F476413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 267 | 1410 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0027625|Ga0395900_0027625_4214_4894 |
| Length | 226 |
| Sequence | VADFFHLPDWAGPVARYMLHTGLPGTLRIAVFAVLGAALVGMVLGTLMTVRFEPVRWLIRLYIEVWRGLPIIVTIFILYFALPDLHVRMSAFNAATLGLILWGSAQVAEATRGAIQSVPREQHEAAAALGFGWVGTQVNVIFPQAFRRLLPPLVSLLVNVIQNTTIAALIGVSEVLQSGQRSVERLQFVPPGNSHAFEIYGAVLVMFFVISFPLTRLAAYLEKRLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 176 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 179 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 180 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 181 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 182 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 183 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 184 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 185 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 186 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 187 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 207 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 208 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 209 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 210 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 211 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 213 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 214 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 215 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 216 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 217 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 252 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 4.11 |
| Rhizosphere | 95.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395900_0027625 | 3300037418 | Bacteria | 5813 |
| 2 | JGI24743J22301_10048364 | 3300001991 | Bacteria | 863 |
| 3 | JGI24738J21930_10007013 | 3300002075 | Bacteria | 2618 |
| 4 | Ga0070658_10014552 | 3300005327 | Bacteria | 6314 |
| 5 | Ga0070683_100030326 | 3300005329 | Bacteria | 4907 |
| 6 | Ga0070683_100105303 | 3300005329 | Unclassified | 2659 |
| 7 | Ga0070683_100214150 | 3300005329 | Bacteria | 1830 |
| 8 | Ga0070690_100139104 | 3300005330 | Bacteria | 1647 |
| 9 | Ga0070670_100538741 | 3300005331 | Bacteria | 1041 |
| 10 | Ga0068869_100252251 | 3300005334 | Bacteria | 1410 |
| 11 | Ga0068869_100265028 | 3300005334 | Bacteria | 1376 |
| 12 | Ga0068869_100338183 | 3300005334 | Bacteria | 1224 |
| 13 | Ga0070666_10214050 | 3300005335 | Bacteria | 1358 |
| 14 | Ga0070680_100123408 | 3300005336 | Bacteria | 2163 |
| 15 | Ga0070682_100430250 | 3300005337 | Bacteria | 1005 |
| 16 | Ga0068868_100253424 | 3300005338 | Unclassified | 1482 |
| 17 | Ga0068868_100262957 | 3300005338 | Bacteria | 1456 |
| 18 | Ga0070660_100074437 | 3300005339 | Bacteria | 2657 |
| 19 | Ga0070689_100062289 | 3300005340 | Bacteria | 2902 |
| 20 | Ga0070689_100111475 | 3300005340 | Bacteria | 2176 |
| 21 | Ga0070661_100033838 | 3300005344 | Bacteria | 3704 |
| 22 | Ga0070661_100291093 | 3300005344 | Bacteria | 1269 |
| 23 | Ga0070692_10022650 | 3300005345 | Unclassified | 3070 |
| 24 | Ga0070692_10096548 | 3300005345 | Bacteria | 1614 |
| 25 | Ga0070692_10183089 | 3300005345 | Bacteria | 1215 |
| 26 | Ga0070668_100303001 | 3300005347 | Bacteria | 1341 |
| 27 | Ga0070669_100296296 | 3300005353 | Bacteria | 1300 |
| 28 | Ga0070675_100050447 | 3300005354 | Unclassified | 3416 |
| 29 | Ga0070675_100101673 | 3300005354 | Bacteria | 2422 |
| 30 | Ga0070675_100104384 | 3300005354 | Bacteria | 2391 |
| 31 | Ga0070675_100132329 | 3300005354 | Bacteria | 2126 |
| 32 | Ga0070675_100248494 | 3300005354 | Bacteria | 1556 |
| 33 | Ga0070675_100322583 | 3300005354 | Bacteria | 1365 |
| 34 | Ga0070671_100048938 | 3300005355 | Bacteria | 3517 |
| 35 | Ga0070671_100111102 | 3300005355 | Bacteria | 2302 |
| 36 | Ga0070671_100353299 | 3300005355 | Bacteria | 1255 |
| 37 | Ga0070674_100030030 | 3300005356 | Bacteria | 3588 |
| 38 | Ga0070674_100050159 | 3300005356 | Bacteria | 2873 |
| 39 | Ga0070674_100059972 | 3300005356 | Bacteria | 2650 |
| 40 | Ga0070674_100281708 | 3300005356 | Unclassified | 1318 |
| 41 | Ga0070674_100407407 | 3300005356 | Bacteria | 1112 |
| 42 | Ga0070673_100039231 | 3300005364 | Bacteria | 3622 |
| 43 | Ga0070673_100198579 | 3300005364 | Bacteria | 1727 |
| 44 | Ga0070688_100036085 | 3300005365 | Bacteria | 3005 |
| 45 | Ga0070688_100089827 | 3300005365 | Bacteria | 2005 |
| 46 | Ga0070659_100071734 | 3300005366 | Bacteria | 2754 |
| 47 | Ga0070659_100374455 | 3300005366 | Bacteria | 1198 |
| 48 | Ga0070659_100401753 | 3300005366 | Bacteria | 1157 |
| 49 | Ga0070667_100283509 | 3300005367 | Bacteria | 1488 |
| 50 | Ga0070703_10153159 | 3300005406 | Bacteria | 868 |
| 51 | Ga0070714_100460514 | 3300005435 | Bacteria | 1209 |
| 52 | Ga0070701_10042963 | 3300005438 | Bacteria | 2310 |
| 53 | Ga0070701_10190687 | 3300005438 | Bacteria | 1206 |
| 54 | Ga0070701_10439882 | 3300005438 | Bacteria | 835 |
| 55 | Ga0070711_100181434 | 3300005439 | Bacteria | 1612 |
| 56 | Ga0070705_100084770 | 3300005440 | Bacteria | 1956 |
| 57 | Ga0070700_100015707 | 3300005441 | Bacteria | 4299 |
| 58 | Ga0070700_100042746 | 3300005441 | Bacteria | 2784 |
| 59 | Ga0070694_100662394 | 3300005444 | Bacteria | 846 |
| 60 | Ga0070708_100030728 | 3300005445 | Bacteria | 4644 |
| 61 | Ga0070663_100249067 | 3300005455 | Bacteria | 1405 |
| 62 | Ga0070678_100025390 | 3300005456 | Bacteria | 3985 |
| 63 | Ga0070678_100145655 | 3300005456 | Bacteria | 1901 |
| 64 | Ga0070678_100277516 | 3300005456 | Bacteria | 1416 |
| 65 | Ga0070678_100338090 | 3300005456 | Bacteria | 1291 |
| 66 | Ga0070662_100059385 | 3300005457 | Bacteria | 2786 |
| 67 | Ga0070662_100312888 | 3300005457 | Bacteria | 1279 |
| 68 | Ga0070662_100315041 | 3300005457 | Bacteria | 1274 |
| 69 | Ga0070681_10036083 | 3300005458 | Bacteria | 4966 |
| 70 | Ga0070681_10118500 | 3300005458 | Bacteria | 2584 |
| 71 | Ga0068867_100062420 | 3300005459 | Bacteria | 2768 |
| 72 | Ga0068867_100215746 | 3300005459 | Bacteria | 1543 |
| 73 | Ga0068867_100936208 | 3300005459 | Bacteria | 782 |
| 74 | Ga0070685_10152277 | 3300005466 | Bacteria | 1466 |
| 75 | Ga0070706_100548974 | 3300005467 | Bacteria | 1075 |
| 76 | Ga0070698_100165233 | 3300005471 | Bacteria | 2156 |
| 77 | Ga0070699_100057094 | 3300005518 | Bacteria | 3381 |
| 78 | Ga0070679_100002810 | 3300005530 | Bacteria | 15819 |
| 79 | Ga0070679_100311215 | 3300005530 | Bacteria | 1525 |
| 80 | Ga0070684_100001001 | 3300005535 | Bacteria | 20112 |
| 81 | Ga0070684_100086582 | 3300005535 | Bacteria | 2780 |
| 82 | Ga0070684_100089423 | 3300005535 | Bacteria | 2737 |
| 83 | Ga0070684_100143229 | 3300005535 | Unclassified | 2162 |
| 84 | Ga0070684_100272546 | 3300005535 | Bacteria | 1549 |
| 85 | Ga0070697_100821624 | 3300005536 | Bacteria | 823 |
| 86 | Ga0068853_100040586 | 3300005539 | Bacteria | 3971 |
| 87 | Ga0070672_100078785 | 3300005543 | Bacteria | 2636 |
| 88 | Ga0070672_100103769 | 3300005543 | Bacteria | 2309 |
| 89 | Ga0070686_100059129 | 3300005544 | Bacteria | 2468 |
| 90 | Ga0070686_100070653 | 3300005544 | Bacteria | 2284 |
| 91 | Ga0070686_100208275 | 3300005544 | Bacteria | 1406 |
| 92 | Ga0070695_100341999 | 3300005545 | Bacteria | 1118 |
| 93 | Ga0070696_100408586 | 3300005546 | Bacteria | 1064 |
| 94 | Ga0070696_100571954 | 3300005546 | Bacteria | 908 |
| 95 | Ga0070693_100002648 | 3300005547 | Bacteria | 8244 |
| 96 | Ga0070693_100381266 | 3300005547 | Bacteria | 973 |
| 97 | Ga0070665_100061791 | 3300005548 | Bacteria | 3755 |
| 98 | Ga0070665_100272407 | 3300005548 | Bacteria | 1695 |
| 99 | Ga0070665_100635100 | 3300005548 | Bacteria | 1081 |
| 100 | Ga0070704_100203563 | 3300005549 | Bacteria | 1600 |
| 101 | Ga0068855_100120961 | 3300005563 | Bacteria | 2996 |
| 102 | Ga0068855_100514263 | 3300005563 | Bacteria | 1300 |
| 103 | Ga0070664_100081999 | 3300005564 | Unclassified | 2780 |
| 104 | Ga0070664_100265488 | 3300005564 | Bacteria | 1545 |
| 105 | Ga0070664_100455141 | 3300005564 | Bacteria | 1175 |
| 106 | Ga0070664_100734637 | 3300005564 | Unclassified | 921 |
| 107 | Ga0068854_100068446 | 3300005578 | Bacteria | 2589 |
| 108 | Ga0068854_100068936 | 3300005578 | Unclassified | 2580 |
| 109 | Ga0068854_100157985 | 3300005578 | Bacteria | 1754 |
| 110 | Ga0068854_100599098 | 3300005578 | Bacteria | 941 |
| 111 | Ga0068856_100022134 | 3300005614 | Bacteria | 6180 |
| 112 | Ga0068856_100655765 | 3300005614 | Bacteria | 1070 |
| 113 | Ga0070702_100078783 | 3300005615 | Bacteria | 1968 |
| 114 | Ga0070702_100328558 | 3300005615 | Bacteria | 1068 |
| 115 | Ga0068852_100044266 | 3300005616 | Bacteria | 3779 |
| 116 | Ga0068852_100698048 | 3300005616 | Bacteria | 1025 |
| 117 | Ga0068859_101148816 | 3300005617 | Bacteria | 855 |
| 118 | Ga0068864_100010668 | 3300005618 | Bacteria | 7595 |
| 119 | Ga0068864_100139626 | 3300005618 | Bacteria | 2185 |
| 120 | Ga0068866_10045660 | 3300005718 | Bacteria | 2199 |
| 121 | Ga0068861_100120831 | 3300005719 | Bacteria | 2113 |
| 122 | Ga0068861_100497312 | 3300005719 | Bacteria | 1102 |
| 123 | Ga0068851_10207547 | 3300005834 | Bacteria | 1096 |
| 124 | Ga0068851_10218550 | 3300005834 | Bacteria | 1070 |
| 125 | Ga0068870_10017694 | 3300005840 | Bacteria | 3428 |
| 126 | Ga0068863_100319115 | 3300005841 | Bacteria | 1509 |
| 127 | Ga0068863_100405395 | 3300005841 | Bacteria | 1334 |
| 128 | Ga0068858_100031474 | 3300005842 | Bacteria | 4927 |
| 129 | Ga0068860_100228134 | 3300005843 | Bacteria | 1809 |
| 130 | Ga0068862_100330968 | 3300005844 | Bacteria | 1408 |
| 131 | Ga0068862_100335245 | 3300005844 | Bacteria | 1400 |
| 132 | Ga0081455_10001861 | 3300005937 | Bacteria | 25391 |
| 133 | Ga0081455_10034264 | 3300005937 | Bacteria | 4552 |
| 134 | Ga0081455_10036893 | 3300005937 | Bacteria | 4346 |
| 135 | Ga0081455_10046668 | 3300005937 | Bacteria | 3756 |
| 136 | Ga0081455_10204763 | 3300005937 | Bacteria | 1475 |
| 137 | Ga0081455_10380441 | 3300005937 | Bacteria | 986 |
| 138 | Ga0081455_10462538 | 3300005937 | Bacteria | 863 |
| 139 | Ga0081539_10001335 | 3300005985 | Bacteria | 42960 |
| 140 | Ga0081539_10139239 | 3300005985 | Bacteria | 1181 |
| 141 | Ga0075365_10044653 | 3300006038 | Unclassified | 2905 |
| 142 | Ga0075432_10004132 | 3300006058 | Bacteria | 4953 |
| 143 | Ga0097621_100056538 | 3300006237 | Bacteria | 3206 |
| 144 | Ga0097621_100245042 | 3300006237 | Unclassified | 1568 |
| 145 | Ga0068871_100144363 | 3300006358 | Bacteria | 2025 |
| 146 | Ga0068871_100167649 | 3300006358 | Bacteria | 1881 |
| 147 | Ga0068871_100487270 | 3300006358 | Bacteria | 1110 |
| 148 | Ga0075428_100028279 | 3300006844 | Bacteria | 6201 |
| 149 | Ga0075428_100144090 | 3300006844 | Bacteria | 2590 |
| 150 | Ga0075428_100359630 | 3300006844 | Bacteria | 1562 |
| 151 | Ga0075428_100682445 | 3300006844 | Bacteria | 1095 |
| 152 | Ga0075430_100644725 | 3300006846 | Bacteria | 873 |
| 153 | Ga0075431_100006254 | 3300006847 | Bacteria | 11832 |
| 154 | Ga0075431_100041551 | 3300006847 | Bacteria | 4741 |
| 155 | Ga0075431_100292724 | 3300006847 | Bacteria | 1646 |
| 156 | Ga0075433_10045622 | 3300006852 | Bacteria | 3810 |
| 157 | Ga0075433_10149203 | 3300006852 | Bacteria | 2079 |
| 158 | Ga0075434_100400816 | 3300006871 | Bacteria | 1393 |
| 159 | Ga0075429_100038392 | 3300006880 | Bacteria | 4168 |
| 160 | Ga0075429_100043419 | 3300006880 | Bacteria | 3912 |
| 161 | Ga0068865_100024294 | 3300006881 | Bacteria | 3974 |
| 162 | Ga0068865_100147614 | 3300006881 | Bacteria | 1780 |
| 163 | Ga0075436_100019331 | 3300006914 | Bacteria | 4669 |
| 164 | Ga0097620_101148696 | 3300006931 | Bacteria | 855 |
| 165 | Ga0111539_10060383 | 3300009094 | Bacteria | 4493 |
| 166 | Ga0111539_10073822 | 3300009094 | Bacteria | 4021 |
| 167 | Ga0111539_10200581 | 3300009094 | Unclassified | 2327 |
| 168 | Ga0111539_10210949 | 3300009094 | Bacteria | 2263 |
| 169 | Ga0111539_10261331 | 3300009094 | Bacteria | 2015 |
| 170 | Ga0111539_11365623 | 3300009094 | Unclassified | 822 |
| 171 | Ga0105245_10045161 | 3300009098 | Bacteria | 3934 |
| 172 | Ga0105245_10047827 | 3300009098 | Bacteria | 3825 |
| 173 | Ga0105245_10231403 | 3300009098 | Bacteria | 1788 |
| 174 | Ga0105245_10235222 | 3300009098 | Bacteria | 1773 |
| 175 | Ga0105245_10266091 | 3300009098 | Bacteria | 1670 |
| 176 | Ga0105245_10328797 | 3300009098 | Bacteria | 1508 |
| 177 | Ga0105245_11029712 | 3300009098 | Bacteria | 868 |
| 178 | Ga0105247_10051620 | 3300009101 | Bacteria | 2533 |
| 179 | Ga0114129_10085229 | 3300009147 | Bacteria | 4383 |
| 180 | Ga0114129_10090048 | 3300009147 | Bacteria | 4253 |
| 181 | Ga0114129_10290134 | 3300009147 | Bacteria | 2183 |
| 182 | Ga0114129_10767583 | 3300009147 | Unclassified | 1233 |
| 183 | Ga0114129_10829694 | 3300009147 | Unclassified | 1177 |
| 184 | Ga0105243_10032600 | 3300009148 | Bacteria | 4026 |
| 185 | Ga0105243_10070969 | 3300009148 | Bacteria | 2815 |
| 186 | Ga0105243_10202073 | 3300009148 | Bacteria | 1743 |
| 187 | Ga0105243_10364113 | 3300009148 | Bacteria | 1332 |
| 188 | Ga0105243_10404113 | 3300009148 | Bacteria | 1270 |
| 189 | Ga0105243_10621653 | 3300009148 | Bacteria | 1043 |
| 190 | Ga0105243_11277198 | 3300009148 | Unclassified | 750 |
| 191 | Ga0105241_10083061 | 3300009174 | Bacteria | 2512 |
| 192 | Ga0105242_10056351 | 3300009176 | Bacteria | 3216 |
| 193 | Ga0105242_10079642 | 3300009176 | Bacteria | 2736 |
| 194 | Ga0105242_10346173 | 3300009176 | Bacteria | 1371 |
| 195 | Ga0105242_10459762 | 3300009176 | Unclassified | 1202 |
| 196 | Ga0105242_10540647 | 3300009176 | Bacteria | 1115 |
| 197 | Ga0105248_10059033 | 3300009177 | Bacteria | 4309 |
| 198 | Ga0105248_10772830 | 3300009177 | Bacteria | 1084 |
| 199 | Ga0105248_10903844 | 3300009177 | Unclassified | 997 |
| 200 | Ga0105238_10097055 | 3300009551 | Bacteria | 2933 |
| 201 | Ga0105238_10176567 | 3300009551 | Bacteria | 2113 |
| 202 | Ga0105238_10307207 | 3300009551 | Bacteria | 1570 |
| 203 | Ga0105249_10189391 | 3300009553 | Bacteria | 2007 |
| 204 | Ga0105249_10196626 | 3300009553 | Bacteria | 1971 |
| 205 | Ga0105239_10006421 | 3300010375 | Bacteria | 13645 |
| 206 | Ga0105239_10213106 | 3300010375 | Bacteria | 2165 |
| 207 | Ga0105239_10965761 | 3300010375 | Bacteria | 979 |
| 208 | Ga0105246_10021900 | 3300011119 | Bacteria | 4120 |
| 209 | Ga0105246_10086556 | 3300011119 | Bacteria | 2247 |
| 210 | Ga0105246_10126267 | 3300011119 | Bacteria | 1903 |
| 211 | Ga0105246_10339463 | 3300011119 | Unclassified | 1227 |
| 212 | Ga0157371_10054594 | 3300013102 | Unclassified | 2837 |
| 213 | Ga0157371_10255448 | 3300013102 | Unclassified | 1263 |
| 214 | Ga0157378_10276171 | 3300013297 | Bacteria | 1618 |
| 215 | Ga0157378_10279811 | 3300013297 | Bacteria | 1608 |
| 216 | Ga0157378_10309536 | 3300013297 | Bacteria | 1531 |
| 217 | Ga0163162_10105934 | 3300013306 | Bacteria | 2906 |
| 218 | Ga0163162_10172847 | 3300013306 | Bacteria | 2285 |
| 219 | Ga0163162_10185649 | 3300013306 | Bacteria | 2206 |
| 220 | Ga0157372_10230245 | 3300013307 | Bacteria | 2148 |
| 221 | Ga0157372_10337114 | 3300013307 | Bacteria | 1756 |
| 222 | Ga0157375_10126712 | 3300013308 | Bacteria | 2669 |
| 223 | Ga0157375_10142029 | 3300013308 | Bacteria | 2529 |
| 224 | Ga0157375_10156153 | 3300013308 | Bacteria | 2420 |
| 225 | Ga0157375_10262534 | 3300013308 | Bacteria | 1888 |
| 226 | Ga0157375_10498123 | 3300013308 | Unclassified | 1382 |
| 227 | Ga0157375_10672747 | 3300013308 | Bacteria | 1190 |
| 228 | Ga0163163_10028019 | 3300014325 | Bacteria | 5405 |
| 229 | Ga0163163_10033206 | 3300014325 | Bacteria | 4990 |
| 230 | Ga0163163_10682824 | 3300014325 | Unclassified | 1090 |
| 231 | Ga0157380_10101514 | 3300014326 | Bacteria | 2397 |
| 232 | Ga0157380_10414655 | 3300014326 | Bacteria | 1282 |
| 233 | Ga0157380_10615235 | 3300014326 | Bacteria | 1077 |
| 234 | Ga0157377_10052379 | 3300014745 | Bacteria | 2304 |
| 235 | Ga0157377_10233924 | 3300014745 | Bacteria | 1183 |
| 236 | Ga0157379_10164367 | 3300014968 | Bacteria | 2003 |
| 237 | Ga0157379_10191131 | 3300014968 | Unclassified | 1850 |
| 238 | Ga0157376_10055228 | 3300014969 | Bacteria | 3313 |
| 239 | Ga0157376_10422039 | 3300014969 | Bacteria | 1295 |
| 240 | Ga0157376_10452161 | 3300014969 | Bacteria | 1253 |
| 241 | Ga0157376_10647728 | 3300014969 | Bacteria | 1057 |
| 242 | Ga0163161_10034765 | 3300017792 | Bacteria | 3605 |
| 243 | Ga0207642_10365664 | 3300025899 | Bacteria | 855 |
| 244 | Ga0207710_10044822 | 3300025900 | Bacteria | 1971 |
| 245 | Ga0207688_10007691 | 3300025901 | Bacteria | 5869 |
| 246 | Ga0207688_10026359 | 3300025901 | Bacteria | 3196 |
| 247 | Ga0207688_10043270 | 3300025901 | Bacteria | 2507 |
| 248 | Ga0207645_10033387 | 3300025907 | Bacteria | 3308 |
| 249 | Ga0207643_10009991 | 3300025908 | Bacteria | 5101 |
| 250 | Ga0207643_10054627 | 3300025908 | Unclassified | 2270 |
| 251 | Ga0207643_10102730 | 3300025908 | Bacteria | 1677 |
| 252 | Ga0207684_10410682 | 3300025910 | Bacteria | 1164 |
| 253 | Ga0207707_10070930 | 3300025912 | Bacteria | 3036 |
| 254 | Ga0207707_10587799 | 3300025912 | Bacteria | 943 |
| 255 | Ga0207693_10296657 | 3300025915 | Bacteria | 1266 |
| 256 | Ga0207663_10247214 | 3300025916 | Unclassified | 1311 |
| 257 | Ga0207660_10097822 | 3300025917 | Bacteria | 2188 |
| 258 | Ga0207662_10198230 | 3300025918 | Bacteria | 1298 |
| 259 | Ga0207657_10005767 | 3300025919 | Bacteria | 12912 |
| 260 | Ga0207652_10091740 | 3300025921 | Bacteria | 2671 |
| 261 | Ga0207659_10065165 | 3300025926 | Bacteria | 2639 |
| 262 | Ga0207659_10067506 | 3300025926 | Bacteria | 2598 |
| 263 | Ga0207659_10131737 | 3300025926 | Bacteria | 1931 |
| 264 | Ga0207659_10152138 | 3300025926 | Bacteria | 1808 |
| 265 | Ga0207659_10190862 | 3300025926 | Bacteria | 1630 |
| 266 | Ga0207687_10018548 | 3300025927 | Bacteria | 4596 |
| 267 | Ga0207687_10096847 | 3300025927 | Unclassified | 2163 |
| 268 | Ga0207687_10190056 | 3300025927 | Bacteria | 1597 |
| 269 | Ga0207687_10221833 | 3300025927 | Bacteria | 1489 |
| 270 | Ga0207687_10372083 | 3300025927 | Bacteria | 1169 |
| 271 | Ga0207644_10095645 | 3300025931 | Bacteria | 2222 |
| 272 | Ga0207644_10239232 | 3300025931 | Bacteria | 1445 |
| 273 | Ga0207690_10175690 | 3300025932 | Bacteria | 1608 |
| 274 | Ga0207706_10022764 | 3300025933 | Bacteria | 5624 |
| 275 | Ga0207706_10076375 | 3300025933 | Bacteria | 2946 |
| 276 | Ga0207706_10342136 | 3300025933 | Bacteria | 1301 |
| 277 | Ga0207686_10008053 | 3300025934 | Bacteria | 5686 |
| 278 | Ga0207686_10075825 | 3300025934 | Bacteria | 2178 |
| 279 | Ga0207686_10256030 | 3300025934 | Bacteria | 1281 |
| 280 | Ga0207709_10055713 | 3300025935 | Unclassified | 2444 |
| 281 | Ga0207709_10129303 | 3300025935 | Bacteria | 1719 |
| 282 | Ga0207709_10229450 | 3300025935 | Bacteria | 1344 |
| 283 | Ga0207709_10357606 | 3300025935 | Bacteria | 1104 |
| 284 | Ga0207709_10755456 | 3300025935 | Unclassified | 782 |
| 285 | Ga0207670_10041414 | 3300025936 | Bacteria | 3029 |
| 286 | Ga0207670_10224528 | 3300025936 | Bacteria | 1439 |
| 287 | Ga0207669_10026984 | 3300025937 | Bacteria | 3135 |
| 288 | Ga0207669_10077719 | 3300025937 | Bacteria | 2112 |
| 289 | Ga0207669_10229405 | 3300025937 | Unclassified | 1369 |
| 290 | Ga0207669_10349006 | 3300025937 | Bacteria | 1142 |
| 291 | Ga0207704_10013025 | 3300025938 | Bacteria | 4147 |
| 292 | Ga0207704_10194214 | 3300025938 | Bacteria | 1479 |
| 293 | Ga0207704_10315831 | 3300025938 | Bacteria | 1203 |
| 294 | Ga0207691_10015174 | 3300025940 | Bacteria | 7330 |
| 295 | Ga0207691_10068001 | 3300025940 | Bacteria | 3219 |
| 296 | Ga0207691_10091844 | 3300025940 | Bacteria | 2719 |
| 297 | Ga0207691_10099680 | 3300025940 | Bacteria | 2594 |
| 298 | Ga0207691_10351922 | 3300025940 | Unclassified | 1260 |
| 299 | Ga0207689_10170984 | 3300025942 | Bacteria | 1791 |
| 300 | Ga0207689_10384975 | 3300025942 | Bacteria | 1168 |
| 301 | Ga0207689_10562761 | 3300025942 | Unclassified | 958 |
| 302 | Ga0207661_10006850 | 3300025944 | Bacteria | 8077 |
| 303 | Ga0207661_10159116 | 3300025944 | Bacteria | 1958 |
| 304 | Ga0207679_10077118 | 3300025945 | Bacteria | 2534 |
| 305 | Ga0207679_10405091 | 3300025945 | Unclassified | 1201 |
| 306 | Ga0207667_10618980 | 3300025949 | Bacteria | 1090 |
| 307 | Ga0207667_10673744 | 3300025949 | Unclassified | 1038 |
| 308 | Ga0207651_10439339 | 3300025960 | Bacteria | 1117 |
| 309 | Ga0207712_10114770 | 3300025961 | Bacteria | 2026 |
| 310 | Ga0207668_10045504 | 3300025972 | Bacteria | 2994 |
| 311 | Ga0207668_10526862 | 3300025972 | Bacteria | 1020 |
| 312 | Ga0207640_10267676 | 3300025981 | Bacteria | 1335 |
| 313 | Ga0207658_10596603 | 3300025986 | Bacteria | 992 |
| 314 | Ga0207677_10084159 | 3300026023 | Bacteria | 2292 |
| 315 | Ga0207677_10165622 | 3300026023 | Bacteria | 1722 |
| 316 | Ga0207677_10394039 | 3300026023 | Unclassified | 1172 |
| 317 | Ga0207677_10396474 | 3300026023 | Bacteria | 1169 |
| 318 | Ga0207703_10177796 | 3300026035 | Bacteria | 1876 |
| 319 | Ga0207639_10009827 | 3300026041 | Bacteria | 6612 |
| 320 | Ga0207639_10252529 | 3300026041 | Bacteria | 1538 |
| 321 | Ga0207678_10040907 | 3300026067 | Bacteria | 4019 |
| 322 | Ga0207678_10064008 | 3300026067 | Bacteria | 3160 |
| 323 | Ga0207678_10141276 | 3300026067 | Bacteria | 2055 |
| 324 | Ga0207678_10455522 | 3300026067 | Bacteria | 1112 |
| 325 | Ga0207708_10029150 | 3300026075 | Bacteria | 4181 |
| 326 | Ga0207708_10071594 | 3300026075 | Bacteria | 2656 |
| 327 | Ga0207708_10139977 | 3300026075 | Bacteria | 1897 |
| 328 | Ga0207708_10497305 | 3300026075 | Unclassified | 1021 |
| 329 | Ga0207702_10028914 | 3300026078 | Bacteria | 4610 |
| 330 | Ga0207702_10484214 | 3300026078 | Bacteria | 1204 |
| 331 | Ga0207648_10059070 | 3300026089 | Bacteria | 3344 |
| 332 | Ga0207648_10082012 | 3300026089 | Bacteria | 2812 |
| 333 | Ga0207648_10484480 | 3300026089 | Bacteria | 1130 |
| 334 | Ga0207676_10024777 | 3300026095 | Bacteria | 4444 |
| 335 | Ga0207676_10421086 | 3300026095 | Bacteria | 1252 |
| 336 | Ga0207674_10340850 | 3300026116 | Bacteria | 1449 |
| 337 | Ga0207675_100504826 | 3300026118 | Unclassified | 1204 |
| 338 | Ga0207683_10006492 | 3300026121 | Bacteria | 10011 |
| 339 | Ga0207683_10040843 | 3300026121 | Bacteria | 4050 |
| 340 | Ga0207683_10069950 | 3300026121 | Bacteria | 3100 |
| 341 | Ga0207683_10269823 | 3300026121 | Bacteria | 1554 |
| 342 | Ga0207683_10297316 | 3300026121 | Bacteria | 1477 |
| 343 | Ga0207698_10222047 | 3300026142 | Bacteria | 1708 |
| 344 | Ga0207698_10541106 | 3300026142 | Bacteria | 1140 |
| 345 | Ga0207428_10000616 | 3300027907 | Bacteria | 42107 |
| 346 | Ga0207428_10015169 | 3300027907 | Bacteria | 6668 |
| 347 | Ga0207428_10086222 | 3300027907 | Unclassified | 2444 |
| 348 | Ga0207428_10177793 | 3300027907 | Bacteria | 1609 |
| 349 | Ga0268266_10044661 | 3300028379 | Bacteria | 3788 |
| 350 | Ga0268266_11108335 | 3300028379 | Bacteria | 766 |
| 351 | Ga0307408_100253735 | 3300031548 | Bacteria | 1452 |
| 352 | Ga0307405_10021940 | 3300031731 | Bacteria | 3600 |
| 353 | Ga0307405_10050742 | 3300031731 | Unclassified | 2571 |
| 354 | Ga0307405_10372766 | 3300031731 | Unclassified | 1108 |
| 355 | Ga0307413_10040164 | 3300031824 | Bacteria | 2728 |
| 356 | Ga0307406_10024504 | 3300031901 | Bacteria | 3605 |
| 357 | Ga0307406_10111617 | 3300031901 | Unclassified | 1884 |
| 358 | Ga0307406_10178661 | 3300031901 | Bacteria | 1543 |
| 359 | Ga0307407_10056789 | 3300031903 | Bacteria | 2268 |
| 360 | Ga0307412_10013446 | 3300031911 | Bacteria | 4802 |
| 361 | Ga0307409_100027370 | 3300031995 | Bacteria | 4039 |
| 362 | Ga0307409_100089066 | 3300031995 | Bacteria | 2521 |
| 363 | Ga0307409_100176533 | 3300031995 | Bacteria | 1886 |
| 364 | Ga0307409_100224583 | 3300031995 | Bacteria | 1698 |
| 365 | Ga0307416_100007300 | 3300032002 | Bacteria | 7010 |
| 366 | Ga0307416_100037867 | 3300032002 | Bacteria | 3716 |
| 367 | Ga0307416_100100233 | 3300032002 | Bacteria | 2518 |
| 368 | Ga0307416_101068232 | 3300032002 | Unclassified | 911 |
| 369 | Ga0307414_10101969 | 3300032004 | Bacteria | 2162 |
| 370 | Ga0307415_100008009 | 3300032126 | Bacteria | 5828 |
| 371 | Ga0307415_100009850 | 3300032126 | Bacteria | 5384 |
| 372 | Ga0307415_100226645 | 3300032126 | Bacteria | 1502 |
| 373 | Ga0373930_0009177 | 3300034816 | Bacteria | 1746 |
| 374 | Ga0373938_0070553 | 3300034957 | Bacteria | 834 |
| 375 | Ga0373943_0079191 | 3300035170 | Bacteria | 1681 |
| 376 | Ga0373931_0139776 | 3300035691 | Bacteria | 1401 |
| 377 | Ga0373947_0001805 | 3300035725 | Bacteria | 13097 |
| 378 | Ga0373925_0009072 | 3300037068 | Bacteria | 7240 |
| 379 | Ga0395899_0009994 | 3300037312 | Bacteria | 7277 |
| 380 | Ga0395899_0019116 | 3300037312 | Bacteria | 5207 |
| 381 | Ga0395899_0027148 | 3300037312 | Bacteria | 4319 |
| 382 | Ga0395899_0060632 | 3300037312 | Bacteria | 2787 |
| 383 | Ga0395899_0238702 | 3300037312 | Bacteria | 1252 |
| 384 | Ga0395899_0243526 | 3300037312 | Bacteria | 1237 |
| 385 | Ga0395899_0263027 | 3300037312 | Unclassified | 1179 |
| 386 | Ga0395899_0337494 | 3300037312 | Bacteria | 1011 |
| 387 | Ga0395900_0000672 | 3300037418 | Bacteria | 45487 |
| 388 | Ga0395900_0016135 | 3300037418 | Bacteria | 7609 |
| 389 | Ga0395900_0019167 | 3300037418 | Bacteria | 6976 |
| 390 | Ga0395900_0019349 | 3300037418 | Bacteria | 6946 |
| 391 | Ga0395900_0072732 | 3300037418 | Bacteria | 3534 |
| 392 | Ga0395900_0371235 | 3300037418 | Unclassified | 1400 |
| 393 | Ga0395900_0411929 | 3300037418 | Bacteria | 1314 |
| 394 | Ga0395900_0851726 | 3300037418 | Unclassified | 837 |
| 395 | Ga0395898_0010163 | 3300037466 | Bacteria | 9849 |
| 396 | Ga0395898_0012873 | 3300037466 | Bacteria | 8631 |
| 397 | Ga0395898_0013953 | 3300037466 | Bacteria | 8258 |
| 398 | Ga0395898_0017705 | 3300037466 | Bacteria | 7272 |
| 399 | Ga0395898_0021932 | 3300037466 | Bacteria | 6469 |
| 400 | Ga0395898_0026880 | 3300037466 | Bacteria | 5783 |
| 401 | Ga0395898_0030915 | 3300037466 | Bacteria | 5356 |
| 402 | Ga0395898_0104380 | 3300037466 | Bacteria | 2718 |
| 403 | Ga0395898_0152102 | 3300037466 | Bacteria | 2214 |
| 404 | Ga0395898_0165462 | 3300037466 | Bacteria | 2115 |
| 405 | Ga0395898_0326656 | 3300037466 | Bacteria | 1463 |
| 406 | Ga0395898_0668387 | 3300037466 | Unclassified | 981 |
| 407 | Ga0395905_0016268 | 3300037471 | Bacteria | 7067 |
| 408 | Ga0395905_0021201 | 3300037471 | Bacteria | 6149 |
| 409 | Ga0395905_0033503 | 3300037471 | Bacteria | 4825 |
| 410 | Ga0395905_0066619 | 3300037471 | Bacteria | 3372 |
| 411 | Ga0395905_0076612 | 3300037471 | Bacteria | 3134 |
| 412 | Ga0395905_0137279 | 3300037471 | Unclassified | 2301 |
| 413 | Ga0395905_0144145 | 3300037471 | Bacteria | 2241 |
| 414 | Ga0395905_0182443 | 3300037471 | Bacteria | 1970 |
| 415 | Ga0395905_0199038 | 3300037471 | Bacteria | 1878 |
| 416 | Ga0395905_0271508 | 3300037471 | Unclassified | 1582 |
| 417 | Ga0395905_0317876 | 3300037471 | Bacteria | 1446 |
| 418 | Ga0395905_0484045 | 3300037471 | Bacteria | 1137 |
| 419 | Ga0395901_0003116 | 3300038443 | Bacteria | 16658 |
| 420 | Ga0395901_0005130 | 3300038443 | Bacteria | 13221 |
| 421 | Ga0395901_0009295 | 3300038443 | Bacteria | 9964 |
| 422 | Ga0395901_0011511 | 3300038443 | Bacteria | 8965 |
| 423 | Ga0395901_0036763 | 3300038443 | Bacteria | 5062 |
| 424 | Ga0395901_0049487 | 3300038443 | Bacteria | 4367 |
| 425 | Ga0395901_0062002 | 3300038443 | Unclassified | 3891 |
| 426 | Ga0395901_0091605 | 3300038443 | Bacteria | 3182 |
| 427 | Ga0395901_0129312 | 3300038443 | Bacteria | 2654 |
| 428 | Ga0395901_0204064 | 3300038443 | Bacteria | 2071 |
| 429 | Ga0395901_0226285 | 3300038443 | Bacteria | 1954 |
| 430 | Ga0395901_0398483 | 3300038443 | Bacteria | 1414 |
| 431 | Ga0395901_1118788 | 3300038443 | Bacteria | 757 |
| 432 | Ga0439453_0007341 | 3300041408 | Bacteria | 1746 |
| 433 | Ga0439461_0014244 | 3300041410 | Bacteria | 1510 |
| 434 | Ga0451853_0017336 | 3300041512 | Bacteria | 2388 |
| 435 | Ga0439431_0034869 | 3300041997 | Bacteria | 1263 |
| 436 | Ga0439433_0003150 | 3300041999 | Bacteria | 3530 |
| 437 | Ga0439449_0046816 | 3300042007 | Bacteria | 1602 |
| 438 | Ga0439451_013274 | 3300042009 | Bacteria | 1665 |
| 439 | Ga0439462_0004141 | 3300042015 | Bacteria | 3524 |
| 440 | Ga0450923_049887 | 3300042125 | Bacteria | 897 |
| 441 | Ga0439446_0003664 | 3300042156 | Bacteria | 3834 |
| 442 | Ga0439446_0022727 | 3300042156 | Bacteria | 1779 |
| 443 | Ga0439434_0018470 | 3300042435 | Unclassified | 2088 |
| 444 | Ga0439434_0073923 | 3300042435 | Bacteria | 1075 |
| 445 | Ga0439435_0012367 | 3300042436 | Bacteria | 2067 |
| 446 | Ga0450918_017009 | 3300042531 | Unclassified | 1266 |
| 447 | Ga0451576_0383715 | 3300045051 | Bacteria | 1473 |
| 448 | Ga0451576_0713680 | 3300045051 | Unclassified | 1053 |
| 449 | Ga0495603_0026358 | 3300046455 | Bacteria | 3512 |
| 450 | Ga0495629_0187113 | 3300046459 | Bacteria | 1434 |
| 451 | Ga0495641_0147132 | 3300046461 | Bacteria | 1053 |
| 452 | Ga0495584_0114995 | 3300046491 | Bacteria | 1362 |
| 453 | Ga0495594_0221165 | 3300046499 | Bacteria | 1080 |
| 454 | Ga0495596_0065083 | 3300046500 | Bacteria | 1418 |
| 455 | Ga0495630_0084956 | 3300046517 | Bacteria | 2389 |
| 456 | Ga0495630_0134753 | 3300046517 | Bacteria | 1877 |
| 457 | Ga0495644_0150572 | 3300046523 | Bacteria | 890 |
| 458 | Ga0495663_0006977 | 3300046525 | Bacteria | 3116 |
| 459 | Ga0495586_0025563 | 3300046535 | Bacteria | 3160 |
| 460 | Ga0495656_0085338 | 3300046615 | Bacteria | 1434 |
| 461 | Ga0495656_0172281 | 3300046615 | Bacteria | 1059 |
| 462 | Ga0495658_0066558 | 3300046683 | Bacteria | 2081 |
| 463 | Ga0495624_0108440 | 3300046690 | Bacteria | 1708 |
| 464 | Ga0495589_0143189 | 3300046794 | Unclassified | 1144 |
| 465 | Ga0495676_0475201 | 3300047321 | Unclassified | 823 |
| 466 | Ga0496101_0130127 | 3300048904 | Bacteria | 1911 |
| 467 | Ga0496101_0499112 | 3300048904 | Bacteria | 961 |
| 468 | Ga0496101_0610686 | 3300048904 | Bacteria | 862 |
| 469 | Ga0496102_0014207 | 3300048905 | Bacteria | 6918 |
| 470 | Ga0496102_0574308 | 3300048905 | Bacteria | 1050 |
| 471 | Ga0496102_0583173 | 3300048905 | Bacteria | 1041 |
| 472 | Ga0496103_0002770 | 3300048906 | Bacteria | 10905 |
| 473 | Ga0496104_0036459 | 3300048907 | Bacteria | 4598 |
| 474 | Ga0496104_0038609 | 3300048907 | Bacteria | 4468 |
| 475 | Ga0496104_0328130 | 3300048907 | Bacteria | 1443 |
| 476 | Ga0496104_0346003 | 3300048907 | Bacteria | 1399 |
| 477 | Ga0496105_0071558 | 3300048908 | Bacteria | 2866 |
| 478 | Ga0496106_0227132 | 3300048909 | Bacteria | 1490 |
| 479 | Ga0496107_0068959 | 3300048910 | Bacteria | 2566 |
| 480 | Ga0496108_0031277 | 3300048911 | Bacteria | 4415 |
| 481 | Ga0496108_0116015 | 3300048911 | Bacteria | 2293 |
| 482 | Ga0496108_0465927 | 3300048911 | Unclassified | 1104 |
| 483 | Ga0496110_0051029 | 3300048913 | Bacteria | 3634 |
| 484 | Ga0496110_0126882 | 3300048913 | Bacteria | 2302 |
| 485 | Ga0496110_0205939 | 3300048913 | Bacteria | 1788 |
| 486 | Ga0496110_0224234 | 3300048913 | Bacteria | 1709 |
| 487 | Ga0496111_0018202 | 3300048914 | Bacteria | 4864 |
| 488 | Ga0496111_0032088 | 3300048914 | Bacteria | 3744 |
| 489 | Ga0496111_0088175 | 3300048914 | Bacteria | 2272 |
| 490 | Ga0496112_0484127 | 3300048915 | Archaea | 1174 |
| 491 | Ga0496113_0156754 | 3300048916 | Bacteria | 1799 |
| 492 | Ga0496114_0049486 | 3300048917 | Bacteria | 3497 |
| 493 | Ga0496114_0101503 | 3300048917 | Bacteria | 2457 |
| 494 | Ga0496114_0220192 | 3300048917 | Bacteria | 1666 |
| 495 | Ga0501031_0008367 | 3300049568 | Bacteria | 6728 |
| 496 | Ga0501031_0009260 | 3300049568 | Bacteria | 6399 |
| 497 | Ga0501031_0025391 | 3300049568 | Bacteria | 3864 |
| 498 | Ga0501031_0218843 | 3300049568 | Bacteria | 1240 |
| 499 | Ga0501032_0019947 | 3300049569 | Bacteria | 4679 |
| 500 | Ga0501032_0054782 | 3300049569 | Bacteria | 2684 |
| 501 | Ga0501033_0016515 | 3300049570 | Bacteria | 5589 |
| 502 | Ga0501033_0096748 | 3300049570 | Bacteria | 2157 |
| 503 | Ga0501033_0120851 | 3300049570 | Bacteria | 1901 |
| 504 | Ga0501033_0136568 | 3300049570 | Bacteria | 1774 |
| 505 | Ga0501033_0329138 | 3300049570 | Bacteria | 1072 |
| 506 | Ga0501034_0150188 | 3300049571 | Bacteria | 2306 |
| 507 | Ga0501034_0271792 | 3300049571 | Unclassified | 1636 |
| 508 | Ga0501036_0004235 | 3300049572 | Bacteria | 11568 |
| 509 | Ga0501036_0016320 | 3300049572 | Bacteria | 6204 |
| 510 | Ga0501036_0019484 | 3300049572 | Bacteria | 5698 |
| 511 | Ga0501036_0022712 | 3300049572 | Bacteria | 5280 |
| 512 | Ga0501036_0041300 | 3300049572 | Bacteria | 3903 |
| 513 | Ga0501036_0063480 | 3300049572 | Bacteria | 3127 |
| 514 | Ga0501037_0042351 | 3300049573 | Bacteria | 3346 |
| 515 | Ga0501037_0122830 | 3300049573 | Bacteria | 1866 |
| 516 | Ga0501037_0288839 | 3300049573 | Bacteria | 1141 |
| 517 | Ga0501038_0021115 | 3300049574 | Bacteria | 5849 |
| 518 | Ga0501038_0022053 | 3300049574 | Bacteria | 5711 |
| 519 | Ga0501038_0028893 | 3300049574 | Bacteria | 4921 |
| 520 | Ga0501039_0029315 | 3300049575 | Bacteria | 4238 |
| 521 | Ga0501039_0062172 | 3300049575 | Bacteria | 2893 |
| 522 | Ga0501039_0067219 | 3300049575 | Bacteria | 2783 |
| 523 | Ga0501039_0074183 | 3300049575 | Bacteria | 2644 |
| 524 | Ga0501039_0091517 | 3300049575 | Bacteria | 2370 |
| 525 | Ga0501039_0186062 | 3300049575 | Bacteria | 1633 |
| 526 | Ga0501039_0610964 | 3300049575 | Unclassified | 854 |
| 527 | Ga0501040_0010581 | 3300049576 | Bacteria | 6032 |
| 528 | Ga0501040_0011857 | 3300049576 | Bacteria | 5702 |
| 529 | Ga0501040_0014319 | 3300049576 | Bacteria | 5225 |
| 530 | Ga0501040_0025565 | 3300049576 | Bacteria | 3970 |
| 531 | Ga0501040_0063898 | 3300049576 | Bacteria | 2533 |
| 532 | Ga0501040_0217892 | 3300049576 | Bacteria | 1358 |
| 533 | Ga0501040_0286854 | 3300049576 | Bacteria | 1176 |
| 534 | Ga0501041_0006637 | 3300049577 | Bacteria | 6778 |
| 535 | Ga0501041_0007584 | 3300049577 | Bacteria | 6371 |
| 536 | Ga0501041_0008596 | 3300049577 | Bacteria | 6013 |
| 537 | Ga0501041_0009544 | 3300049577 | Bacteria | 5721 |
| 538 | Ga0501041_0019049 | 3300049577 | Bacteria | 4092 |
| 539 | Ga0501041_0482825 | 3300049577 | Unclassified | 788 |
| 540 | Ga0501042_0000441 | 3300049578 | Bacteria | 21218 |
| 541 | Ga0501042_0002574 | 3300049578 | Bacteria | 11148 |
| 542 | Ga0501042_0014381 | 3300049578 | Bacteria | 5401 |
| 543 | Ga0501042_0022949 | 3300049578 | Bacteria | 4359 |
| 544 | Ga0501042_0052522 | 3300049578 | Bacteria | 2907 |
| 545 | Ga0501042_0135859 | 3300049578 | Bacteria | 1773 |
| 546 | Ga0501042_0137837 | 3300049578 | Bacteria | 1759 |
| 547 | Ga0501042_0469104 | 3300049578 | Unclassified | 913 |
| 548 | Ga0501043_0057963 | 3300049579 | Bacteria | 3040 |
| 549 | Ga0501043_0108777 | 3300049579 | Bacteria | 2177 |
| 550 | Ga0501043_0455890 | 3300049579 | Unclassified | 960 |
| 551 | Ga0501046_0002052 | 3300049580 | Bacteria | 19128 |
| 552 | Ga0501046_0005519 | 3300049580 | Bacteria | 11295 |
| 553 | Ga0501046_0032575 | 3300049580 | Bacteria | 4220 |
| 554 | Ga0501046_0280174 | 3300049580 | Bacteria | 1221 |
| 555 | Ga0501046_0431988 | 3300049580 | Bacteria | 948 |
| 556 | Ga0501046_0536598 | 3300049580 | Bacteria | 835 |
| 557 | Ga0501047_0379163 | 3300049581 | Bacteria | 1249 |
| 558 | Ga0501047_0674864 | 3300049581 | Bacteria | 852 |
| 559 | Ga0501048_0002595 | 3300049582 | Bacteria | 13845 |
| 560 | Ga0501048_0011844 | 3300049582 | Bacteria | 6502 |
| 561 | Ga0501048_0017118 | 3300049582 | Bacteria | 5342 |
| 562 | Ga0501048_0063657 | 3300049582 | Bacteria | 2608 |
| 563 | Ga0501048_0088042 | 3300049582 | Bacteria | 2190 |
| 564 | Ga0501048_0176836 | 3300049582 | Bacteria | 1512 |
| 565 | Ga0501048_0376595 | 3300049582 | Bacteria | 1013 |
| 566 | Ga0501048_0595288 | 3300049582 | Unclassified | 794 |
| 567 | Ga0501067_0403792 | 3300049583 | Unclassified | 762 |
| 568 | Ga0501068_0001633 | 3300049584 | Bacteria | 11967 |
| 569 | Ga0501068_0033710 | 3300049584 | Bacteria | 3050 |
| 570 | Ga0501068_0053928 | 3300049584 | Bacteria | 2435 |
| 571 | Ga0501068_0159986 | 3300049584 | Bacteria | 1419 |
| 572 | Ga0501068_0168004 | 3300049584 | Bacteria | 1383 |
| 573 | Ga0501068_0168969 | 3300049584 | Bacteria | 1380 |
| 574 | Ga0501069_0104424 | 3300049585 | Bacteria | 1610 |
| 575 | Ga0501069_0228693 | 3300049585 | Unclassified | 1082 |
| 576 | Ga0501069_0243499 | 3300049585 | Unclassified | 1048 |
| 577 | Ga0501070_0080649 | 3300049586 | Bacteria | 2693 |
| 578 | Ga0501070_0110290 | 3300049586 | Bacteria | 2274 |
| 579 | Ga0501070_0367836 | 3300049586 | Bacteria | 1166 |
| 580 | Ga0501070_0483736 | 3300049586 | Bacteria | 995 |
| 581 | Ga0501071_0012115 | 3300049587 | Bacteria | 5833 |
| 582 | Ga0501071_0012611 | 3300049587 | Bacteria | 5739 |
| 583 | Ga0501071_0014388 | 3300049587 | Bacteria | 5410 |
| 584 | Ga0501071_0048698 | 3300049587 | Bacteria | 3049 |
| 585 | Ga0501071_0065122 | 3300049587 | Bacteria | 2646 |
| 586 | Ga0501071_0119307 | 3300049587 | Bacteria | 1954 |
| 587 | Ga0501071_0214379 | 3300049587 | Bacteria | 1448 |
| 588 | Ga0501071_0565721 | 3300049587 | Bacteria | 873 |
| 589 | Ga0501072_0000735 | 3300049588 | Bacteria | 23877 |
| 590 | Ga0501072_0006457 | 3300049588 | Bacteria | 8927 |
| 591 | Ga0501072_0008774 | 3300049588 | Bacteria | 7675 |
| 592 | Ga0501072_0020922 | 3300049588 | Bacteria | 5071 |
| 593 | Ga0501072_0036036 | 3300049588 | Bacteria | 3877 |
| 594 | Ga0501072_0086824 | 3300049588 | Bacteria | 2482 |
| 595 | Ga0501072_0147449 | 3300049588 | Bacteria | 1876 |
| 596 | Ga0501072_0364342 | 3300049588 | Bacteria | 1147 |
| 597 | Ga0501073_0030002 | 3300049589 | Bacteria | 3884 |
| 598 | Ga0501074_0002379 | 3300049590 | Bacteria | 13109 |
| 599 | Ga0501074_0025235 | 3300049590 | Bacteria | 4318 |
| 600 | Ga0501074_0083473 | 3300049590 | Bacteria | 2290 |
| 601 | Ga0501074_0302040 | 3300049590 | Unclassified | 1137 |
| 602 | Ga0501075_0012546 | 3300049591 | Bacteria | 6026 |
| 603 | Ga0501075_0032012 | 3300049591 | Bacteria | 3906 |
| 604 | Ga0501075_0124610 | 3300049591 | Bacteria | 1961 |
| 605 | Ga0501075_0126200 | 3300049591 | Bacteria | 1948 |
| 606 | Ga0501075_0176216 | 3300049591 | Unclassified | 1631 |
| 607 | Ga0501076_0008053 | 3300049592 | Bacteria | 7700 |
| 608 | Ga0501076_0021974 | 3300049592 | Bacteria | 4900 |
| 609 | Ga0501076_0026124 | 3300049592 | Bacteria | 4520 |
| 610 | Ga0501076_0044145 | 3300049592 | Bacteria | 3514 |
| 611 | Ga0501076_0066295 | 3300049592 | Bacteria | 2881 |
| 612 | Ga0501076_0157351 | 3300049592 | Bacteria | 1850 |
| 613 | Ga0501076_0228651 | 3300049592 | Unclassified | 1520 |
| 614 | Ga0501076_0249705 | 3300049592 | Bacteria | 1451 |
| 615 | Ga0501076_0287867 | 3300049592 | Bacteria | 1346 |
| 616 | Ga0501077_0000885 | 3300049593 | Bacteria | 18007 |
| 617 | Ga0501077_0025285 | 3300049593 | Bacteria | 3771 |
| 618 | Ga0501077_0038111 | 3300049593 | Bacteria | 3060 |
| 619 | Ga0501077_0073148 | 3300049593 | Bacteria | 2171 |
| 620 | Ga0501077_0115122 | 3300049593 | Bacteria | 1704 |
| 621 | Ga0501077_0156503 | 3300049593 | Bacteria | 1446 |
| 622 | Ga0501077_0219525 | 3300049593 | Unclassified | 1208 |
| 623 | Ga0501233_020491 | 3300049668 | Bacteria | 1412 |
| 624 | Ga0501079_0009303 | 3300049741 | Bacteria | 7448 |
| 625 | Ga0501079_0070893 | 3300049741 | Bacteria | 2691 |
| 626 | Ga0501079_0082959 | 3300049741 | Bacteria | 2479 |
| 627 | Ga0501079_0083661 | 3300049741 | Bacteria | 2468 |
| 628 | Ga0501079_0125792 | 3300049741 | Bacteria | 1994 |
| 629 | Ga0501080_0002230 | 3300049742 | Bacteria | 16845 |
| 630 | Ga0501080_0017960 | 3300049742 | Bacteria | 6547 |
| 631 | Ga0501080_0021884 | 3300049742 | Bacteria | 5921 |
| 632 | Ga0501080_0027304 | 3300049742 | Bacteria | 5308 |
| 633 | Ga0501080_0061509 | 3300049742 | Bacteria | 3496 |
| 634 | Ga0501080_0170262 | 3300049742 | Bacteria | 2009 |
| 635 | Ga0501080_0748257 | 3300049742 | Bacteria | 860 |
| 636 | Ga0501081_0005847 | 3300049743 | Bacteria | 7961 |
| 637 | Ga0501081_0008382 | 3300049743 | Bacteria | 6710 |
| 638 | Ga0501081_0055723 | 3300049743 | Bacteria | 2731 |
| 639 | Ga0501081_0065503 | 3300049743 | Bacteria | 2525 |
| 640 | Ga0501081_0075562 | 3300049743 | Bacteria | 2352 |
| 641 | Ga0501081_0282834 | 3300049743 | Bacteria | 1215 |
| 642 | Ga0501081_0590508 | 3300049743 | Bacteria | 831 |
| 643 | Ga0501083_0063983 | 3300049744 | Bacteria | 2452 |
| 644 | Ga0501083_0238022 | 3300049744 | Bacteria | 1185 |
| 645 | Ga0501035_0022962 | 3300049822 | Bacteria | 5726 |
| 646 | Ga0501035_0029556 | 3300049822 | Bacteria | 4999 |
| 647 | Ga0501035_0029940 | 3300049822 | Bacteria | 4965 |
| 648 | Ga0501035_0776175 | 3300049822 | Bacteria | 767 |
| 649 | Ga0501044_0133072 | 3300049823 | Bacteria | 2480 |
| 650 | Ga0501045_0000823 | 3300049824 | Bacteria | 20069 |
| 651 | Ga0501045_0009423 | 3300049824 | Bacteria | 6830 |
| 652 | Ga0501045_0039661 | 3300049824 | Bacteria | 3426 |
| 653 | Ga0501045_0074044 | 3300049824 | Bacteria | 2508 |
| 654 | Ga0501045_0085081 | 3300049824 | Bacteria | 2333 |
| 655 | Ga0501045_0176644 | 3300049824 | Bacteria | 1591 |
| 656 | Ga0501045_0470065 | 3300049824 | Unclassified | 934 |
| 657 | nmdc:mga00v17_281630_c1 | 3300050491 | Bacteria | 1079 |
| 658 | nmdc:mga0yw44_27835_c1 | 3300050492 | Bacteria | 3243 |
| 659 | nmdc:mga05p37_16558_c1 | 3300050507 | Bacteria | 8881 |
| 660 | nmdc:mga05p37_40133_c1 | 3300050507 | Bacteria | 5747 |
| 661 | nmdc:mga05p37_43395_c1 | 3300050507 | Bacteria | 4870 |
| 662 | nmdc:mga05p37_452670_c1 | 3300050507 | Bacteria | 1485 |
| 663 | nmdc:mga05p37_87920_c1 | 3300050507 | Bacteria | 3831 |
| 664 | nmdc:mga09592_15345_c1 | 3300050508 | Bacteria | 6256 |
| 665 | nmdc:mga09592_246881_c1 | 3300050508 | Bacteria | 1547 |
| 666 | nmdc:mga0qj67_348709_c1 | 3300050509 | Bacteria | 1197 |
| 667 | nmdc:mga0qj67_448208_c1 | 3300050509 | Bacteria | 1040 |
| 668 | nmdc:mga06r32_34305_c1 | 3300050510 | Bacteria | 4784 |
| 669 | nmdc:mga06r32_6256_c1 | 3300050510 | Bacteria | 10688 |
| 670 | nmdc:mga08y16_108075_c1 | 3300050511 | Bacteria | 2896 |
| 671 | nmdc:mga08y16_19639_c1 | 3300050511 | Bacteria | 7126 |
| 672 | nmdc:mga08y16_444438_c1 | 3300050511 | Bacteria | 1323 |
| 673 | nmdc:mga08y16_47453_c1 | 3300050511 | Bacteria | 4495 |
| 674 | nmdc:mga08y16_91910_c1 | 3300050511 | Bacteria | 3162 |
| 675 | nmdc:mga0n895_45637_c1 | 3300050512 | Bacteria | 4277 |
| 676 | nmdc:mga0n895_517307_c1 | 3300050512 | Bacteria | 1201 |
| 677 | nmdc:mga0rr50_2921_c1 | 3300050513 | Bacteria | 9757 |
| 678 | nmdc:mga08x19_5927_c1 | 3300050514 | Bacteria | 7231 |
| 679 | nmdc:mga0a205_123505_c1 | 3300050515 | Bacteria | 2489 |
| 680 | Ga0495655_0002969 | 3300053083 | Bacteria | 2750 |
| 681 | Ga0501084_0010166 | 3300054114 | Bacteria | 7780 |
| 682 | Ga0501084_0019340 | 3300054114 | Bacteria | 5674 |
| 683 | Ga0501084_0048439 | 3300054114 | Bacteria | 3557 |
| 684 | Ga0501084_0093846 | 3300054114 | Bacteria | 2520 |
| 685 | Ga0501084_0120349 | 3300054114 | Bacteria | 2207 |
| 686 | Ga0501084_0145148 | 3300054114 | Bacteria | 1998 |
| 687 | Ga0501084_0179559 | 3300054114 | Bacteria | 1787 |
| 688 | Ga0590075_013270 | 3300059424 | Bacteria | 2006 |
| 689 | Ga0590075_043626 | 3300059424 | Unclassified | 1147 |
| 690 | Ga0590077_034813 | 3300059426 | Bacteria | 1108 |
| 691 | Ga0501082_0007159 | 3300060353 | Bacteria | 9616 |
| 692 | Ga0501082_0041366 | 3300060353 | Bacteria | 3973 |
| 693 | Ga0501082_0061741 | 3300060353 | Bacteria | 3225 |
| 694 | Ga0501082_0300647 | 3300060353 | Unclassified | 1397 |
| 695 | Ga0501082_0361290 | 3300060353 | Bacteria | 1266 |
| 696 | Ga0501082_0548241 | 3300060353 | Bacteria | 1011 |
| 697 | Ga0501082_0570733 | 3300060353 | Unclassified | 990 |
| 698 | Ga0501082_0597795 | 3300060353 | Bacteria | 965 |
| 699 | Ga0530510_0003263 | 3300061734 | Bacteria | 11151 |
| 700 | Ga0530510_0018543 | 3300061734 | Bacteria | 4933 |
| 701 | Ga0530510_0041743 | 3300061734 | Bacteria | 3312 |
| 702 | Ga0530510_0054130 | 3300061734 | Bacteria | 2900 |
| 703 | Ga0530510_0161726 | 3300061734 | Bacteria | 1656 |
| 704 | Ga0530510_0180253 | 3300061734 | Bacteria | 1566 |
| 705 | Ga0530510_0378003 | 3300061734 | Bacteria | 1066 |
| 706 | Ga0395900_0027625 | |||
| 707 | JGI24743J22301_10048364 | |||
| 708 | JGI24738J21930_10007013 | |||
| 709 | Ga0070658_10014552 | |||
| 710 | Ga0070683_100030326 | |||
| 711 | Ga0070683_100105303 | |||
| 712 | Ga0070683_100214150 | |||
| 713 | Ga0070690_100139104 | |||
| 714 | Ga0070670_100538741 | |||
| 715 | Ga0068869_100252251 | |||
| 716 | Ga0068869_100265028 | |||
| 717 | Ga0068869_100338183 | |||
| 718 | Ga0070666_10214050 | |||
| 719 | Ga0070680_100123408 | |||
| 720 | Ga0070682_100430250 | |||
| 721 | Ga0068868_100253424 | |||
| 722 | Ga0068868_100262957 | |||
| 723 | Ga0070660_100074437 | |||
| 724 | Ga0070689_100062289 | |||
| 725 | Ga0070689_100111475 | |||
| 726 | Ga0070661_100033838 | |||
| 727 | Ga0070661_100291093 | |||
| 728 | Ga0070692_10022650 | |||
| 729 | Ga0070692_10096548 | |||
| 730 | Ga0070692_10183089 | |||
| 731 | Ga0070668_100303001 | |||
| 732 | Ga0070669_100296296 | |||
| 733 | Ga0070675_100050447 | |||
| 734 | Ga0070675_100101673 | |||
| 735 | Ga0070675_100104384 | |||
| 736 | Ga0070675_100132329 | |||
| 737 | Ga0070675_100248494 | |||
| 738 | Ga0070675_100322583 | |||
| 739 | Ga0070671_100048938 | |||
| 740 | Ga0070671_100111102 | |||
| 741 | Ga0070671_100353299 | |||
| 742 | Ga0070674_100030030 | |||
| 743 | Ga0070674_100050159 | |||
| 744 | Ga0070674_100059972 | |||
| 745 | Ga0070674_100281708 | |||
| 746 | Ga0070674_100407407 | |||
| 747 | Ga0070673_100039231 | |||
| 748 | Ga0070673_100198579 | |||
| 749 | Ga0070688_100036085 | |||
| 750 | Ga0070688_100089827 | |||
| 751 | Ga0070659_100071734 | |||
| 752 | Ga0070659_100374455 | |||
| 753 | Ga0070659_100401753 | |||
| 754 | Ga0070667_100283509 | |||
| 755 | Ga0070703_10153159 | |||
| 756 | Ga0070714_100460514 | |||
| 757 | Ga0070701_10042963 | |||
| 758 | Ga0070701_10190687 | |||
| 759 | Ga0070701_10439882 | |||
| 760 | Ga0070711_100181434 | |||
| 761 | Ga0070705_100084770 | |||
| 762 | Ga0070700_100015707 | |||
| 763 | Ga0070700_100042746 | |||
| 764 | Ga0070694_100662394 | |||
| 765 | Ga0070708_100030728 | |||
| 766 | Ga0070663_100249067 | |||
| 767 | Ga0070678_100025390 | |||
| 768 | Ga0070678_100145655 | |||
| 769 | Ga0070678_100277516 | |||
| 770 | Ga0070678_100338090 | |||
| 771 | Ga0070662_100059385 | |||
| 772 | Ga0070662_100312888 | |||
| 773 | Ga0070662_100315041 | |||
| 774 | Ga0070681_10036083 | |||
| 775 | Ga0070681_10118500 | |||
| 776 | Ga0068867_100062420 | |||
| 777 | Ga0068867_100215746 | |||
| 778 | Ga0068867_100936208 | |||
| 779 | Ga0070685_10152277 | |||
| 780 | Ga0070706_100548974 | |||
| 781 | Ga0070698_100165233 | |||
| 782 | Ga0070699_100057094 | |||
| 783 | Ga0070679_100002810 | |||
| 784 | Ga0070679_100311215 | |||
| 785 | Ga0070684_100001001 | |||
| 786 | Ga0070684_100086582 | |||
| 787 | Ga0070684_100089423 | |||
| 788 | Ga0070684_100143229 | |||
| 789 | Ga0070684_100272546 | |||
| 790 | Ga0070697_100821624 | |||
| 791 | Ga0068853_100040586 | |||
| 792 | Ga0070672_100078785 | |||
| 793 | Ga0070672_100103769 | |||
| 794 | Ga0070686_100059129 | |||
| 795 | Ga0070686_100070653 | |||
| 796 | Ga0070686_100208275 | |||
| 797 | Ga0070695_100341999 | |||
| 798 | Ga0070696_100408586 | |||
| 799 | Ga0070696_100571954 | |||
| 800 | Ga0070693_100002648 | |||
| 801 | Ga0070693_100381266 | |||
| 802 | Ga0070665_100061791 | |||
| 803 | Ga0070665_100272407 | |||
| 804 | Ga0070665_100635100 | |||
| 805 | Ga0070704_100203563 | |||
| 806 | Ga0068855_100120961 | |||
| 807 | Ga0068855_100514263 | |||
| 808 | Ga0070664_100081999 | |||
| 809 | Ga0070664_100265488 | |||
| 810 | Ga0070664_100455141 | |||
| 811 | Ga0070664_100734637 | |||
| 812 | Ga0068854_100068446 | |||
| 813 | Ga0068854_100068936 | |||
| 814 | Ga0068854_100157985 | |||
| 815 | Ga0068854_100599098 | |||
| 816 | Ga0068856_100022134 | |||
| 817 | Ga0068856_100655765 | |||
| 818 | Ga0070702_100078783 | |||
| 819 | Ga0070702_100328558 | |||
| 820 | Ga0068852_100044266 | |||
| 821 | Ga0068852_100698048 | |||
| 822 | Ga0068859_101148816 | |||
| 823 | Ga0068864_100010668 | |||
| 824 | Ga0068864_100139626 | |||
| 825 | Ga0068866_10045660 | |||
| 826 | Ga0068861_100120831 | |||
| 827 | Ga0068861_100497312 | |||
| 828 | Ga0068851_10207547 | |||
| 829 | Ga0068851_10218550 | |||
| 830 | Ga0068870_10017694 | |||
| 831 | Ga0068863_100319115 | |||
| 832 | Ga0068863_100405395 | |||
| 833 | Ga0068858_100031474 | |||
| 834 | Ga0068860_100228134 | |||
| 835 | Ga0068862_100330968 | |||
| 836 | Ga0068862_100335245 | |||
| 837 | Ga0081455_10001861 | |||
| 838 | Ga0081455_10034264 | |||
| 839 | Ga0081455_10036893 | |||
| 840 | Ga0081455_10046668 | |||
| 841 | Ga0081455_10204763 | |||
| 842 | Ga0081455_10380441 | |||
| 843 | Ga0081455_10462538 | |||
| 844 | Ga0081539_10001335 | |||
| 845 | Ga0081539_10139239 | |||
| 846 | Ga0075365_10044653 | |||
| 847 | Ga0075432_10004132 | |||
| 848 | Ga0097621_100056538 | |||
| 849 | Ga0097621_100245042 | |||
| 850 | Ga0068871_100144363 | |||
| 851 | Ga0068871_100167649 | |||
| 852 | Ga0068871_100487270 | |||
| 853 | Ga0075428_100028279 | |||
| 854 | Ga0075428_100144090 | |||
| 855 | Ga0075428_100359630 | |||
| 856 | Ga0075428_100682445 | |||
| 857 | Ga0075430_100644725 | |||
| 858 | Ga0075431_100006254 | |||
| 859 | Ga0075431_100041551 | |||
| 860 | Ga0075431_100292724 | |||
| 861 | Ga0075433_10045622 | |||
| 862 | Ga0075433_10149203 | |||
| 863 | Ga0075434_100400816 | |||
| 864 | Ga0075429_100038392 | |||
| 865 | Ga0075429_100043419 | |||
| 866 | Ga0068865_100024294 | |||
| 867 | Ga0068865_100147614 | |||
| 868 | Ga0075436_100019331 | |||
| 869 | Ga0097620_101148696 | |||
| 870 | Ga0111539_10060383 | |||
| 871 | Ga0111539_10073822 | |||
| 872 | Ga0111539_10200581 | |||
| 873 | Ga0111539_10210949 | |||
| 874 | Ga0111539_10261331 | |||
| 875 | Ga0111539_11365623 | |||
| 876 | Ga0105245_10045161 | |||
| 877 | Ga0105245_10047827 | |||
| 878 | Ga0105245_10231403 | |||
| 879 | Ga0105245_10235222 | |||
| 880 | Ga0105245_10266091 | |||
| 881 | Ga0105245_10328797 | |||
| 882 | Ga0105245_11029712 | |||
| 883 | Ga0105247_10051620 | |||
| 884 | Ga0114129_10085229 | |||
| 885 | Ga0114129_10090048 | |||
| 886 | Ga0114129_10290134 | |||
| 887 | Ga0114129_10767583 | |||
| 888 | Ga0114129_10829694 | |||
| 889 | Ga0105243_10032600 | |||
| 890 | Ga0105243_10070969 | |||
| 891 | Ga0105243_10202073 | |||
| 892 | Ga0105243_10364113 | |||
| 893 | Ga0105243_10404113 | |||
| 894 | Ga0105243_10621653 | |||
| 895 | Ga0105243_11277198 | |||
| 896 | Ga0105241_10083061 | |||
| 897 | Ga0105242_10056351 | |||
| 898 | Ga0105242_10079642 | |||
| 899 | Ga0105242_10346173 | |||
| 900 | Ga0105242_10459762 | |||
| 901 | Ga0105242_10540647 | |||
| 902 | Ga0105248_10059033 | |||
| 903 | Ga0105248_10772830 | |||
| 904 | Ga0105248_10903844 | |||
| 905 | Ga0105238_10097055 | |||
| 906 | Ga0105238_10176567 | |||
| 907 | Ga0105238_10307207 | |||
| 908 | Ga0105249_10189391 | |||
| 909 | Ga0105249_10196626 | |||
| 910 | Ga0105239_10006421 | |||
| 911 | Ga0105239_10213106 | |||
| 912 | Ga0105239_10965761 | |||
| 913 | Ga0105246_10021900 | |||
| 914 | Ga0105246_10086556 | |||
| 915 | Ga0105246_10126267 | |||
| 916 | Ga0105246_10339463 | |||
| 917 | Ga0157371_10054594 | |||
| 918 | Ga0157371_10255448 | |||
| 919 | Ga0157378_10276171 | |||
| 920 | Ga0157378_10279811 | |||
| 921 | Ga0157378_10309536 | |||
| 922 | Ga0163162_10105934 | |||
| 923 | Ga0163162_10172847 | |||
| 924 | Ga0163162_10185649 | |||
| 925 | Ga0157372_10230245 | |||
| 926 | Ga0157372_10337114 | |||
| 927 | Ga0157375_10126712 | |||
| 928 | Ga0157375_10142029 | |||
| 929 | Ga0157375_10156153 | |||
| 930 | Ga0157375_10262534 | |||
| 931 | Ga0157375_10498123 | |||
| 932 | Ga0157375_10672747 | |||
| 933 | Ga0163163_10028019 | |||
| 934 | Ga0163163_10033206 | |||
| 935 | Ga0163163_10682824 | |||
| 936 | Ga0157380_10101514 | |||
| 937 | Ga0157380_10414655 | |||
| 938 | Ga0157380_10615235 | |||
| 939 | Ga0157377_10052379 | |||
| 940 | Ga0157377_10233924 | |||
| 941 | Ga0157379_10164367 | |||
| 942 | Ga0157379_10191131 | |||
| 943 | Ga0157376_10055228 | |||
| 944 | Ga0157376_10422039 | |||
| 945 | Ga0157376_10452161 | |||
| 946 | Ga0157376_10647728 | |||
| 947 | Ga0163161_10034765 | |||
| 948 | Ga0207642_10365664 | |||
| 949 | Ga0207710_10044822 | |||
| 950 | Ga0207688_10007691 | |||
| 951 | Ga0207688_10026359 | |||
| 952 | Ga0207688_10043270 | |||
| 953 | Ga0207645_10033387 | |||
| 954 | Ga0207643_10009991 | |||
| 955 | Ga0207643_10054627 | |||
| 956 | Ga0207643_10102730 | |||
| 957 | Ga0207684_10410682 | |||
| 958 | Ga0207707_10070930 | |||
| 959 | Ga0207707_10587799 | |||
| 960 | Ga0207693_10296657 | |||
| 961 | Ga0207663_10247214 | |||
| 962 | Ga0207660_10097822 | |||
| 963 | Ga0207662_10198230 | |||
| 964 | Ga0207657_10005767 | |||
| 965 | Ga0207652_10091740 | |||
| 966 | Ga0207659_10065165 | |||
| 967 | Ga0207659_10067506 | |||
| 968 | Ga0207659_10131737 | |||
| 969 | Ga0207659_10152138 | |||
| 970 | Ga0207659_10190862 | |||
| 971 | Ga0207687_10018548 | |||
| 972 | Ga0207687_10096847 | |||
| 973 | Ga0207687_10190056 | |||
| 974 | Ga0207687_10221833 | |||
| 975 | Ga0207687_10372083 | |||
| 976 | Ga0207644_10095645 | |||
| 977 | Ga0207644_10239232 | |||
| 978 | Ga0207690_10175690 | |||
| 979 | Ga0207706_10022764 | |||
| 980 | Ga0207706_10076375 | |||
| 981 | Ga0207706_10342136 | |||
| 982 | Ga0207686_10008053 | |||
| 983 | Ga0207686_10075825 | |||
| 984 | Ga0207686_10256030 | |||
| 985 | Ga0207709_10055713 | |||
| 986 | Ga0207709_10129303 | |||
| 987 | Ga0207709_10229450 | |||
| 988 | Ga0207709_10357606 | |||
| 989 | Ga0207709_10755456 | |||
| 990 | Ga0207670_10041414 | |||
| 991 | Ga0207670_10224528 | |||
| 992 | Ga0207669_10026984 | |||
| 993 | Ga0207669_10077719 | |||
| 994 | Ga0207669_10229405 | |||
| 995 | Ga0207669_10349006 | |||
| 996 | Ga0207704_10013025 | |||
| 997 | Ga0207704_10194214 | |||
| 998 | Ga0207704_10315831 | |||
| 999 | Ga0207691_10015174 | |||
| 1000 | Ga0207691_10068001 | |||
| 1001 | Ga0207691_10091844 | |||
| 1002 | Ga0207691_10099680 | |||
| 1003 | Ga0207691_10351922 | |||
| 1004 | Ga0207689_10170984 | |||
| 1005 | Ga0207689_10384975 | |||
| 1006 | Ga0207689_10562761 | |||
| 1007 | Ga0207661_10006850 | |||
| 1008 | Ga0207661_10159116 | |||
| 1009 | Ga0207679_10077118 | |||
| 1010 | Ga0207679_10405091 | |||
| 1011 | Ga0207667_10618980 | |||
| 1012 | Ga0207667_10673744 | |||
| 1013 | Ga0207651_10439339 | |||
| 1014 | Ga0207712_10114770 | |||
| 1015 | Ga0207668_10045504 | |||
| 1016 | Ga0207668_10526862 | |||
| 1017 | Ga0207640_10267676 | |||
| 1018 | Ga0207658_10596603 | |||
| 1019 | Ga0207677_10084159 | |||
| 1020 | Ga0207677_10165622 | |||
| 1021 | Ga0207677_10394039 | |||
| 1022 | Ga0207677_10396474 | |||
| 1023 | Ga0207703_10177796 | |||
| 1024 | Ga0207639_10009827 | |||
| 1025 | Ga0207639_10252529 | |||
| 1026 | Ga0207678_10040907 | |||
| 1027 | Ga0207678_10064008 | |||
| 1028 | Ga0207678_10141276 | |||
| 1029 | Ga0207678_10455522 | |||
| 1030 | Ga0207708_10029150 | |||
| 1031 | Ga0207708_10071594 | |||
| 1032 | Ga0207708_10139977 | |||
| 1033 | Ga0207708_10497305 | |||
| 1034 | Ga0207702_10028914 | |||
| 1035 | Ga0207702_10484214 | |||
| 1036 | Ga0207648_10059070 | |||
| 1037 | Ga0207648_10082012 | |||
| 1038 | Ga0207648_10484480 | |||
| 1039 | Ga0207676_10024777 | |||
| 1040 | Ga0207676_10421086 | |||
| 1041 | Ga0207674_10340850 | |||
| 1042 | Ga0207675_100504826 | |||
| 1043 | Ga0207683_10006492 | |||
| 1044 | Ga0207683_10040843 | |||
| 1045 | Ga0207683_10069950 | |||
| 1046 | Ga0207683_10269823 | |||
| 1047 | Ga0207683_10297316 | |||
| 1048 | Ga0207698_10222047 | |||
| 1049 | Ga0207698_10541106 | |||
| 1050 | Ga0207428_10000616 | |||
| 1051 | Ga0207428_10015169 | |||
| 1052 | Ga0207428_10086222 | |||
| 1053 | Ga0207428_10177793 | |||
| 1054 | Ga0268266_10044661 | |||
| 1055 | Ga0268266_11108335 | |||
| 1056 | Ga0307408_100253735 | |||
| 1057 | Ga0307405_10021940 | |||
| 1058 | Ga0307405_10050742 | |||
| 1059 | Ga0307405_10372766 | |||
| 1060 | Ga0307413_10040164 | |||
| 1061 | Ga0307406_10024504 | |||
| 1062 | Ga0307406_10111617 | |||
| 1063 | Ga0307406_10178661 | |||
| 1064 | Ga0307407_10056789 | |||
| 1065 | Ga0307412_10013446 | |||
| 1066 | Ga0307409_100027370 | |||
| 1067 | Ga0307409_100089066 | |||
| 1068 | Ga0307409_100176533 | |||
| 1069 | Ga0307409_100224583 | |||
| 1070 | Ga0307416_100007300 | |||
| 1071 | Ga0307416_100037867 | |||
| 1072 | Ga0307416_100100233 | |||
| 1073 | Ga0307416_101068232 | |||
| 1074 | Ga0307414_10101969 | |||
| 1075 | Ga0307415_100008009 | |||
| 1076 | Ga0307415_100009850 | |||
| 1077 | Ga0307415_100226645 | |||
| 1078 | Ga0373930_0009177 | |||
| 1079 | Ga0373938_0070553 | |||
| 1080 | Ga0373943_0079191 | |||
| 1081 | Ga0373931_0139776 | |||
| 1082 | Ga0373947_0001805 | |||
| 1083 | Ga0373925_0009072 | |||
| 1084 | Ga0395899_0009994 | |||
| 1085 | Ga0395899_0019116 | |||
| 1086 | Ga0395899_0027148 | |||
| 1087 | Ga0395899_0060632 | |||
| 1088 | Ga0395899_0238702 | |||
| 1089 | Ga0395899_0243526 | |||
| 1090 | Ga0395899_0263027 | |||
| 1091 | Ga0395899_0337494 | |||
| 1092 | Ga0395900_0000672 | |||
| 1093 | Ga0395900_0016135 | |||
| 1094 | Ga0395900_0019167 | |||
| 1095 | Ga0395900_0019349 | |||
| 1096 | Ga0395900_0072732 | |||
| 1097 | Ga0395900_0371235 | |||
| 1098 | Ga0395900_0411929 | |||
| 1099 | Ga0395900_0851726 | |||
| 1100 | Ga0395898_0010163 | |||
| 1101 | Ga0395898_0012873 | |||
| 1102 | Ga0395898_0013953 | |||
| 1103 | Ga0395898_0017705 | |||
| 1104 | Ga0395898_0021932 | |||
| 1105 | Ga0395898_0026880 | |||
| 1106 | Ga0395898_0030915 | |||
| 1107 | Ga0395898_0104380 | |||
| 1108 | Ga0395898_0152102 | |||
| 1109 | Ga0395898_0165462 | |||
| 1110 | Ga0395898_0326656 | |||
| 1111 | Ga0395898_0668387 | |||
| 1112 | Ga0395905_0016268 | |||
| 1113 | Ga0395905_0021201 | |||
| 1114 | Ga0395905_0033503 | |||
| 1115 | Ga0395905_0066619 | |||
| 1116 | Ga0395905_0076612 | |||
| 1117 | Ga0395905_0137279 | |||
| 1118 | Ga0395905_0144145 | |||
| 1119 | Ga0395905_0182443 | |||
| 1120 | Ga0395905_0199038 | |||
| 1121 | Ga0395905_0271508 | |||
| 1122 | Ga0395905_0317876 | |||
| 1123 | Ga0395905_0484045 | |||
| 1124 | Ga0395901_0003116 | |||
| 1125 | Ga0395901_0005130 | |||
| 1126 | Ga0395901_0009295 | |||
| 1127 | Ga0395901_0011511 | |||
| 1128 | Ga0395901_0036763 | |||
| 1129 | Ga0395901_0049487 | |||
| 1130 | Ga0395901_0062002 | |||
| 1131 | Ga0395901_0091605 | |||
| 1132 | Ga0395901_0129312 | |||
| 1133 | Ga0395901_0204064 | |||
| 1134 | Ga0395901_0226285 | |||
| 1135 | Ga0395901_0398483 | |||
| 1136 | Ga0395901_1118788 | |||
| 1137 | Ga0439453_0007341 | |||
| 1138 | Ga0439461_0014244 | |||
| 1139 | Ga0451853_0017336 | |||
| 1140 | Ga0439431_0034869 | |||
| 1141 | Ga0439433_0003150 | |||
| 1142 | Ga0439449_0046816 | |||
| 1143 | Ga0439451_013274 | |||
| 1144 | Ga0439462_0004141 | |||
| 1145 | Ga0450923_049887 | |||
| 1146 | Ga0439446_0003664 | |||
| 1147 | Ga0439446_0022727 | |||
| 1148 | Ga0439434_0018470 | |||
| 1149 | Ga0439434_0073923 | |||
| 1150 | Ga0439435_0012367 | |||
| 1151 | Ga0450918_017009 | |||
| 1152 | Ga0451576_0383715 | |||
| 1153 | Ga0451576_0713680 | |||
| 1154 | Ga0495603_0026358 | |||
| 1155 | Ga0495629_0187113 | |||
| 1156 | Ga0495641_0147132 | |||
| 1157 | Ga0495584_0114995 | |||
| 1158 | Ga0495594_0221165 | |||
| 1159 | Ga0495596_0065083 | |||
| 1160 | Ga0495630_0084956 | |||
| 1161 | Ga0495630_0134753 | |||
| 1162 | Ga0495644_0150572 | |||
| 1163 | Ga0495663_0006977 | |||
| 1164 | Ga0495586_0025563 | |||
| 1165 | Ga0495656_0085338 | |||
| 1166 | Ga0495656_0172281 | |||
| 1167 | Ga0495658_0066558 | |||
| 1168 | Ga0495624_0108440 | |||
| 1169 | Ga0495589_0143189 | |||
| 1170 | Ga0495676_0475201 | |||
| 1171 | Ga0496101_0130127 | |||
| 1172 | Ga0496101_0499112 | |||
| 1173 | Ga0496101_0610686 | |||
| 1174 | Ga0496102_0014207 | |||
| 1175 | Ga0496102_0574308 | |||
| 1176 | Ga0496102_0583173 | |||
| 1177 | Ga0496103_0002770 | |||
| 1178 | Ga0496104_0036459 | |||
| 1179 | Ga0496104_0038609 | |||
| 1180 | Ga0496104_0328130 | |||
| 1181 | Ga0496104_0346003 | |||
| 1182 | Ga0496105_0071558 | |||
| 1183 | Ga0496106_0227132 | |||
| 1184 | Ga0496107_0068959 | |||
| 1185 | Ga0496108_0031277 | |||
| 1186 | Ga0496108_0116015 | |||
| 1187 | Ga0496108_0465927 | |||
| 1188 | Ga0496110_0051029 | |||
| 1189 | Ga0496110_0126882 | |||
| 1190 | Ga0496110_0205939 | |||
| 1191 | Ga0496110_0224234 | |||
| 1192 | Ga0496111_0018202 | |||
| 1193 | Ga0496111_0032088 | |||
| 1194 | Ga0496111_0088175 | |||
| 1195 | Ga0496112_0484127 | |||
| 1196 | Ga0496113_0156754 | |||
| 1197 | Ga0496114_0049486 | |||
| 1198 | Ga0496114_0101503 | |||
| 1199 | Ga0496114_0220192 | |||
| 1200 | Ga0501031_0008367 | |||
| 1201 | Ga0501031_0009260 | |||
| 1202 | Ga0501031_0025391 | |||
| 1203 | Ga0501031_0218843 | |||
| 1204 | Ga0501032_0019947 | |||
| 1205 | Ga0501032_0054782 | |||
| 1206 | Ga0501033_0016515 | |||
| 1207 | Ga0501033_0096748 | |||
| 1208 | Ga0501033_0120851 | |||
| 1209 | Ga0501033_0136568 | |||
| 1210 | Ga0501033_0329138 | |||
| 1211 | Ga0501034_0150188 | |||
| 1212 | Ga0501034_0271792 | |||
| 1213 | Ga0501036_0004235 | |||
| 1214 | Ga0501036_0016320 | |||
| 1215 | Ga0501036_0019484 | |||
| 1216 | Ga0501036_0022712 | |||
| 1217 | Ga0501036_0041300 | |||
| 1218 | Ga0501036_0063480 | |||
| 1219 | Ga0501037_0042351 | |||
| 1220 | Ga0501037_0122830 | |||
| 1221 | Ga0501037_0288839 | |||
| 1222 | Ga0501038_0021115 | |||
| 1223 | Ga0501038_0022053 | |||
| 1224 | Ga0501038_0028893 | |||
| 1225 | Ga0501039_0029315 | |||
| 1226 | Ga0501039_0062172 | |||
| 1227 | Ga0501039_0067219 | |||
| 1228 | Ga0501039_0074183 | |||
| 1229 | Ga0501039_0091517 | |||
| 1230 | Ga0501039_0186062 | |||
| 1231 | Ga0501039_0610964 | |||
| 1232 | Ga0501040_0010581 | |||
| 1233 | Ga0501040_0011857 | |||
| 1234 | Ga0501040_0014319 | |||
| 1235 | Ga0501040_0025565 | |||
| 1236 | Ga0501040_0063898 | |||
| 1237 | Ga0501040_0217892 | |||
| 1238 | Ga0501040_0286854 | |||
| 1239 | Ga0501041_0006637 | |||
| 1240 | Ga0501041_0007584 | |||
| 1241 | Ga0501041_0008596 | |||
| 1242 | Ga0501041_0009544 | |||
| 1243 | Ga0501041_0019049 | |||
| 1244 | Ga0501041_0482825 | |||
| 1245 | Ga0501042_0000441 | |||
| 1246 | Ga0501042_0002574 | |||
| 1247 | Ga0501042_0014381 | |||
| 1248 | Ga0501042_0022949 | |||
| 1249 | Ga0501042_0052522 | |||
| 1250 | Ga0501042_0135859 | |||
| 1251 | Ga0501042_0137837 | |||
| 1252 | Ga0501042_0469104 | |||
| 1253 | Ga0501043_0057963 | |||
| 1254 | Ga0501043_0108777 | |||
| 1255 | Ga0501043_0455890 | |||
| 1256 | Ga0501046_0002052 | |||
| 1257 | Ga0501046_0005519 | |||
| 1258 | Ga0501046_0032575 | |||
| 1259 | Ga0501046_0280174 | |||
| 1260 | Ga0501046_0431988 | |||
| 1261 | Ga0501046_0536598 | |||
| 1262 | Ga0501047_0379163 | |||
| 1263 | Ga0501047_0674864 | |||
| 1264 | Ga0501048_0002595 | |||
| 1265 | Ga0501048_0011844 | |||
| 1266 | Ga0501048_0017118 | |||
| 1267 | Ga0501048_0063657 | |||
| 1268 | Ga0501048_0088042 | |||
| 1269 | Ga0501048_0176836 | |||
| 1270 | Ga0501048_0376595 | |||
| 1271 | Ga0501048_0595288 | |||
| 1272 | Ga0501067_0403792 | |||
| 1273 | Ga0501068_0001633 | |||
| 1274 | Ga0501068_0033710 | |||
| 1275 | Ga0501068_0053928 | |||
| 1276 | Ga0501068_0159986 | |||
| 1277 | Ga0501068_0168004 | |||
| 1278 | Ga0501068_0168969 | |||
| 1279 | Ga0501069_0104424 | |||
| 1280 | Ga0501069_0228693 | |||
| 1281 | Ga0501069_0243499 | |||
| 1282 | Ga0501070_0080649 | |||
| 1283 | Ga0501070_0110290 | |||
| 1284 | Ga0501070_0367836 | |||
| 1285 | Ga0501070_0483736 | |||
| 1286 | Ga0501071_0012115 | |||
| 1287 | Ga0501071_0012611 | |||
| 1288 | Ga0501071_0014388 | |||
| 1289 | Ga0501071_0048698 | |||
| 1290 | Ga0501071_0065122 | |||
| 1291 | Ga0501071_0119307 | |||
| 1292 | Ga0501071_0214379 | |||
| 1293 | Ga0501071_0565721 | |||
| 1294 | Ga0501072_0000735 | |||
| 1295 | Ga0501072_0006457 | |||
| 1296 | Ga0501072_0008774 | |||
| 1297 | Ga0501072_0020922 | |||
| 1298 | Ga0501072_0036036 | |||
| 1299 | Ga0501072_0086824 | |||
| 1300 | Ga0501072_0147449 | |||
| 1301 | Ga0501072_0364342 | |||
| 1302 | Ga0501073_0030002 | |||
| 1303 | Ga0501074_0002379 | |||
| 1304 | Ga0501074_0025235 | |||
| 1305 | Ga0501074_0083473 | |||
| 1306 | Ga0501074_0302040 | |||
| 1307 | Ga0501075_0012546 | |||
| 1308 | Ga0501075_0032012 | |||
| 1309 | Ga0501075_0124610 | |||
| 1310 | Ga0501075_0126200 | |||
| 1311 | Ga0501075_0176216 | |||
| 1312 | Ga0501076_0008053 | |||
| 1313 | Ga0501076_0021974 | |||
| 1314 | Ga0501076_0026124 | |||
| 1315 | Ga0501076_0044145 | |||
| 1316 | Ga0501076_0066295 | |||
| 1317 | Ga0501076_0157351 | |||
| 1318 | Ga0501076_0228651 | |||
| 1319 | Ga0501076_0249705 | |||
| 1320 | Ga0501076_0287867 | |||
| 1321 | Ga0501077_0000885 | |||
| 1322 | Ga0501077_0025285 | |||
| 1323 | Ga0501077_0038111 | |||
| 1324 | Ga0501077_0073148 | |||
| 1325 | Ga0501077_0115122 | |||
| 1326 | Ga0501077_0156503 | |||
| 1327 | Ga0501077_0219525 | |||
| 1328 | Ga0501233_020491 | |||
| 1329 | Ga0501079_0009303 | |||
| 1330 | Ga0501079_0070893 | |||
| 1331 | Ga0501079_0082959 | |||
| 1332 | Ga0501079_0083661 | |||
| 1333 | Ga0501079_0125792 | |||
| 1334 | Ga0501080_0002230 | |||
| 1335 | Ga0501080_0017960 | |||
| 1336 | Ga0501080_0021884 | |||
| 1337 | Ga0501080_0027304 | |||
| 1338 | Ga0501080_0061509 | |||
| 1339 | Ga0501080_0170262 | |||
| 1340 | Ga0501080_0748257 | |||
| 1341 | Ga0501081_0005847 | |||
| 1342 | Ga0501081_0008382 | |||
| 1343 | Ga0501081_0055723 | |||
| 1344 | Ga0501081_0065503 | |||
| 1345 | Ga0501081_0075562 | |||
| 1346 | Ga0501081_0282834 | |||
| 1347 | Ga0501081_0590508 | |||
| 1348 | Ga0501083_0063983 | |||
| 1349 | Ga0501083_0238022 | |||
| 1350 | Ga0501035_0022962 | |||
| 1351 | Ga0501035_0029556 | |||
| 1352 | Ga0501035_0029940 | |||
| 1353 | Ga0501035_0776175 | |||
| 1354 | Ga0501044_0133072 | |||
| 1355 | Ga0501045_0000823 | |||
| 1356 | Ga0501045_0009423 | |||
| 1357 | Ga0501045_0039661 | |||
| 1358 | Ga0501045_0074044 | |||
| 1359 | Ga0501045_0085081 | |||
| 1360 | Ga0501045_0176644 | |||
| 1361 | Ga0501045_0470065 | |||
| 1362 | nmdc:mga00v17_281630_c1 | |||
| 1363 | nmdc:mga0yw44_27835_c1 | |||
| 1364 | nmdc:mga05p37_16558_c1 | |||
| 1365 | nmdc:mga05p37_40133_c1 | |||
| 1366 | nmdc:mga05p37_43395_c1 | |||
| 1367 | nmdc:mga05p37_452670_c1 | |||
| 1368 | nmdc:mga05p37_87920_c1 | |||
| 1369 | nmdc:mga09592_15345_c1 | |||
| 1370 | nmdc:mga09592_246881_c1 | |||
| 1371 | nmdc:mga0qj67_348709_c1 | |||
| 1372 | nmdc:mga0qj67_448208_c1 | |||
| 1373 | nmdc:mga06r32_34305_c1 | |||
| 1374 | nmdc:mga06r32_6256_c1 | |||
| 1375 | nmdc:mga08y16_108075_c1 | |||
| 1376 | nmdc:mga08y16_19639_c1 | |||
| 1377 | nmdc:mga08y16_444438_c1 | |||
| 1378 | nmdc:mga08y16_47453_c1 | |||
| 1379 | nmdc:mga08y16_91910_c1 | |||
| 1380 | nmdc:mga0n895_45637_c1 | |||
| 1381 | nmdc:mga0n895_517307_c1 | |||
| 1382 | nmdc:mga0rr50_2921_c1 | |||
| 1383 | nmdc:mga08x19_5927_c1 | |||
| 1384 | nmdc:mga0a205_123505_c1 | |||
| 1385 | Ga0495655_0002969 | |||
| 1386 | Ga0501084_0010166 | |||
| 1387 | Ga0501084_0019340 | |||
| 1388 | Ga0501084_0048439 | |||
| 1389 | Ga0501084_0093846 | |||
| 1390 | Ga0501084_0120349 | |||
| 1391 | Ga0501084_0145148 | |||
| 1392 | Ga0501084_0179559 | |||
| 1393 | Ga0590075_013270 | |||
| 1394 | Ga0590075_043626 | |||
| 1395 | Ga0590077_034813 | |||
| 1396 | Ga0501082_0007159 | |||
| 1397 | Ga0501082_0041366 | |||
| 1398 | Ga0501082_0061741 | |||
| 1399 | Ga0501082_0300647 | |||
| 1400 | Ga0501082_0361290 | |||
| 1401 | Ga0501082_0548241 | |||
| 1402 | Ga0501082_0570733 | |||
| 1403 | Ga0501082_0597795 | |||
| 1404 | Ga0530510_0003263 | |||
| 1405 | Ga0530510_0018543 | |||
| 1406 | Ga0530510_0041743 | |||
| 1407 | Ga0530510_0054130 | |||
| 1408 | Ga0530510_0161726 | |||
| 1409 | Ga0530510_0180253 | |||
| 1410 | Ga0530510_0378003 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
37
226
0.89
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.7912 | 20 | 166 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7862 | 9 | 162 |
| 3fh6-assembly2.cif.gz_H | crystal structure of the resting state maltose transporter from e. coli | 0.7686 | 19 | 159 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7512 | 8 | 162 |
| 3pv0-assembly1.cif.gz_F | crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide | 0.7512 | 11 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WG11_24_299_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8709 | 19 | 157 | 1.10.3720.10 |
| af_P07654_38_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8704 | 17 | 157 | 1.10.3720.10 |
| af_Q58419_14_276_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8456 | 19 | 157 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8206 | 7 | 224 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7913 | 1 | 224 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0WC32-F1-model_v4 | Amino acid ABC transporter permease | 0.9882 | 1 | 167 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A7W0WC32-F1-model_v4 | Amino acid ABC transporter permease | 0.9766 | 1 | 167 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A4P6EMV3-F1-model_v4 | ABC transporter permease subunit | 0.9489 | 2 | 148 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A538MMI1-F1-model_v4 | ABC transporter permease subunit | 0.945 | 1 | 128 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A538MMI1-F1-model_v4 | ABC transporter permease subunit | 0.938 | 1 | 128 |
GO:0006865
GO:0022857 GO:0043190 |