F476421

General Info

Members Datasets Scaffolds Average Seq Length
705 275 1410 166

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0145973|Ga0495598_0145973_53_649
Length 198
Sequence MRSLYERVLIAIGGALAVSSVRDDKKFTHLPTFLLNTKMQISVGIITVSDRASRGEYNDLGGPALKEAALKNNWSVLCEAIVPDEIAQIQETIRSFAAQGCGLILTTGGTGLAARDITPEAIRGLMRVELPGFGEVMRAESMKITPNAILSRNLAAVVEQSLVVALPGKPSGAVECLGFVAGAVSHGVALARRMPTSC

Samples

Sample ID Description Type Environment
1 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
116 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
177 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
210 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
274 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 7.38
Rhizosphere 90.35
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495598_0145973 3300046537 Bacteria 822
2 MBSR1b_contig_1598471 2162886012 Unclassified 843
3 CNXas_1000077 3300000545 Bacteria 18398
4 JGI24737J22298_10070194 3300001990 Unclassified 1046
5 JGI24743J22301_10000126 3300001991 Bacteria 7571
6 JGI25406J46586_10000668 3300003203 Bacteria 15988
7 rootL2_10221030 3300003322 Bacteria 1155
8 rootH1_10001313 3300003323 Bacteria 46158
9 Ga0065704_10094005 3300005289 Bacteria 2562
10 Ga0065712_10007504 3300005290 Bacteria 2386
11 Ga0065712_10016200 3300005290 Bacteria 1815
12 Ga0065712_10037352 3300005290 Bacteria 716
13 Ga0065712_10135352 3300005290 Bacteria 1503
14 Ga0065712_10142324 3300005290 Bacteria 1433
15 Ga0065712_10206013 3300005290 Bacteria 1090
16 Ga0065715_10002587 3300005293 Bacteria 7483
17 Ga0065715_10143467 3300005293 Bacteria 1820
18 Ga0065715_10239545 3300005293 Bacteria 1204
19 Ga0065715_10607559 3300005293 Unclassified 703
20 Ga0065707_10007381 3300005295 Bacteria 4545
21 Ga0065707_10008423 3300005295 Bacteria 3486
22 Ga0065707_10028663 3300005295 Bacteria 942
23 Ga0070676_10023340 3300005328 Bacteria 3476
24 Ga0070676_10035224 3300005328 Bacteria 2878
25 Ga0070676_10244600 3300005328 Unclassified 1195
26 Ga0070676_10301164 3300005328 Bacteria 1087
27 Ga0070683_100158531 3300005329 Bacteria 2147
28 Ga0070683_100220936 3300005329 Bacteria 1801
29 Ga0070683_100283444 3300005329 Bacteria 1576
30 Ga0070683_100531934 3300005329 Bacteria 1123
31 Ga0070690_100087366 3300005330 Bacteria 2048
32 Ga0070690_100146356 3300005330 Bacteria 1608
33 Ga0070690_100365284 3300005330 Bacteria 1051
34 Ga0070670_100025092 3300005331 Bacteria 5128
35 Ga0070670_100040678 3300005331 Bacteria 3995
36 Ga0070677_10035817 3300005333 Bacteria 1926
37 Ga0070677_10201641 3300005333 Bacteria 960
38 Ga0068869_100145820 3300005334 Bacteria 1832
39 Ga0068869_100715295 3300005334 Bacteria 855
40 Ga0070666_10004811 3300005335 Bacteria 8257
41 Ga0070666_10009820 3300005335 Bacteria 5977
42 Ga0070666_10031595 3300005335 Bacteria 3496
43 Ga0070666_10234889 3300005335 Bacteria 1295
44 Ga0070680_100326520 3300005336 Bacteria 1303
45 Ga0068868_100036155 3300005338 Unclassified 3821
46 Ga0068868_100070545 3300005338 Bacteria 2786
47 Ga0068868_100184466 3300005338 Bacteria 1732
48 Ga0068868_100205402 3300005338 Bacteria 1644
49 Ga0070660_100016406 3300005339 Bacteria 5374
50 Ga0070660_100369112 3300005339 Bacteria 1184
51 Ga0070689_100000681 3300005340 Bacteria 20637
52 Ga0070689_100011875 3300005340 Bacteria 6252
53 Ga0070689_100191635 3300005340 Bacteria 1665
54 Ga0070689_100245110 3300005340 Bacteria 1477
55 Ga0070689_100466602 3300005340 Bacteria 1077
56 Ga0070687_100234609 3300005343 Bacteria 1131
57 Ga0070661_100062160 3300005344 Bacteria 2742
58 Ga0070661_100408010 3300005344 Bacteria 1075
59 Ga0070661_100756402 3300005344 Bacteria 795
60 Ga0070692_10052787 3300005345 Bacteria 2118
61 Ga0070668_100008469 3300005347 Bacteria 7639
62 Ga0070668_100072985 3300005347 Bacteria 2675
63 Ga0070668_100152038 3300005347 Bacteria 1873
64 Ga0070668_101382866 3300005347 Unclassified 641
65 Ga0070675_100001807 3300005354 Bacteria 15816
66 Ga0070675_100004314 3300005354 Bacteria 10840
67 Ga0070675_100048354 3300005354 Bacteria 3487
68 Ga0070675_100146276 3300005354 Bacteria 2024
69 Ga0070675_100224036 3300005354 Bacteria 1638
70 Ga0070675_100370842 3300005354 Bacteria 1272
71 Ga0070671_100008811 3300005355 Bacteria 8093
72 Ga0070671_100010700 3300005355 Bacteria 7365
73 Ga0070671_100053473 3300005355 Bacteria 3357
74 Ga0070671_100055557 3300005355 Bacteria 3293
75 Ga0070671_100056235 3300005355 Bacteria 3274
76 Ga0070671_100057650 3300005355 Bacteria 3232
77 Ga0070671_100170136 3300005355 Bacteria 1843
78 Ga0070671_100313163 3300005355 Bacteria 1337
79 Ga0070671_100324461 3300005355 Bacteria 1312
80 Ga0070671_100604564 3300005355 Unclassified 948
81 Ga0070674_100003293 3300005356 Bacteria 9036
82 Ga0070674_100025353 3300005356 Bacteria 3859
83 Ga0070674_100160170 3300005356 Bacteria 1707
84 Ga0070674_100361826 3300005356 Unclassified 1175
85 Ga0070674_100399849 3300005356 Bacteria 1122
86 Ga0070673_100005164 3300005364 Bacteria 8334
87 Ga0070673_100023903 3300005364 Bacteria 4471
88 Ga0070673_100064654 3300005364 Bacteria 2915
89 Ga0070673_100153521 3300005364 Bacteria 1952
90 Ga0070673_100217534 3300005364 Bacteria 1652
91 Ga0070673_100310607 3300005364 Bacteria 1390
92 Ga0070673_101514133 3300005364 Unclassified 633
93 Ga0070688_100000809 3300005365 Bacteria 15426
94 Ga0070688_100011465 3300005365 Bacteria 4925
95 Ga0070688_100035915 3300005365 Bacteria 3012
96 Ga0070688_100076926 3300005365 Bacteria 2149
97 Ga0070688_100108600 3300005365 Bacteria 1841
98 Ga0070688_100208323 3300005365 Bacteria 1371
99 Ga0070659_100000778 3300005366 Bacteria 23158
100 Ga0070667_100008283 3300005367 Bacteria 8616
101 Ga0070667_100236034 3300005367 Bacteria 1632
102 Ga0070667_100399555 3300005367 Bacteria 1251
103 Ga0070703_10027428 3300005406 Bacteria 1697
104 Ga0070703_10062254 3300005406 Bacteria 1224
105 Ga0070703_10393347 3300005406 Bacteria 602
106 Ga0070709_10129214 3300005434 Bacteria 1723
107 Ga0070709_10172624 3300005434 Bacteria 1512
108 Ga0070714_100133170 3300005435 Bacteria 2223
109 Ga0070714_100168563 3300005435 Bacteria 1986
110 Ga0070714_100356411 3300005435 Unclassified 1375
111 Ga0070714_100840440 3300005435 Bacteria 890
112 Ga0070713_100141365 3300005436 Bacteria 2133
113 Ga0070713_100406191 3300005436 Bacteria 1273
114 Ga0070713_101369686 3300005436 Bacteria 686
115 Ga0070710_10036989 3300005437 Bacteria 2672
116 Ga0070710_10317809 3300005437 Bacteria 1021
117 Ga0070701_10041669 3300005438 Bacteria 2341
118 Ga0070711_100008159 3300005439 Bacteria 6404
119 Ga0070711_100023455 3300005439 Bacteria 4013
120 Ga0070711_100044234 3300005439 Bacteria 3021
121 Ga0070705_100003124 3300005440 Bacteria 8146
122 Ga0070705_100041103 3300005440 Bacteria 2634
123 Ga0070700_100014411 3300005441 Bacteria 4464
124 Ga0070700_100131207 3300005441 Bacteria 1691
125 Ga0070708_100043946 3300005445 Unclassified 3927
126 Ga0070708_100065485 3300005445 Bacteria 3259
127 Ga0070708_100069909 3300005445 Bacteria 3158
128 Ga0070708_100125096 3300005445 Bacteria 2375
129 Ga0070708_100151575 3300005445 Bacteria 2156
130 Ga0070708_100190357 3300005445 Bacteria 1919
131 Ga0070708_100328393 3300005445 Bacteria 1441
132 Ga0070708_100509815 3300005445 Bacteria 1135
133 Ga0070708_100634158 3300005445 Unclassified 1007
134 Ga0070708_100687981 3300005445 Unclassified 963
135 Ga0070708_100742281 3300005445 Unclassified 923
136 Ga0070663_100148587 3300005455 Bacteria 1795
137 Ga0070663_100239468 3300005455 Bacteria 1432
138 Ga0070678_100026260 3300005456 Bacteria 3934
139 Ga0070678_100389490 3300005456 Bacteria 1208
140 Ga0070662_100054020 3300005457 Bacteria 2910
141 Ga0070662_100129943 3300005457 Bacteria 1941
142 Ga0070662_101071284 3300005457 Unclassified 691
143 Ga0070681_10115390 3300005458 Bacteria 2623
144 Ga0068867_100043670 3300005459 Bacteria 3282
145 Ga0068867_100141449 3300005459 Bacteria 1881
146 Ga0070685_10191690 3300005466 Bacteria 1323
147 Ga0070685_10287627 3300005466 Bacteria 1103
148 Ga0070685_10482805 3300005466 Bacteria 874
149 Ga0070706_100016956 3300005467 Bacteria 6729
150 Ga0070706_100047159 3300005467 Bacteria 3976
151 Ga0070706_100047666 3300005467 Unclassified 3954
152 Ga0070706_100086315 3300005467 Bacteria 2908
153 Ga0070706_100113141 3300005467 Bacteria 2527
154 Ga0070706_100134508 3300005467 Bacteria 2308
155 Ga0070706_100338760 3300005467 Bacteria 1402
156 Ga0070706_100397421 3300005467 Bacteria 1283
157 Ga0070706_100467912 3300005467 Unclassified 1173
158 Ga0070706_100570642 3300005467 Bacteria 1052
159 Ga0070706_100810384 3300005467 Bacteria 866
160 Ga0070706_100842341 3300005467 Bacteria 848
161 Ga0070706_101073821 3300005467 Unclassified 741
162 Ga0070707_100002533 3300005468 Bacteria 17381
163 Ga0070707_100005961 3300005468 Bacteria 11366
164 Ga0070707_100029606 3300005468 Bacteria 5213
165 Ga0070707_100058577 3300005468 Bacteria 3694
166 Ga0070707_100152571 3300005468 Bacteria 2250
167 Ga0070707_100184550 3300005468 Unclassified 2034
168 Ga0070707_100189784 3300005468 Bacteria 2004
169 Ga0070707_100199657 3300005468 Bacteria 1949
170 Ga0070707_100246014 3300005468 Bacteria 1740
171 Ga0070707_100364498 3300005468 Bacteria 1404
172 Ga0070698_100001865 3300005471 Bacteria 23485
173 Ga0070698_100006241 3300005471 Bacteria 12968
174 Ga0070698_100008773 3300005471 Bacteria 10883
175 Ga0070698_100022595 3300005471 Bacteria 6578
176 Ga0070698_100088742 3300005471 Bacteria 3077
177 Ga0070698_101478651 3300005471 Bacteria 631
178 Ga0070699_100030456 3300005518 Bacteria 4658
179 Ga0070699_100033553 3300005518 Bacteria 4435
180 Ga0070699_100039183 3300005518 Bacteria 4103
181 Ga0070699_100061740 3300005518 Bacteria 3247
182 Ga0070699_100488617 3300005518 Bacteria 1118
183 Ga0070699_101135131 3300005518 Bacteria 717
184 Ga0070679_101058719 3300005530 Bacteria 755
185 Ga0070684_100000434 3300005535 Bacteria 28740
186 Ga0070684_100332548 3300005535 Bacteria 1396
187 Ga0070684_100726372 3300005535 Bacteria 926
188 Ga0070697_100001418 3300005536 Bacteria 18201
189 Ga0070697_100010497 3300005536 Bacteria 7229
190 Ga0070697_100014756 3300005536 Bacteria 6132
191 Ga0070697_100046939 3300005536 Bacteria 3502
192 Ga0070697_100075116 3300005536 Bacteria 2777
193 Ga0070697_100078476 3300005536 Bacteria 2717
194 Ga0070697_100091024 3300005536 Unclassified 2522
195 Ga0070697_100198268 3300005536 Bacteria 1706
196 Ga0070697_100234105 3300005536 Bacteria 1567
197 Ga0070697_100543299 3300005536 Bacteria 1019
198 Ga0068853_100318545 3300005539 Bacteria 1441
199 Ga0070672_100066414 3300005543 Bacteria 2856
200 Ga0070672_100197283 3300005543 Bacteria 1682
201 Ga0070672_100356348 3300005543 Bacteria 1248
202 Ga0070686_100295406 3300005544 Bacteria 1200
203 Ga0070696_100910491 3300005546 Bacteria 730
204 Ga0070665_100029142 3300005548 Bacteria 5556
205 Ga0070665_100033193 3300005548 Bacteria 5193
206 Ga0070665_100104808 3300005548 Bacteria 2830
207 Ga0070704_100011886 3300005549 Bacteria 5359
208 Ga0070664_100111881 3300005564 Bacteria 2384
209 Ga0070664_100180850 3300005564 Bacteria 1874
210 Ga0068857_100449885 3300005577 Bacteria 1204
211 Ga0068857_101187722 3300005577 Bacteria 738
212 Ga0068856_100000202 3300005614 Bacteria 63636
213 Ga0068856_100014369 3300005614 Bacteria 7653
214 Ga0068859_100105952 3300005617 Bacteria 2871
215 Ga0068863_100008508 3300005841 Bacteria 10021
216 Ga0068858_100003405 3300005842 Bacteria 15815
217 Ga0068860_100041634 3300005843 Bacteria 4388
218 Ga0068860_101292866 3300005843 Unclassified 750
219 Ga0068862_100585004 3300005844 Bacteria 1070
220 Ga0081455_10065972 3300005937 Bacteria 3024
221 Ga0081455_10199141 3300005937 Bacteria 1501
222 Ga0081455_10718119 3300005937 Bacteria 635
223 Ga0081455_10771086 3300005937 Bacteria 606
224 Ga0081539_10001276 3300005985 Bacteria 44329
225 Ga0081539_10005500 3300005985 Bacteria 12868
226 Ga0081539_10064675 3300005985 Bacteria 1989
227 Ga0070717_10015335 3300006028 Bacteria 5917
228 Ga0070717_10020822 3300006028 Bacteria 5162
229 Ga0070717_10049791 3300006028 Bacteria 3440
230 Ga0070717_10051667 3300006028 Bacteria 3384
231 Ga0070717_10231767 3300006028 Bacteria 1626
232 Ga0070717_10468259 3300006028 Bacteria 1137
233 Ga0070715_10631514 3300006163 Bacteria 632
234 Ga0070716_100002802 3300006173 Bacteria 8114
235 Ga0070716_100441990 3300006173 Bacteria 946
236 Ga0070716_101015877 3300006173 Bacteria 656
237 Ga0070712_100006716 3300006175 Bacteria 7150
238 Ga0070712_100015234 3300006175 Bacteria 4946
239 Ga0070712_100098077 3300006175 Bacteria 2161
240 Ga0070712_100144246 3300006175 Unclassified 1821
241 Ga0070712_100210030 3300006175 Bacteria 1534
242 Ga0070712_100362086 3300006175 Unclassified 1190
243 Ga0070712_100452309 3300006175 Bacteria 1069
244 Ga0070712_100531079 3300006175 Bacteria 989
245 Ga0070712_100691365 3300006175 Bacteria 869
246 Ga0070712_100998017 3300006175 Unclassified 724
247 Ga0070712_101128731 3300006175 Bacteria 681
248 Ga0097621_100032156 3300006237 Bacteria 4169
249 Ga0097621_100069722 3300006237 Bacteria 2903
250 Ga0097621_100079767 3300006237 Bacteria 2721
251 Ga0097621_100435728 3300006237 Bacteria 1179
252 Ga0068871_100045278 3300006358 Bacteria 3541
253 Ga0068871_100053237 3300006358 Bacteria 3279
254 Ga0068871_100061929 3300006358 Bacteria 3057
255 Ga0068871_100320958 3300006358 Bacteria 1364
256 Ga0075428_100484277 3300006844 Bacteria 1324
257 Ga0075428_101103373 3300006844 Bacteria 838
258 Ga0075434_100103674 3300006871 Bacteria 2853
259 Ga0075434_100225497 3300006871 Bacteria 1893
260 Ga0075434_100756385 3300006871 Bacteria 989
261 Ga0075436_100228631 3300006914 Unclassified 1321
262 Ga0075436_100385362 3300006914 Bacteria 1014
263 Ga0075436_101255286 3300006914 Unclassified 560
264 Ga0097620_100105947 3300006931 Bacteria 2871
265 Ga0075435_100074542 3300007076 Bacteria 2776
266 Ga0075435_100654823 3300007076 Unclassified 912
267 Ga0075435_100801720 3300007076 Unclassified 820
268 Ga0111539_10695873 3300009094 Unclassified 1183
269 Ga0105245_10218308 3300009098 Bacteria 1838
270 Ga0105245_11734722 3300009098 Bacteria 677
271 Ga0105247_10187628 3300009101 Bacteria 1383
272 Ga0105247_10271522 3300009101 Bacteria 1166
273 Ga0105247_10375706 3300009101 Bacteria 1006
274 Ga0114129_10851763 3300009147 Bacteria 1159
275 Ga0114129_11715946 3300009147 Bacteria 766
276 Ga0105243_10661290 3300009148 Bacteria 1014
277 Ga0105241_10788837 3300009174 Bacteria 874
278 Ga0105242_10207641 3300009176 Bacteria 1743
279 Ga0105242_10422117 3300009176 Bacteria 1250
280 Ga0105242_10460408 3300009176 Bacteria 1201
281 Ga0105242_10492245 3300009176 Bacteria 1164
282 Ga0105248_10102829 3300009177 Bacteria 3220
283 Ga0105237_10436376 3300009545 Unclassified 1315
284 Ga0105249_10004358 3300009553 Bacteria 12241
285 Ga0105249_10558600 3300009553 Bacteria 1196
286 Ga0099796_10007844 3300010159 Bacteria 2814
287 Ga0105239_10057908 3300010375 Bacteria 4250
288 Ga0105239_10980468 3300010375 Bacteria 971
289 Ga0105246_10336629 3300011119 Bacteria 1232
290 Ga0157371_10026798 3300013102 Bacteria 4186
291 Ga0157371_10128969 3300013102 Bacteria 1799
292 Ga0157370_10071791 3300013104 Bacteria 3267
293 Ga0157369_10737645 3300013105 Bacteria 1014
294 Ga0157374_10000209 3300013296 Bacteria 53821
295 Ga0157374_10020719 3300013296 Bacteria 5837
296 Ga0157374_10137845 3300013296 Bacteria 2367
297 Ga0157374_10160475 3300013296 Bacteria 2189
298 Ga0157374_10168848 3300013296 Bacteria 2133
299 Ga0157374_10346742 3300013296 Bacteria 1475
300 Ga0157374_11418355 3300013296 Bacteria 717
301 Ga0157374_11451412 3300013296 Unclassified 709
302 Ga0157378_10052389 3300013297 Bacteria 3631
303 Ga0157378_10056206 3300013297 Bacteria 3506
304 Ga0157378_10060124 3300013297 Bacteria 3391
305 Ga0157378_10064954 3300013297 Bacteria 3266
306 Ga0157378_10102640 3300013297 Bacteria 2612
307 Ga0157378_10142501 3300013297 Bacteria 2227
308 Ga0157378_10193044 3300013297 Bacteria 1922
309 Ga0157378_10203459 3300013297 Bacteria 1874
310 Ga0157378_10205221 3300013297 Bacteria 1866
311 Ga0157378_10420621 3300013297 Bacteria 1321
312 Ga0157378_10760944 3300013297 Bacteria 992
313 Ga0157378_11245303 3300013297 Unclassified 784
314 Ga0157378_12448190 3300013297 Bacteria 574
315 Ga0163162_10048816 3300013306 Bacteria 4241
316 Ga0163162_10057229 3300013306 Bacteria 3926
317 Ga0163162_10138556 3300013306 Bacteria 2545
318 Ga0163162_10147690 3300013306 Bacteria 2468
319 Ga0163162_10544836 3300013306 Bacteria 1289
320 Ga0163162_11464257 3300013306 Bacteria 777
321 Ga0157372_10133664 3300013307 Bacteria 2856
322 Ga0157372_10396758 3300013307 Bacteria 1608
323 Ga0157372_10517908 3300013307 Bacteria 1390
324 Ga0157372_11035818 3300013307 Bacteria 950
325 Ga0157375_10010665 3300013308 Bacteria 8093
326 Ga0157375_10021399 3300013308 Bacteria 5929
327 Ga0157375_10022023 3300013308 Bacteria 5860
328 Ga0157375_10042560 3300013308 Bacteria 4397
329 Ga0157375_10164501 3300013308 Bacteria 2363
330 Ga0157375_10391151 3300013308 Bacteria 1557
331 Ga0157375_10406677 3300013308 Bacteria 1527
332 Ga0163163_10398542 3300014325 Bacteria 1434
333 Ga0157377_10018266 3300014745 Bacteria 3643
334 Ga0157377_10079067 3300014745 Bacteria 1918
335 Ga0157379_10004731 3300014968 Bacteria 11679
336 Ga0157379_11541403 3300014968 Bacteria 647
337 Ga0157376_10007137 3300014969 Bacteria 7936
338 Ga0157376_10062856 3300014969 Bacteria 3125
339 Ga0157376_10085437 3300014969 Bacteria 2719
340 Ga0157376_10131069 3300014969 Bacteria 2237
341 Ga0157376_10170687 3300014969 Bacteria 1980
342 Ga0157376_10229226 3300014969 Bacteria 1725
343 Ga0157376_10341665 3300014969 Bacteria 1430
344 Ga0182006_1235967 3300015261 Bacteria 601
345 Ga0163161_10556802 3300017792 Bacteria 940
346 Ga0213873_10038227 3300021358 Bacteria 1226
347 Ga0213872_10041513 3300021361 Bacteria 2099
348 Ga0213876_10006162 3300021384 Bacteria 6543
349 Ga0213876_10010903 3300021384 Bacteria 4867
350 Ga0213871_10031657 3300021441 Unclassified 1383
351 Ga0207666_1000389 3300025271 Bacteria 5818
352 Ga0207666_1009500 3300025271 Bacteria 1315
353 Ga0207697_10000288 3300025315 Bacteria 28021
354 Ga0207697_10001879 3300025315 Bacteria 11214
355 Ga0207697_10003754 3300025315 Bacteria 7429
356 Ga0207697_10005036 3300025315 Bacteria 6195
357 Ga0207697_10066686 3300025315 Bacteria 1504
358 Ga0207697_10100666 3300025315 Bacteria 1231
359 Ga0207697_10116022 3300025315 Bacteria 1150
360 Ga0207697_10128108 3300025315 Bacteria 1096
361 Ga0207697_10129513 3300025315 Bacteria 1090
362 Ga0207697_10328563 3300025315 Bacteria 679
363 Ga0207653_10014789 3300025885 Bacteria 2449
364 Ga0207692_10088658 3300025898 Bacteria 1672
365 Ga0207692_10694504 3300025898 Unclassified 660
366 Ga0207642_10076790 3300025899 Bacteria 1609
367 Ga0207688_10041644 3300025901 Bacteria 2555
368 Ga0207688_10053822 3300025901 Bacteria 2257
369 Ga0207680_10009936 3300025903 Bacteria 4741
370 Ga0207680_10058534 3300025903 Bacteria 2336
371 Ga0207680_10063036 3300025903 Bacteria 2267
372 Ga0207647_10002631 3300025904 Bacteria 13582
373 Ga0207685_10005447 3300025905 Bacteria 3361
374 Ga0207685_10299544 3300025905 Bacteria 795
375 Ga0207699_10494088 3300025906 Bacteria 883
376 Ga0207645_10002820 3300025907 Bacteria 13499
377 Ga0207645_10417962 3300025907 Unclassified 903
378 Ga0207705_10499784 3300025909 Bacteria 944
379 Ga0207705_10608948 3300025909 Bacteria 849
380 Ga0207684_10000028 3300025910 Bacteria 306450
381 Ga0207684_10016318 3300025910 Bacteria 6377
382 Ga0207684_10018458 3300025910 Bacteria 5972
383 Ga0207684_10024499 3300025910 Bacteria 5144
384 Ga0207684_10074261 3300025910 Bacteria 2889
385 Ga0207684_10100734 3300025910 Bacteria 2469
386 Ga0207684_10148310 3300025910 Bacteria 2018
387 Ga0207684_10181217 3300025910 Unclassified 1816
388 Ga0207684_10400672 3300025910 Bacteria 1180
389 Ga0207684_10466636 3300025910 Unclassified 1084
390 Ga0207654_10791883 3300025911 Bacteria 684
391 Ga0207693_10000682 3300025915 Bacteria 30507
392 Ga0207693_10027730 3300025915 Bacteria 4476
393 Ga0207693_10106103 3300025915 Bacteria 2203
394 Ga0207693_10167003 3300025915 Bacteria 1733
395 Ga0207693_10213708 3300025915 Bacteria 1516
396 Ga0207693_10463014 3300025915 Bacteria 990
397 Ga0207693_10687172 3300025915 Bacteria 793
398 Ga0207663_10076806 3300025916 Bacteria 2171
399 Ga0207663_10090664 3300025916 Bacteria 2027
400 Ga0207663_10227583 3300025916 Bacteria 1360
401 Ga0207660_10042654 3300025917 Bacteria 3185
402 Ga0207662_10022356 3300025918 Bacteria 3626
403 Ga0207657_10022945 3300025919 Bacteria 5823
404 Ga0207649_10620948 3300025920 Bacteria 833
405 Ga0207652_10227154 3300025921 Bacteria 1682
406 Ga0207646_10000794 3300025922 Bacteria 41086
407 Ga0207646_10014890 3300025922 Bacteria 7367
408 Ga0207646_10216117 3300025922 Bacteria 1732
409 Ga0207646_10258162 3300025922 Bacteria 1575
410 Ga0207646_10297483 3300025922 Bacteria 1458
411 Ga0207646_10422382 3300025922 Bacteria 1203
412 Ga0207646_10455603 3300025922 Bacteria 1154
413 Ga0207681_10100437 3300025923 Bacteria 2085
414 Ga0207681_10196526 3300025923 Bacteria 1546
415 Ga0207650_10050103 3300025925 Bacteria 3086
416 Ga0207650_10060354 3300025925 Bacteria 2830
417 Ga0207650_10196723 3300025925 Bacteria 1613
418 Ga0207650_10295999 3300025925 Unclassified 1321
419 Ga0207650_11575927 3300025925 Unclassified 558
420 Ga0207659_10001123 3300025926 Bacteria 15863
421 Ga0207659_10012288 3300025926 Bacteria 5442
422 Ga0207659_10051393 3300025926 Bacteria 2931
423 Ga0207659_10074555 3300025926 Bacteria 2487
424 Ga0207659_10114406 3300025926 Bacteria 2056
425 Ga0207659_10139217 3300025926 Bacteria 1882
426 Ga0207659_10184425 3300025926 Bacteria 1656
427 Ga0207659_11403269 3300025926 Unclassified 599
428 Ga0207687_10334469 3300025927 Bacteria 1229
429 Ga0207687_10667757 3300025927 Bacteria 880
430 Ga0207700_10161514 3300025928 Bacteria 1861
431 Ga0207700_10167724 3300025928 Bacteria 1829
432 Ga0207700_10304300 3300025928 Unclassified 1377
433 Ga0207700_10386566 3300025928 Bacteria 1224
434 Ga0207700_11466653 3300025928 Unclassified 606
435 Ga0207664_10199897 3300025929 Unclassified 1725
436 Ga0207664_10334301 3300025929 Bacteria 1338
437 Ga0207664_10572700 3300025929 Bacteria 1014
438 Ga0207644_10002120 3300025931 Bacteria 12870
439 Ga0207644_10092998 3300025931 Bacteria 2251
440 Ga0207644_10095316 3300025931 Bacteria 2225
441 Ga0207644_10099031 3300025931 Bacteria 2187
442 Ga0207644_10146843 3300025931 Bacteria 1821
443 Ga0207644_10286674 3300025931 Bacteria 1323
444 Ga0207644_10316391 3300025931 Bacteria 1261
445 Ga0207644_10342121 3300025931 Bacteria 1213
446 Ga0207644_10527411 3300025931 Bacteria 976
447 Ga0207644_10545465 3300025931 Bacteria 959
448 Ga0207690_10000727 3300025932 Bacteria 21241
449 Ga0207690_10661755 3300025932 Bacteria 856
450 Ga0207690_10926758 3300025932 Bacteria 723
451 Ga0207706_10014796 3300025933 Bacteria 7063
452 Ga0207706_10029125 3300025933 Bacteria 4931
453 Ga0207706_10072565 3300025933 Bacteria 3027
454 Ga0207706_10861042 3300025933 Bacteria 767
455 Ga0207709_10255352 3300025935 Bacteria 1282
456 Ga0207670_10003010 3300025936 Bacteria 8893
457 Ga0207670_10020024 3300025936 Bacteria 4101
458 Ga0207670_10435845 3300025936 Bacteria 1054
459 Ga0207669_10007994 3300025937 Bacteria 4938
460 Ga0207669_10024744 3300025937 Bacteria 3232
461 Ga0207669_10377947 3300025937 Bacteria 1103
462 Ga0207704_10095046 3300025938 Bacteria 1969
463 Ga0207665_10002886 3300025939 Bacteria 11532
464 Ga0207665_10093457 3300025939 Bacteria 2088
465 Ga0207665_10202904 3300025939 Bacteria 1445
466 Ga0207665_11410490 3300025939 Unclassified 554
467 Ga0207691_10006461 3300025940 Bacteria 11326
468 Ga0207691_10225932 3300025940 Bacteria 1622
469 Ga0207691_10235533 3300025940 Bacteria 1584
470 Ga0207691_10630507 3300025940 Bacteria 906
471 Ga0207691_10927648 3300025940 Unclassified 728
472 Ga0207711_10217868 3300025941 Bacteria 1745
473 Ga0207689_10060203 3300025942 Bacteria 3122
474 Ga0207661_10118371 3300025944 Bacteria 2251
475 Ga0207661_10130923 3300025944 Bacteria 2149
476 Ga0207679_10062867 3300025945 Bacteria 2769
477 Ga0207679_10510813 3300025945 Bacteria 1073
478 Ga0207651_10041307 3300025960 Bacteria 3061
479 Ga0207651_10102646 3300025960 Bacteria 2126
480 Ga0207651_10263387 3300025960 Bacteria 1416
481 Ga0207651_11596781 3300025960 Bacteria 587
482 Ga0207712_10017171 3300025961 Bacteria 4696
483 Ga0207668_10275472 3300025972 Bacteria 1377
484 Ga0207668_10386550 3300025972 Bacteria 1179
485 Ga0207658_10202814 3300025986 Bacteria 1657
486 Ga0207658_10458764 3300025986 Bacteria 1129
487 Ga0207658_10818041 3300025986 Bacteria 846
488 Ga0207677_10076933 3300026023 Bacteria 2378
489 Ga0207677_10201451 3300026023 Bacteria 1582
490 Ga0207677_10232017 3300026023 Bacteria 1487
491 Ga0207677_10281520 3300026023 Bacteria 1365
492 Ga0207703_10027166 3300026035 Bacteria 4507
493 Ga0207703_10743238 3300026035 Bacteria 934
494 Ga0207639_11134360 3300026041 Bacteria 733
495 Ga0207639_11592023 3300026041 Unclassified 613
496 Ga0207678_10190743 3300026067 Bacteria 1751
497 Ga0207708_10023984 3300026075 Bacteria 4614
498 Ga0207708_10146029 3300026075 Bacteria 1859
499 Ga0207702_10003769 3300026078 Bacteria 13697
500 Ga0207702_10064440 3300026078 Bacteria 3136
501 Ga0207702_11416056 3300026078 Bacteria 689
502 Ga0207641_10016661 3300026088 Bacteria 6017
503 Ga0207641_10736192 3300026088 Bacteria 973
504 Ga0207641_11029185 3300026088 Bacteria 821
505 Ga0207648_10025222 3300026089 Bacteria 5299
506 Ga0207676_11652393 3300026095 Bacteria 639
507 Ga0207676_11733781 3300026095 Bacteria 623
508 Ga0207683_10007165 3300026121 Bacteria 9561
509 Ga0207683_10017323 3300026121 Bacteria 6139
510 Ga0207683_10040999 3300026121 Bacteria 4042
511 Ga0207683_10565804 3300026121 Bacteria 1051
512 Ga0268266_10023922 3300028379 Bacteria 5198
513 Ga0268266_10151494 3300028379 Bacteria 2090
514 Ga0268266_10322090 3300028379 Bacteria 1447
515 Ga0268266_10463197 3300028379 Bacteria 1206
516 Ga0268266_10490677 3300028379 Bacteria 1172
517 Ga0268265_10243743 3300028380 Bacteria 1588
518 Ga0268264_10065686 3300028381 Bacteria 3057
519 Ga0265331_10176727 3300031250 Bacteria 965
520 Ga0307513_10175031 3300031456 Bacteria 2017
521 Ga0307410_10743433 3300031852 Unclassified 830
522 Ga0373926_0035768 3300035083 Bacteria 1763
523 Ga0373934_0076891 3300035086 Bacteria 1339
524 Ga0373923_0313558 3300035111 Bacteria 744
525 Ga0373936_0284094 3300035113 Bacteria 744
526 Ga0373945_0131440 3300035116 Bacteria 1003
527 Ga0373943_0041449 3300035170 Bacteria 2226
528 Ga0373943_0050141 3300035170 Bacteria 2050
529 Ga0373943_0221154 3300035170 Bacteria 1055
530 Ga0373955_0051266 3300035172 Bacteria 2247
531 Ga0373955_0134422 3300035172 Bacteria 1446
532 Ga0373955_0248575 3300035172 Bacteria 1066
533 Ga0373931_0015248 3300035691 Bacteria 3768
534 Ga0373931_0224620 3300035691 Bacteria 1132
535 Ga0373935_0007503 3300035692 Bacteria 6530
536 Ga0373935_0076888 3300035692 Bacteria 2162
537 Ga0373927_0265587 3300035695 Bacteria 1128
538 Ga0373933_0479391 3300035724 Bacteria 814
539 Ga0373933_0737191 3300035724 Bacteria 648
540 Ga0373947_0072400 3300035725 Bacteria 2116
541 Ga0373947_0173409 3300035725 Bacteria 1401
542 Ga0373947_0227953 3300035725 Bacteria 1226
543 Ga0373937_0452044 3300036401 Bacteria 1220
544 Ga0373925_0540344 3300037068 Bacteria 958
545 Ga0373925_0653239 3300037068 Bacteria 867
546 Ga0395899_0000148 3300037312 Bacteria 106403
547 Ga0395899_0048950 3300037312 Unclassified 3143
548 Ga0395900_0018935 3300037418 Bacteria 7021
549 Ga0395900_0292221 3300037418 Bacteria 1618
550 Ga0395898_0005604 3300037466 Bacteria 13533
551 Ga0395898_0123828 3300037466 Bacteria 2477
552 Ga0395905_1395651 3300037471 Unclassified 604
553 Ga0436364_0038505 3300037853 Bacteria 1458
554 Ga0436364_0918711 3300037853 Bacteria 1168
555 Ga0395901_0000757 3300038443 Bacteria 36285
556 Ga0395901_0352764 3300038443 Bacteria 1518
557 Ga0395901_0466038 3300038443 Bacteria 1290
558 Ga0395901_0903445 3300038443 Bacteria 865
559 Ga0436365_0291627 3300039437 Bacteria 3804
560 Ga0436365_0542149 3300039437 Bacteria 29982
561 Ga0436365_0836133 3300039437 Bacteria 111215
562 Ga0436365_0949032 3300039437 Bacteria 2530
563 Ga0436365_1840798 3300039437 Bacteria 963
564 Ga0436360_0540386 3300039438 Unclassified 1992
565 Ga0436360_0738046 3300039438 Bacteria 5470
566 Ga0436361_0144833 3300039447 Unclassified 4690
567 Ga0436361_0416595 3300039447 Bacteria 47178
568 Ga0436361_0655048 3300039447 Bacteria 2014
569 Ga0436362_0076865 3300039453 Bacteria 635
570 Ga0436362_0273225 3300039453 Bacteria 1914
571 Ga0436362_1302472 3300039453 Unclassified 704
572 Ga0451800_1123943 3300041459 Bacteria 829
573 Ga0451833_0883708 3300041491 Bacteria 967
574 Ga0451839_0634602 3300041496 Bacteria 970
575 Ga0439448_0057112 3300042005 Bacteria 1286
576 Ga0439455_0004552 3300042012 Bacteria 2755
577 Ga0439455_0054340 3300042012 Bacteria 1051
578 Ga0439460_0064909 3300042461 Bacteria 1121
579 Ga0439440_0145226 3300042993 Bacteria 676
580 Ga0466964_0043560 3300044706 Bacteria 1821
581 Ga0495617_102486 3300046452 Bacteria 930
582 Ga0495592_0007083 3300046454 Bacteria 8391
583 Ga0495629_0113854 3300046459 Bacteria 1885
584 Ga0495641_0145026 3300046461 Bacteria 1061
585 Ga0495651_0183041 3300046462 Bacteria 1481
586 Ga0495653_0083015 3300046463 Bacteria 2364
587 Ga0495653_0266624 3300046463 Bacteria 1130
588 Ga0495582_0459844 3300046473 Bacteria 735
589 Ga0495639_0037429 3300046475 Bacteria 2175
590 Ga0495662_0256716 3300046476 Bacteria 861
591 Ga0495584_0189714 3300046491 Bacteria 1045
592 Ga0495594_0226616 3300046499 Bacteria 1066
593 Ga0495618_0074219 3300046514 Bacteria 2166
594 Ga0495618_0110756 3300046514 Bacteria 1758
595 Ga0495618_0349816 3300046514 Bacteria 911
596 Ga0495628_0016468 3300046516 Bacteria 6166
597 Ga0495628_0334975 3300046516 Bacteria 1115
598 Ga0495630_0364791 3300046517 Unclassified 1106
599 Ga0495630_0545834 3300046517 Bacteria 889
600 Ga0495652_0026455 3300046529 Bacteria 5126
601 Ga0495640_0379371 3300046533 Bacteria 870
602 Ga0495640_0389714 3300046533 Bacteria 856
603 Ga0495586_0074060 3300046535 Bacteria 1863
604 Ga0495587_0049280 3300046536 Bacteria 2493
605 Ga0495598_0000913 3300046537 Bacteria 5685
606 Ga0495609_0076943 3300046538 Bacteria 1462
607 Ga0495645_0096733 3300046543 Bacteria 2103
608 Ga0495645_0482238 3300046543 Unclassified 778
609 Ga0495656_0518127 3300046615 Unclassified 633
610 Ga0495668_0667511 3300046616 Unclassified 575
611 Ga0495634_0100581 3300046642 Bacteria 1868
612 Ga0495634_0130586 3300046642 Bacteria 1602
613 Ga0495634_0164226 3300046642 Bacteria 1398
614 Ga0495659_0007373 3300046664 Bacteria 3490
615 Ga0495659_0102758 3300046664 Bacteria 1109
616 Ga0495657_0161971 3300046675 Bacteria 1384
617 Ga0495599_0001566 3300046678 Bacteria 13177
618 Ga0495623_0014241 3300046679 Bacteria 5151
619 Ga0495646_0003926 3300046680 Bacteria 9300
620 Ga0495658_0010304 3300046683 Bacteria 4676
621 Ga0495658_0160691 3300046683 Bacteria 1385
622 Ga0495669_0180272 3300046684 Unclassified 1007
623 Ga0495669_0300454 3300046684 Bacteria 774
624 Ga0495613_0768086 3300046689 Bacteria 631
625 Ga0495624_0041505 3300046690 Bacteria 2942
626 Ga0495624_0164622 3300046690 Bacteria 1354
627 Ga0495600_0583230 3300046809 Bacteria 681
628 Ga0495581_0162719 3300047315 Bacteria 1305
629 Ga0495604_0039275 3300047317 Bacteria 3721
630 Ga0495674_0030329 3300047319 Bacteria 4918
631 Ga0495674_0118444 3300047319 Bacteria 2239
632 Ga0495674_0477049 3300047319 Bacteria 1000
633 Ga0495675_0075209 3300047444 Bacteria 2128
634 Ga0495684_0013849 3300047471 Bacteria 6203
635 Ga0495684_0114333 3300047471 Bacteria 2035
636 Ga0495593_0445614 3300047673 Bacteria 648
637 Ga0495602_0045007 3300048088 Bacteria 3997
638 Ga0495614_0116751 3300048089 Bacteria 1175
639 Ga0496101_0088608 3300048904 Bacteria 2299
640 Ga0496101_0156103 3300048904 Bacteria 1748
641 Ga0496102_0025928 3300048905 Bacteria 5223
642 Ga0496102_0055322 3300048905 Bacteria 3619
643 Ga0496102_0363242 3300048905 Bacteria 1363
644 Ga0496102_0604149 3300048905 Bacteria 1020
645 Ga0496102_0955458 3300048905 Unclassified 778
646 Ga0496102_1291917 3300048905 Unclassified 649
647 Ga0496104_0098432 3300048907 Bacteria 2800
648 Ga0496104_0213138 3300048907 Bacteria 1843
649 Ga0496104_0521602 3300048907 Bacteria 1099
650 Ga0496104_1001439 3300048907 Bacteria 740
651 Ga0496105_0070186 3300048908 Bacteria 2896
652 Ga0496105_0180704 3300048908 Bacteria 1728
653 Ga0496105_0532756 3300048908 Bacteria 919
654 Ga0496106_0070911 3300048909 Bacteria 2662
655 Ga0496106_0169286 3300048909 Bacteria 1731
656 Ga0496107_0061028 3300048910 Bacteria 2730
657 Ga0496108_0328388 3300048911 Bacteria 1334
658 Ga0496108_0379141 3300048911 Bacteria 1235
659 Ga0496108_0582398 3300048911 Bacteria 975
660 Ga0496108_0794450 3300048911 Bacteria 817
661 Ga0496109_0218622 3300048912 Bacteria 1792
662 Ga0496109_0330255 3300048912 Bacteria 1440
663 Ga0496109_0438541 3300048912 Bacteria 1234
664 Ga0496109_0459065 3300048912 Unclassified 1203
665 Ga0496109_1191749 3300048912 Bacteria 698
666 Ga0496109_1271065 3300048912 Bacteria 672
667 Ga0496110_0106074 3300048913 Bacteria 2521
668 Ga0496110_0383849 3300048913 Bacteria 1280
669 Ga0496110_0592710 3300048913 Bacteria 1006
670 Ga0496111_0416226 3300048914 Bacteria 993
671 Ga0496112_0011325 3300048915 Bacteria 8139
672 Ga0496112_0110867 3300048915 Bacteria 2714
673 Ga0496112_0261280 3300048915 Bacteria 1681
674 Ga0496112_0301367 3300048915 Bacteria 1548
675 Ga0496112_0320516 3300048915 Bacteria 1494
676 Ga0496112_0496050 3300048915 Bacteria 1157
677 Ga0496112_1102582 3300048915 Bacteria 712
678 Ga0496113_0663101 3300048916 Bacteria 834
679 Ga0496113_0885213 3300048916 Bacteria 707
680 Ga0496113_0978379 3300048916 Bacteria 667
681 Ga0496114_0011289 3300048917 Bacteria 7133
682 Ga0496114_0088090 3300048917 Bacteria 2633
683 Ga0496114_0254580 3300048917 Bacteria 1545
684 Ga0496114_0758699 3300048917 Bacteria 848
685 Ga0496115_0019789 3300048918 Bacteria 5184
686 Ga0496115_0029343 3300048918 Bacteria 4320
687 Ga0496115_0270008 3300048918 Bacteria 1398
688 Ga0496115_0296522 3300048918 Bacteria 1325
689 Ga0496115_0837142 3300048918 Bacteria 714
690 Ga0501033_0000142 3300049570 Bacteria 69767
691 Ga0501038_0006514 3300049574 Bacteria 10805
692 Ga0501080_0006036 3300049742 Bacteria 10854
693 nmdc:mga05p37_759928_c1 3300050507 Bacteria 770
694 nmdc:mga08y16_339844_c1 3300050511 Bacteria 1543
695 nmdc:mga0n895_140263_c1 3300050512 Bacteria 2445
696 nmdc:mga0n895_149373_c1 3300050512 Bacteria 2366
697 nmdc:mga0n895_600049_c1 3300050512 Bacteria 1103
698 nmdc:mga0n895_70416_c1 3300050512 Bacteria 3466
699 nmdc:mga0rr50_167589_c1 3300050513 Bacteria 1787
700 nmdc:mga08x19_288984_c1 3300050514 Unclassified 1137
701 nmdc:mga08x19_335933_c1 3300050514 Bacteria 1053
702 Ga0495601_0040981 3300053077 Bacteria 2901
703 Ga0495655_0077717 3300053083 Bacteria 942
704 Ga0500566_0273065 3300053094 Bacteria 810
705 Ga0500618_076805 3300053125 Bacteria 749
706 Ga0495598_0145973
707 MBSR1b_contig_1598471
708 CNXas_1000077
709 JGI24737J22298_10070194
710 JGI24743J22301_10000126
711 JGI25406J46586_10000668
712 rootL2_10221030
713 rootH1_10001313
714 Ga0065704_10094005
715 Ga0065712_10007504
716 Ga0065712_10016200
717 Ga0065712_10037352
718 Ga0065712_10135352
719 Ga0065712_10142324
720 Ga0065712_10206013
721 Ga0065715_10002587
722 Ga0065715_10143467
723 Ga0065715_10239545
724 Ga0065715_10607559
725 Ga0065707_10007381
726 Ga0065707_10008423
727 Ga0065707_10028663
728 Ga0070676_10023340
729 Ga0070676_10035224
730 Ga0070676_10244600
731 Ga0070676_10301164
732 Ga0070683_100158531
733 Ga0070683_100220936
734 Ga0070683_100283444
735 Ga0070683_100531934
736 Ga0070690_100087366
737 Ga0070690_100146356
738 Ga0070690_100365284
739 Ga0070670_100025092
740 Ga0070670_100040678
741 Ga0070677_10035817
742 Ga0070677_10201641
743 Ga0068869_100145820
744 Ga0068869_100715295
745 Ga0070666_10004811
746 Ga0070666_10009820
747 Ga0070666_10031595
748 Ga0070666_10234889
749 Ga0070680_100326520
750 Ga0068868_100036155
751 Ga0068868_100070545
752 Ga0068868_100184466
753 Ga0068868_100205402
754 Ga0070660_100016406
755 Ga0070660_100369112
756 Ga0070689_100000681
757 Ga0070689_100011875
758 Ga0070689_100191635
759 Ga0070689_100245110
760 Ga0070689_100466602
761 Ga0070687_100234609
762 Ga0070661_100062160
763 Ga0070661_100408010
764 Ga0070661_100756402
765 Ga0070692_10052787
766 Ga0070668_100008469
767 Ga0070668_100072985
768 Ga0070668_100152038
769 Ga0070668_101382866
770 Ga0070675_100001807
771 Ga0070675_100004314
772 Ga0070675_100048354
773 Ga0070675_100146276
774 Ga0070675_100224036
775 Ga0070675_100370842
776 Ga0070671_100008811
777 Ga0070671_100010700
778 Ga0070671_100053473
779 Ga0070671_100055557
780 Ga0070671_100056235
781 Ga0070671_100057650
782 Ga0070671_100170136
783 Ga0070671_100313163
784 Ga0070671_100324461
785 Ga0070671_100604564
786 Ga0070674_100003293
787 Ga0070674_100025353
788 Ga0070674_100160170
789 Ga0070674_100361826
790 Ga0070674_100399849
791 Ga0070673_100005164
792 Ga0070673_100023903
793 Ga0070673_100064654
794 Ga0070673_100153521
795 Ga0070673_100217534
796 Ga0070673_100310607
797 Ga0070673_101514133
798 Ga0070688_100000809
799 Ga0070688_100011465
800 Ga0070688_100035915
801 Ga0070688_100076926
802 Ga0070688_100108600
803 Ga0070688_100208323
804 Ga0070659_100000778
805 Ga0070667_100008283
806 Ga0070667_100236034
807 Ga0070667_100399555
808 Ga0070703_10027428
809 Ga0070703_10062254
810 Ga0070703_10393347
811 Ga0070709_10129214
812 Ga0070709_10172624
813 Ga0070714_100133170
814 Ga0070714_100168563
815 Ga0070714_100356411
816 Ga0070714_100840440
817 Ga0070713_100141365
818 Ga0070713_100406191
819 Ga0070713_101369686
820 Ga0070710_10036989
821 Ga0070710_10317809
822 Ga0070701_10041669
823 Ga0070711_100008159
824 Ga0070711_100023455
825 Ga0070711_100044234
826 Ga0070705_100003124
827 Ga0070705_100041103
828 Ga0070700_100014411
829 Ga0070700_100131207
830 Ga0070708_100043946
831 Ga0070708_100065485
832 Ga0070708_100069909
833 Ga0070708_100125096
834 Ga0070708_100151575
835 Ga0070708_100190357
836 Ga0070708_100328393
837 Ga0070708_100509815
838 Ga0070708_100634158
839 Ga0070708_100687981
840 Ga0070708_100742281
841 Ga0070663_100148587
842 Ga0070663_100239468
843 Ga0070678_100026260
844 Ga0070678_100389490
845 Ga0070662_100054020
846 Ga0070662_100129943
847 Ga0070662_101071284
848 Ga0070681_10115390
849 Ga0068867_100043670
850 Ga0068867_100141449
851 Ga0070685_10191690
852 Ga0070685_10287627
853 Ga0070685_10482805
854 Ga0070706_100016956
855 Ga0070706_100047159
856 Ga0070706_100047666
857 Ga0070706_100086315
858 Ga0070706_100113141
859 Ga0070706_100134508
860 Ga0070706_100338760
861 Ga0070706_100397421
862 Ga0070706_100467912
863 Ga0070706_100570642
864 Ga0070706_100810384
865 Ga0070706_100842341
866 Ga0070706_101073821
867 Ga0070707_100002533
868 Ga0070707_100005961
869 Ga0070707_100029606
870 Ga0070707_100058577
871 Ga0070707_100152571
872 Ga0070707_100184550
873 Ga0070707_100189784
874 Ga0070707_100199657
875 Ga0070707_100246014
876 Ga0070707_100364498
877 Ga0070698_100001865
878 Ga0070698_100006241
879 Ga0070698_100008773
880 Ga0070698_100022595
881 Ga0070698_100088742
882 Ga0070698_101478651
883 Ga0070699_100030456
884 Ga0070699_100033553
885 Ga0070699_100039183
886 Ga0070699_100061740
887 Ga0070699_100488617
888 Ga0070699_101135131
889 Ga0070679_101058719
890 Ga0070684_100000434
891 Ga0070684_100332548
892 Ga0070684_100726372
893 Ga0070697_100001418
894 Ga0070697_100010497
895 Ga0070697_100014756
896 Ga0070697_100046939
897 Ga0070697_100075116
898 Ga0070697_100078476
899 Ga0070697_100091024
900 Ga0070697_100198268
901 Ga0070697_100234105
902 Ga0070697_100543299
903 Ga0068853_100318545
904 Ga0070672_100066414
905 Ga0070672_100197283
906 Ga0070672_100356348
907 Ga0070686_100295406
908 Ga0070696_100910491
909 Ga0070665_100029142
910 Ga0070665_100033193
911 Ga0070665_100104808
912 Ga0070704_100011886
913 Ga0070664_100111881
914 Ga0070664_100180850
915 Ga0068857_100449885
916 Ga0068857_101187722
917 Ga0068856_100000202
918 Ga0068856_100014369
919 Ga0068859_100105952
920 Ga0068863_100008508
921 Ga0068858_100003405
922 Ga0068860_100041634
923 Ga0068860_101292866
924 Ga0068862_100585004
925 Ga0081455_10065972
926 Ga0081455_10199141
927 Ga0081455_10718119
928 Ga0081455_10771086
929 Ga0081539_10001276
930 Ga0081539_10005500
931 Ga0081539_10064675
932 Ga0070717_10015335
933 Ga0070717_10020822
934 Ga0070717_10049791
935 Ga0070717_10051667
936 Ga0070717_10231767
937 Ga0070717_10468259
938 Ga0070715_10631514
939 Ga0070716_100002802
940 Ga0070716_100441990
941 Ga0070716_101015877
942 Ga0070712_100006716
943 Ga0070712_100015234
944 Ga0070712_100098077
945 Ga0070712_100144246
946 Ga0070712_100210030
947 Ga0070712_100362086
948 Ga0070712_100452309
949 Ga0070712_100531079
950 Ga0070712_100691365
951 Ga0070712_100998017
952 Ga0070712_101128731
953 Ga0097621_100032156
954 Ga0097621_100069722
955 Ga0097621_100079767
956 Ga0097621_100435728
957 Ga0068871_100045278
958 Ga0068871_100053237
959 Ga0068871_100061929
960 Ga0068871_100320958
961 Ga0075428_100484277
962 Ga0075428_101103373
963 Ga0075434_100103674
964 Ga0075434_100225497
965 Ga0075434_100756385
966 Ga0075436_100228631
967 Ga0075436_100385362
968 Ga0075436_101255286
969 Ga0097620_100105947
970 Ga0075435_100074542
971 Ga0075435_100654823
972 Ga0075435_100801720
973 Ga0111539_10695873
974 Ga0105245_10218308
975 Ga0105245_11734722
976 Ga0105247_10187628
977 Ga0105247_10271522
978 Ga0105247_10375706
979 Ga0114129_10851763
980 Ga0114129_11715946
981 Ga0105243_10661290
982 Ga0105241_10788837
983 Ga0105242_10207641
984 Ga0105242_10422117
985 Ga0105242_10460408
986 Ga0105242_10492245
987 Ga0105248_10102829
988 Ga0105237_10436376
989 Ga0105249_10004358
990 Ga0105249_10558600
991 Ga0099796_10007844
992 Ga0105239_10057908
993 Ga0105239_10980468
994 Ga0105246_10336629
995 Ga0157371_10026798
996 Ga0157371_10128969
997 Ga0157370_10071791
998 Ga0157369_10737645
999 Ga0157374_10000209
1000 Ga0157374_10020719
1001 Ga0157374_10137845
1002 Ga0157374_10160475
1003 Ga0157374_10168848
1004 Ga0157374_10346742
1005 Ga0157374_11418355
1006 Ga0157374_11451412
1007 Ga0157378_10052389
1008 Ga0157378_10056206
1009 Ga0157378_10060124
1010 Ga0157378_10064954
1011 Ga0157378_10102640
1012 Ga0157378_10142501
1013 Ga0157378_10193044
1014 Ga0157378_10203459
1015 Ga0157378_10205221
1016 Ga0157378_10420621
1017 Ga0157378_10760944
1018 Ga0157378_11245303
1019 Ga0157378_12448190
1020 Ga0163162_10048816
1021 Ga0163162_10057229
1022 Ga0163162_10138556
1023 Ga0163162_10147690
1024 Ga0163162_10544836
1025 Ga0163162_11464257
1026 Ga0157372_10133664
1027 Ga0157372_10396758
1028 Ga0157372_10517908
1029 Ga0157372_11035818
1030 Ga0157375_10010665
1031 Ga0157375_10021399
1032 Ga0157375_10022023
1033 Ga0157375_10042560
1034 Ga0157375_10164501
1035 Ga0157375_10391151
1036 Ga0157375_10406677
1037 Ga0163163_10398542
1038 Ga0157377_10018266
1039 Ga0157377_10079067
1040 Ga0157379_10004731
1041 Ga0157379_11541403
1042 Ga0157376_10007137
1043 Ga0157376_10062856
1044 Ga0157376_10085437
1045 Ga0157376_10131069
1046 Ga0157376_10170687
1047 Ga0157376_10229226
1048 Ga0157376_10341665
1049 Ga0182006_1235967
1050 Ga0163161_10556802
1051 Ga0213873_10038227
1052 Ga0213872_10041513
1053 Ga0213876_10006162
1054 Ga0213876_10010903
1055 Ga0213871_10031657
1056 Ga0207666_1000389
1057 Ga0207666_1009500
1058 Ga0207697_10000288
1059 Ga0207697_10001879
1060 Ga0207697_10003754
1061 Ga0207697_10005036
1062 Ga0207697_10066686
1063 Ga0207697_10100666
1064 Ga0207697_10116022
1065 Ga0207697_10128108
1066 Ga0207697_10129513
1067 Ga0207697_10328563
1068 Ga0207653_10014789
1069 Ga0207692_10088658
1070 Ga0207692_10694504
1071 Ga0207642_10076790
1072 Ga0207688_10041644
1073 Ga0207688_10053822
1074 Ga0207680_10009936
1075 Ga0207680_10058534
1076 Ga0207680_10063036
1077 Ga0207647_10002631
1078 Ga0207685_10005447
1079 Ga0207685_10299544
1080 Ga0207699_10494088
1081 Ga0207645_10002820
1082 Ga0207645_10417962
1083 Ga0207705_10499784
1084 Ga0207705_10608948
1085 Ga0207684_10000028
1086 Ga0207684_10016318
1087 Ga0207684_10018458
1088 Ga0207684_10024499
1089 Ga0207684_10074261
1090 Ga0207684_10100734
1091 Ga0207684_10148310
1092 Ga0207684_10181217
1093 Ga0207684_10400672
1094 Ga0207684_10466636
1095 Ga0207654_10791883
1096 Ga0207693_10000682
1097 Ga0207693_10027730
1098 Ga0207693_10106103
1099 Ga0207693_10167003
1100 Ga0207693_10213708
1101 Ga0207693_10463014
1102 Ga0207693_10687172
1103 Ga0207663_10076806
1104 Ga0207663_10090664
1105 Ga0207663_10227583
1106 Ga0207660_10042654
1107 Ga0207662_10022356
1108 Ga0207657_10022945
1109 Ga0207649_10620948
1110 Ga0207652_10227154
1111 Ga0207646_10000794
1112 Ga0207646_10014890
1113 Ga0207646_10216117
1114 Ga0207646_10258162
1115 Ga0207646_10297483
1116 Ga0207646_10422382
1117 Ga0207646_10455603
1118 Ga0207681_10100437
1119 Ga0207681_10196526
1120 Ga0207650_10050103
1121 Ga0207650_10060354
1122 Ga0207650_10196723
1123 Ga0207650_10295999
1124 Ga0207650_11575927
1125 Ga0207659_10001123
1126 Ga0207659_10012288
1127 Ga0207659_10051393
1128 Ga0207659_10074555
1129 Ga0207659_10114406
1130 Ga0207659_10139217
1131 Ga0207659_10184425
1132 Ga0207659_11403269
1133 Ga0207687_10334469
1134 Ga0207687_10667757
1135 Ga0207700_10161514
1136 Ga0207700_10167724
1137 Ga0207700_10304300
1138 Ga0207700_10386566
1139 Ga0207700_11466653
1140 Ga0207664_10199897
1141 Ga0207664_10334301
1142 Ga0207664_10572700
1143 Ga0207644_10002120
1144 Ga0207644_10092998
1145 Ga0207644_10095316
1146 Ga0207644_10099031
1147 Ga0207644_10146843
1148 Ga0207644_10286674
1149 Ga0207644_10316391
1150 Ga0207644_10342121
1151 Ga0207644_10527411
1152 Ga0207644_10545465
1153 Ga0207690_10000727
1154 Ga0207690_10661755
1155 Ga0207690_10926758
1156 Ga0207706_10014796
1157 Ga0207706_10029125
1158 Ga0207706_10072565
1159 Ga0207706_10861042
1160 Ga0207709_10255352
1161 Ga0207670_10003010
1162 Ga0207670_10020024
1163 Ga0207670_10435845
1164 Ga0207669_10007994
1165 Ga0207669_10024744
1166 Ga0207669_10377947
1167 Ga0207704_10095046
1168 Ga0207665_10002886
1169 Ga0207665_10093457
1170 Ga0207665_10202904
1171 Ga0207665_11410490
1172 Ga0207691_10006461
1173 Ga0207691_10225932
1174 Ga0207691_10235533
1175 Ga0207691_10630507
1176 Ga0207691_10927648
1177 Ga0207711_10217868
1178 Ga0207689_10060203
1179 Ga0207661_10118371
1180 Ga0207661_10130923
1181 Ga0207679_10062867
1182 Ga0207679_10510813
1183 Ga0207651_10041307
1184 Ga0207651_10102646
1185 Ga0207651_10263387
1186 Ga0207651_11596781
1187 Ga0207712_10017171
1188 Ga0207668_10275472
1189 Ga0207668_10386550
1190 Ga0207658_10202814
1191 Ga0207658_10458764
1192 Ga0207658_10818041
1193 Ga0207677_10076933
1194 Ga0207677_10201451
1195 Ga0207677_10232017
1196 Ga0207677_10281520
1197 Ga0207703_10027166
1198 Ga0207703_10743238
1199 Ga0207639_11134360
1200 Ga0207639_11592023
1201 Ga0207678_10190743
1202 Ga0207708_10023984
1203 Ga0207708_10146029
1204 Ga0207702_10003769
1205 Ga0207702_10064440
1206 Ga0207702_11416056
1207 Ga0207641_10016661
1208 Ga0207641_10736192
1209 Ga0207641_11029185
1210 Ga0207648_10025222
1211 Ga0207676_11652393
1212 Ga0207676_11733781
1213 Ga0207683_10007165
1214 Ga0207683_10017323
1215 Ga0207683_10040999
1216 Ga0207683_10565804
1217 Ga0268266_10023922
1218 Ga0268266_10151494
1219 Ga0268266_10322090
1220 Ga0268266_10463197
1221 Ga0268266_10490677
1222 Ga0268265_10243743
1223 Ga0268264_10065686
1224 Ga0265331_10176727
1225 Ga0307513_10175031
1226 Ga0307410_10743433
1227 Ga0373926_0035768
1228 Ga0373934_0076891
1229 Ga0373923_0313558
1230 Ga0373936_0284094
1231 Ga0373945_0131440
1232 Ga0373943_0041449
1233 Ga0373943_0050141
1234 Ga0373943_0221154
1235 Ga0373955_0051266
1236 Ga0373955_0134422
1237 Ga0373955_0248575
1238 Ga0373931_0015248
1239 Ga0373931_0224620
1240 Ga0373935_0007503
1241 Ga0373935_0076888
1242 Ga0373927_0265587
1243 Ga0373933_0479391
1244 Ga0373933_0737191
1245 Ga0373947_0072400
1246 Ga0373947_0173409
1247 Ga0373947_0227953
1248 Ga0373937_0452044
1249 Ga0373925_0540344
1250 Ga0373925_0653239
1251 Ga0395899_0000148
1252 Ga0395899_0048950
1253 Ga0395900_0018935
1254 Ga0395900_0292221
1255 Ga0395898_0005604
1256 Ga0395898_0123828
1257 Ga0395905_1395651
1258 Ga0436364_0038505
1259 Ga0436364_0918711
1260 Ga0395901_0000757
1261 Ga0395901_0352764
1262 Ga0395901_0466038
1263 Ga0395901_0903445
1264 Ga0436365_0291627
1265 Ga0436365_0542149
1266 Ga0436365_0836133
1267 Ga0436365_0949032
1268 Ga0436365_1840798
1269 Ga0436360_0540386
1270 Ga0436360_0738046
1271 Ga0436361_0144833
1272 Ga0436361_0416595
1273 Ga0436361_0655048
1274 Ga0436362_0076865
1275 Ga0436362_0273225
1276 Ga0436362_1302472
1277 Ga0451800_1123943
1278 Ga0451833_0883708
1279 Ga0451839_0634602
1280 Ga0439448_0057112
1281 Ga0439455_0004552
1282 Ga0439455_0054340
1283 Ga0439460_0064909
1284 Ga0439440_0145226
1285 Ga0466964_0043560
1286 Ga0495617_102486
1287 Ga0495592_0007083
1288 Ga0495629_0113854
1289 Ga0495641_0145026
1290 Ga0495651_0183041
1291 Ga0495653_0083015
1292 Ga0495653_0266624
1293 Ga0495582_0459844
1294 Ga0495639_0037429
1295 Ga0495662_0256716
1296 Ga0495584_0189714
1297 Ga0495594_0226616
1298 Ga0495618_0074219
1299 Ga0495618_0110756
1300 Ga0495618_0349816
1301 Ga0495628_0016468
1302 Ga0495628_0334975
1303 Ga0495630_0364791
1304 Ga0495630_0545834
1305 Ga0495652_0026455
1306 Ga0495640_0379371
1307 Ga0495640_0389714
1308 Ga0495586_0074060
1309 Ga0495587_0049280
1310 Ga0495598_0000913
1311 Ga0495609_0076943
1312 Ga0495645_0096733
1313 Ga0495645_0482238
1314 Ga0495656_0518127
1315 Ga0495668_0667511
1316 Ga0495634_0100581
1317 Ga0495634_0130586
1318 Ga0495634_0164226
1319 Ga0495659_0007373
1320 Ga0495659_0102758
1321 Ga0495657_0161971
1322 Ga0495599_0001566
1323 Ga0495623_0014241
1324 Ga0495646_0003926
1325 Ga0495658_0010304
1326 Ga0495658_0160691
1327 Ga0495669_0180272
1328 Ga0495669_0300454
1329 Ga0495613_0768086
1330 Ga0495624_0041505
1331 Ga0495624_0164622
1332 Ga0495600_0583230
1333 Ga0495581_0162719
1334 Ga0495604_0039275
1335 Ga0495674_0030329
1336 Ga0495674_0118444
1337 Ga0495674_0477049
1338 Ga0495675_0075209
1339 Ga0495684_0013849
1340 Ga0495684_0114333
1341 Ga0495593_0445614
1342 Ga0495602_0045007
1343 Ga0495614_0116751
1344 Ga0496101_0088608
1345 Ga0496101_0156103
1346 Ga0496102_0025928
1347 Ga0496102_0055322
1348 Ga0496102_0363242
1349 Ga0496102_0604149
1350 Ga0496102_0955458
1351 Ga0496102_1291917
1352 Ga0496104_0098432
1353 Ga0496104_0213138
1354 Ga0496104_0521602
1355 Ga0496104_1001439
1356 Ga0496105_0070186
1357 Ga0496105_0180704
1358 Ga0496105_0532756
1359 Ga0496106_0070911
1360 Ga0496106_0169286
1361 Ga0496107_0061028
1362 Ga0496108_0328388
1363 Ga0496108_0379141
1364 Ga0496108_0582398
1365 Ga0496108_0794450
1366 Ga0496109_0218622
1367 Ga0496109_0330255
1368 Ga0496109_0438541
1369 Ga0496109_0459065
1370 Ga0496109_1191749
1371 Ga0496109_1271065
1372 Ga0496110_0106074
1373 Ga0496110_0383849
1374 Ga0496110_0592710
1375 Ga0496111_0416226
1376 Ga0496112_0011325
1377 Ga0496112_0110867
1378 Ga0496112_0261280
1379 Ga0496112_0301367
1380 Ga0496112_0320516
1381 Ga0496112_0496050
1382 Ga0496112_1102582
1383 Ga0496113_0663101
1384 Ga0496113_0885213
1385 Ga0496113_0978379
1386 Ga0496114_0011289
1387 Ga0496114_0088090
1388 Ga0496114_0254580
1389 Ga0496114_0758699
1390 Ga0496115_0019789
1391 Ga0496115_0029343
1392 Ga0496115_0270008
1393 Ga0496115_0296522
1394 Ga0496115_0837142
1395 Ga0501033_0000142
1396 Ga0501038_0006514
1397 Ga0501080_0006036
1398 nmdc:mga05p37_759928_c1
1399 nmdc:mga08y16_339844_c1
1400 nmdc:mga0n895_140263_c1
1401 nmdc:mga0n895_149373_c1
1402 nmdc:mga0n895_600049_c1
1403 nmdc:mga0n895_70416_c1
1404 nmdc:mga0rr50_167589_c1
1405 nmdc:mga08x19_288984_c1
1406 nmdc:mga08x19_335933_c1
1407 Ga0495601_0040981
1408 Ga0495655_0077717
1409 Ga0500566_0273065
1410 Ga0500618_076805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

44

186

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uuy-assembly1.cif.gz_A structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism 0.9522 17 167
1o8o-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9502 17 167
1o8q-assembly1.cif.gz_A the active site of the molybdenum cofactor biosenthetic protein domain cnx1g 0.9502 17 167
1eav-assembly2.cif.gz_E crystal structures of human gephyrin and plant cnx1 g domains - comparative analysis and functional implications 0.9502 17 166
1o8n-assembly1.cif.gz_C the active site of the molybdenum cofactor biosynthetic protein domain cnx1g 0.9486 17 168
ID Description Score Start End Superfamily
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9486 17 168 3.40.980.10
af_O53897_20_180_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9285 18 168 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9245 9 169 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9227 15 169 3.40.980.10
4lhbC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.912 16 168 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A2V5KDY3-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9912 16 159 GO:0006777
AF-A0A2V6JBX5-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.989 16 174 GO:0006777
AF-A0A382HIS5-F1-model_v4 MoaB/Mog domain-containing protein 0.9852 41 174 GO:0006777
AF-A0A2V5KDY3-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9777 16 159 GO:0006777
AF-A0A3C0R1L6-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9768 16 139 GO:0006777

Map