418 | 3.90.1150.10 |
| 4j5uB01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9662 | 292 | 424 | 3.90.1150.10 |
| 4p3mB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.961 | 284 | 424 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A090T083-F1-model_v4 | Serine hydroxymethyltransferase (EC 2.1.2.1) | 0.9954 | 270 | 394 |
GO:0004372
GO:0005829 GO:0008168 GO:0019264 GO:0030170 GO:0032259 GO:0046653 |
| AF-K2DFK8-F1-model_v4 | Serine hydroxymethyltransferase-like domain-containing protein | 0.9904 | 272 | 393 |
GO:0004372
GO:0005737 GO:0019264 GO:0030170 GO:0046653 |
| AF-A0A358B0M0-F1-model_v4 | Serine hydroxymethyltransferase (EC 2.1.2.1) | 0.9903 | 278 | 424 |
GO:0004372
GO:0005829 GO:0008168 GO:0019264 GO:0030170 GO:0032259 GO:0046653 |
| AF-F0GKV8-F1-model_v4 | Serine hydroxymethyltransferase (EC 2.1.2.1) | 0.9902 | 245 | 424 |
GO:0004372
GO:0005829 GO:0008168 GO:0019264 GO:0030170 GO:0032259 GO:0046653 |
| AF-A0A378VW09-F1-model_v4 | Serine hydroxymethyltransferase (EC 2.1.2.1) | 0.99 | 82 | 246 |
GO:0004372
GO:0005829 GO:0006730 GO:0008168 GO:0019264 GO:0030170 GO:0032259 GO:0046653 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar