F476413

General Info

Members Datasets Scaffolds Average Seq Length
705 267 1410 227

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0027625|Ga0395900_0027625_4214_4894
Length 226
Sequence VADFFHLPDWAGPVARYMLHTGLPGTLRIAVFAVLGAALVGMVLGTLMTVRFEPVRWLIRLYIEVWRGLPIIVTIFILYFALPDLHVRMSAFNAATLGLILWGSAQVAEATRGAIQSVPREQHEAAAALGFGWVGTQVNVIFPQAFRRLLPPLVSLLVNVIQNTTIAALIGVSEVLQSGQRSVERLQFVPPGNSHAFEIYGAVLVMFFVISFPLTRLAAYLEKRLA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
176 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
179 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
184 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
185 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
186 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
187 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
200 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
252 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 4.11
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 10.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0027625 3300037418 Bacteria 5813
2 JGI24743J22301_10048364 3300001991 Bacteria 863
3 JGI24738J21930_10007013 3300002075 Bacteria 2618
4 Ga0070658_10014552 3300005327 Bacteria 6314
5 Ga0070683_100030326 3300005329 Bacteria 4907
6 Ga0070683_100105303 3300005329 Unclassified 2659
7 Ga0070683_100214150 3300005329 Bacteria 1830
8 Ga0070690_100139104 3300005330 Bacteria 1647
9 Ga0070670_100538741 3300005331 Bacteria 1041
10 Ga0068869_100252251 3300005334 Bacteria 1410
11 Ga0068869_100265028 3300005334 Bacteria 1376
12 Ga0068869_100338183 3300005334 Bacteria 1224
13 Ga0070666_10214050 3300005335 Bacteria 1358
14 Ga0070680_100123408 3300005336 Bacteria 2163
15 Ga0070682_100430250 3300005337 Bacteria 1005
16 Ga0068868_100253424 3300005338 Unclassified 1482
17 Ga0068868_100262957 3300005338 Bacteria 1456
18 Ga0070660_100074437 3300005339 Bacteria 2657
19 Ga0070689_100062289 3300005340 Bacteria 2902
20 Ga0070689_100111475 3300005340 Bacteria 2176
21 Ga0070661_100033838 3300005344 Bacteria 3704
22 Ga0070661_100291093 3300005344 Bacteria 1269
23 Ga0070692_10022650 3300005345 Unclassified 3070
24 Ga0070692_10096548 3300005345 Bacteria 1614
25 Ga0070692_10183089 3300005345 Bacteria 1215
26 Ga0070668_100303001 3300005347 Bacteria 1341
27 Ga0070669_100296296 3300005353 Bacteria 1300
28 Ga0070675_100050447 3300005354 Unclassified 3416
29 Ga0070675_100101673 3300005354 Bacteria 2422
30 Ga0070675_100104384 3300005354 Bacteria 2391
31 Ga0070675_100132329 3300005354 Bacteria 2126
32 Ga0070675_100248494 3300005354 Bacteria 1556
33 Ga0070675_100322583 3300005354 Bacteria 1365
34 Ga0070671_100048938 3300005355 Bacteria 3517
35 Ga0070671_100111102 3300005355 Bacteria 2302
36 Ga0070671_100353299 3300005355 Bacteria 1255
37 Ga0070674_100030030 3300005356 Bacteria 3588
38 Ga0070674_100050159 3300005356 Bacteria 2873
39 Ga0070674_100059972 3300005356 Bacteria 2650
40 Ga0070674_100281708 3300005356 Unclassified 1318
41 Ga0070674_100407407 3300005356 Bacteria 1112
42 Ga0070673_100039231 3300005364 Bacteria 3622
43 Ga0070673_100198579 3300005364 Bacteria 1727
44 Ga0070688_100036085 3300005365 Bacteria 3005
45 Ga0070688_100089827 3300005365 Bacteria 2005
46 Ga0070659_100071734 3300005366 Bacteria 2754
47 Ga0070659_100374455 3300005366 Bacteria 1198
48 Ga0070659_100401753 3300005366 Bacteria 1157
49 Ga0070667_100283509 3300005367 Bacteria 1488
50 Ga0070703_10153159 3300005406 Bacteria 868
51 Ga0070714_100460514 3300005435 Bacteria 1209
52 Ga0070701_10042963 3300005438 Bacteria 2310
53 Ga0070701_10190687 3300005438 Bacteria 1206
54 Ga0070701_10439882 3300005438 Bacteria 835
55 Ga0070711_100181434 3300005439 Bacteria 1612
56 Ga0070705_100084770 3300005440 Bacteria 1956
57 Ga0070700_100015707 3300005441 Bacteria 4299
58 Ga0070700_100042746 3300005441 Bacteria 2784
59 Ga0070694_100662394 3300005444 Bacteria 846
60 Ga0070708_100030728 3300005445 Bacteria 4644
61 Ga0070663_100249067 3300005455 Bacteria 1405
62 Ga0070678_100025390 3300005456 Bacteria 3985
63 Ga0070678_100145655 3300005456 Bacteria 1901
64 Ga0070678_100277516 3300005456 Bacteria 1416
65 Ga0070678_100338090 3300005456 Bacteria 1291
66 Ga0070662_100059385 3300005457 Bacteria 2786
67 Ga0070662_100312888 3300005457 Bacteria 1279
68 Ga0070662_100315041 3300005457 Bacteria 1274
69 Ga0070681_10036083 3300005458 Bacteria 4966
70 Ga0070681_10118500 3300005458 Bacteria 2584
71 Ga0068867_100062420 3300005459 Bacteria 2768
72 Ga0068867_100215746 3300005459 Bacteria 1543
73 Ga0068867_100936208 3300005459 Bacteria 782
74 Ga0070685_10152277 3300005466 Bacteria 1466
75 Ga0070706_100548974 3300005467 Bacteria 1075
76 Ga0070698_100165233 3300005471 Bacteria 2156
77 Ga0070699_100057094 3300005518 Bacteria 3381
78 Ga0070679_100002810 3300005530 Bacteria 15819
79 Ga0070679_100311215 3300005530 Bacteria 1525
80 Ga0070684_100001001 3300005535 Bacteria 20112
81 Ga0070684_100086582 3300005535 Bacteria 2780
82 Ga0070684_100089423 3300005535 Bacteria 2737
83 Ga0070684_100143229 3300005535 Unclassified 2162
84 Ga0070684_100272546 3300005535 Bacteria 1549
85 Ga0070697_100821624 3300005536 Bacteria 823
86 Ga0068853_100040586 3300005539 Bacteria 3971
87 Ga0070672_100078785 3300005543 Bacteria 2636
88 Ga0070672_100103769 3300005543 Bacteria 2309
89 Ga0070686_100059129 3300005544 Bacteria 2468
90 Ga0070686_100070653 3300005544 Bacteria 2284
91 Ga0070686_100208275 3300005544 Bacteria 1406
92 Ga0070695_100341999 3300005545 Bacteria 1118
93 Ga0070696_100408586 3300005546 Bacteria 1064
94 Ga0070696_100571954 3300005546 Bacteria 908
95 Ga0070693_100002648 3300005547 Bacteria 8244
96 Ga0070693_100381266 3300005547 Bacteria 973
97 Ga0070665_100061791 3300005548 Bacteria 3755
98 Ga0070665_100272407 3300005548 Bacteria 1695
99 Ga0070665_100635100 3300005548 Bacteria 1081
100 Ga0070704_100203563 3300005549 Bacteria 1600
101 Ga0068855_100120961 3300005563 Bacteria 2996
102 Ga0068855_100514263 3300005563 Bacteria 1300
103 Ga0070664_100081999 3300005564 Unclassified 2780
104 Ga0070664_100265488 3300005564 Bacteria 1545
105 Ga0070664_100455141 3300005564 Bacteria 1175
106 Ga0070664_100734637 3300005564 Unclassified 921
107 Ga0068854_100068446 3300005578 Bacteria 2589
108 Ga0068854_100068936 3300005578 Unclassified 2580
109 Ga0068854_100157985 3300005578 Bacteria 1754
110 Ga0068854_100599098 3300005578 Bacteria 941
111 Ga0068856_100022134 3300005614 Bacteria 6180
112 Ga0068856_100655765 3300005614 Bacteria 1070
113 Ga0070702_100078783 3300005615 Bacteria 1968
114 Ga0070702_100328558 3300005615 Bacteria 1068
115 Ga0068852_100044266 3300005616 Bacteria 3779
116 Ga0068852_100698048 3300005616 Bacteria 1025
117 Ga0068859_101148816 3300005617 Bacteria 855
118 Ga0068864_100010668 3300005618 Bacteria 7595
119 Ga0068864_100139626 3300005618 Bacteria 2185
120 Ga0068866_10045660 3300005718 Bacteria 2199
121 Ga0068861_100120831 3300005719 Bacteria 2113
122 Ga0068861_100497312 3300005719 Bacteria 1102
123 Ga0068851_10207547 3300005834 Bacteria 1096
124 Ga0068851_10218550 3300005834 Bacteria 1070
125 Ga0068870_10017694 3300005840 Bacteria 3428
126 Ga0068863_100319115 3300005841 Bacteria 1509
127 Ga0068863_100405395 3300005841 Bacteria 1334
128 Ga0068858_100031474 3300005842 Bacteria 4927
129 Ga0068860_100228134 3300005843 Bacteria 1809
130 Ga0068862_100330968 3300005844 Bacteria 1408
131 Ga0068862_100335245 3300005844 Bacteria 1400
132 Ga0081455_10001861 3300005937 Bacteria 25391
133 Ga0081455_10034264 3300005937 Bacteria 4552
134 Ga0081455_10036893 3300005937 Bacteria 4346
135 Ga0081455_10046668 3300005937 Bacteria 3756
136 Ga0081455_10204763 3300005937 Bacteria 1475
137 Ga0081455_10380441 3300005937 Bacteria 986
138 Ga0081455_10462538 3300005937 Bacteria 863
139 Ga0081539_10001335 3300005985 Bacteria 42960
140 Ga0081539_10139239 3300005985 Bacteria 1181
141 Ga0075365_10044653 3300006038 Unclassified 2905
142 Ga0075432_10004132 3300006058 Bacteria 4953
143 Ga0097621_100056538 3300006237 Bacteria 3206
144 Ga0097621_100245042 3300006237 Unclassified 1568
145 Ga0068871_100144363 3300006358 Bacteria 2025
146 Ga0068871_100167649 3300006358 Bacteria 1881
147 Ga0068871_100487270 3300006358 Bacteria 1110
148 Ga0075428_100028279 3300006844 Bacteria 6201
149 Ga0075428_100144090 3300006844 Bacteria 2590
150 Ga0075428_100359630 3300006844 Bacteria 1562
151 Ga0075428_100682445 3300006844 Bacteria 1095
152 Ga0075430_100644725 3300006846 Bacteria 873
153 Ga0075431_100006254 3300006847 Bacteria 11832
154 Ga0075431_100041551 3300006847 Bacteria 4741
155 Ga0075431_100292724 3300006847 Bacteria 1646
156 Ga0075433_10045622 3300006852 Bacteria 3810
157 Ga0075433_10149203 3300006852 Bacteria 2079
158 Ga0075434_100400816 3300006871 Bacteria 1393
159 Ga0075429_100038392 3300006880 Bacteria 4168
160 Ga0075429_100043419 3300006880 Bacteria 3912
161 Ga0068865_100024294 3300006881 Bacteria 3974
162 Ga0068865_100147614 3300006881 Bacteria 1780
163 Ga0075436_100019331 3300006914 Bacteria 4669
164 Ga0097620_101148696 3300006931 Bacteria 855
165 Ga0111539_10060383 3300009094 Bacteria 4493
166 Ga0111539_10073822 3300009094 Bacteria 4021
167 Ga0111539_10200581 3300009094 Unclassified 2327
168 Ga0111539_10210949 3300009094 Bacteria 2263
169 Ga0111539_10261331 3300009094 Bacteria 2015
170 Ga0111539_11365623 3300009094 Unclassified 822
171 Ga0105245_10045161 3300009098 Bacteria 3934
172 Ga0105245_10047827 3300009098 Bacteria 3825
173 Ga0105245_10231403 3300009098 Bacteria 1788
174 Ga0105245_10235222 3300009098 Bacteria 1773
175 Ga0105245_10266091 3300009098 Bacteria 1670
176 Ga0105245_10328797 3300009098 Bacteria 1508
177 Ga0105245_11029712 3300009098 Bacteria 868
178 Ga0105247_10051620 3300009101 Bacteria 2533
179 Ga0114129_10085229 3300009147 Bacteria 4383
180 Ga0114129_10090048 3300009147 Bacteria 4253
181 Ga0114129_10290134 3300009147 Bacteria 2183
182 Ga0114129_10767583 3300009147 Unclassified 1233
183 Ga0114129_10829694 3300009147 Unclassified 1177
184 Ga0105243_10032600 3300009148 Bacteria 4026
185 Ga0105243_10070969 3300009148 Bacteria 2815
186 Ga0105243_10202073 3300009148 Bacteria 1743
187 Ga0105243_10364113 3300009148 Bacteria 1332
188 Ga0105243_10404113 3300009148 Bacteria 1270
189 Ga0105243_10621653 3300009148 Bacteria 1043
190 Ga0105243_11277198 3300009148 Unclassified 750
191 Ga0105241_10083061 3300009174 Bacteria 2512
192 Ga0105242_10056351 3300009176 Bacteria 3216
193 Ga0105242_10079642 3300009176 Bacteria 2736
194 Ga0105242_10346173 3300009176 Bacteria 1371
195 Ga0105242_10459762 3300009176 Unclassified 1202
196 Ga0105242_10540647 3300009176 Bacteria 1115
197 Ga0105248_10059033 3300009177 Bacteria 4309
198 Ga0105248_10772830 3300009177 Bacteria 1084
199 Ga0105248_10903844 3300009177 Unclassified 997
200 Ga0105238_10097055 3300009551 Bacteria 2933
201 Ga0105238_10176567 3300009551 Bacteria 2113
202 Ga0105238_10307207 3300009551 Bacteria 1570
203 Ga0105249_10189391 3300009553 Bacteria 2007
204 Ga0105249_10196626 3300009553 Bacteria 1971
205 Ga0105239_10006421 3300010375 Bacteria 13645
206 Ga0105239_10213106 3300010375 Bacteria 2165
207 Ga0105239_10965761 3300010375 Bacteria 979
208 Ga0105246_10021900 3300011119 Bacteria 4120
209 Ga0105246_10086556 3300011119 Bacteria 2247
210 Ga0105246_10126267 3300011119 Bacteria 1903
211 Ga0105246_10339463 3300011119 Unclassified 1227
212 Ga0157371_10054594 3300013102 Unclassified 2837
213 Ga0157371_10255448 3300013102 Unclassified 1263
214 Ga0157378_10276171 3300013297 Bacteria 1618
215 Ga0157378_10279811 3300013297 Bacteria 1608
216 Ga0157378_10309536 3300013297 Bacteria 1531
217 Ga0163162_10105934 3300013306 Bacteria 2906
218 Ga0163162_10172847 3300013306 Bacteria 2285
219 Ga0163162_10185649 3300013306 Bacteria 2206
220 Ga0157372_10230245 3300013307 Bacteria 2148
221 Ga0157372_10337114 3300013307 Bacteria 1756
222 Ga0157375_10126712 3300013308 Bacteria 2669
223 Ga0157375_10142029 3300013308 Bacteria 2529
224 Ga0157375_10156153 3300013308 Bacteria 2420
225 Ga0157375_10262534 3300013308 Bacteria 1888
226 Ga0157375_10498123 3300013308 Unclassified 1382
227 Ga0157375_10672747 3300013308 Bacteria 1190
228 Ga0163163_10028019 3300014325 Bacteria 5405
229 Ga0163163_10033206 3300014325 Bacteria 4990
230 Ga0163163_10682824 3300014325 Unclassified 1090
231 Ga0157380_10101514 3300014326 Bacteria 2397
232 Ga0157380_10414655 3300014326 Bacteria 1282
233 Ga0157380_10615235 3300014326 Bacteria 1077
234 Ga0157377_10052379 3300014745 Bacteria 2304
235 Ga0157377_10233924 3300014745 Bacteria 1183
236 Ga0157379_10164367 3300014968 Bacteria 2003
237 Ga0157379_10191131 3300014968 Unclassified 1850
238 Ga0157376_10055228 3300014969 Bacteria 3313
239 Ga0157376_10422039 3300014969 Bacteria 1295
240 Ga0157376_10452161 3300014969 Bacteria 1253
241 Ga0157376_10647728 3300014969 Bacteria 1057
242 Ga0163161_10034765 3300017792 Bacteria 3605
243 Ga0207642_10365664 3300025899 Bacteria 855
244 Ga0207710_10044822 3300025900 Bacteria 1971
245 Ga0207688_10007691 3300025901 Bacteria 5869
246 Ga0207688_10026359 3300025901 Bacteria 3196
247 Ga0207688_10043270 3300025901 Bacteria 2507
248 Ga0207645_10033387 3300025907 Bacteria 3308
249 Ga0207643_10009991 3300025908 Bacteria 5101
250 Ga0207643_10054627 3300025908 Unclassified 2270
251 Ga0207643_10102730 3300025908 Bacteria 1677
252 Ga0207684_10410682 3300025910 Bacteria 1164
253 Ga0207707_10070930 3300025912 Bacteria 3036
254 Ga0207707_10587799 3300025912 Bacteria 943
255 Ga0207693_10296657 3300025915 Bacteria 1266
256 Ga0207663_10247214 3300025916 Unclassified 1311
257 Ga0207660_10097822 3300025917 Bacteria 2188
258 Ga0207662_10198230 3300025918 Bacteria 1298
259 Ga0207657_10005767 3300025919 Bacteria 12912
260 Ga0207652_10091740 3300025921 Bacteria 2671
261 Ga0207659_10065165 3300025926 Bacteria 2639
262 Ga0207659_10067506 3300025926 Bacteria 2598
263 Ga0207659_10131737 3300025926 Bacteria 1931
264 Ga0207659_10152138 3300025926 Bacteria 1808
265 Ga0207659_10190862 3300025926 Bacteria 1630
266 Ga0207687_10018548 3300025927 Bacteria 4596
267 Ga0207687_10096847 3300025927 Unclassified 2163
268 Ga0207687_10190056 3300025927 Bacteria 1597
269 Ga0207687_10221833 3300025927 Bacteria 1489
270 Ga0207687_10372083 3300025927 Bacteria 1169
271 Ga0207644_10095645 3300025931 Bacteria 2222
272 Ga0207644_10239232 3300025931 Bacteria 1445
273 Ga0207690_10175690 3300025932 Bacteria 1608
274 Ga0207706_10022764 3300025933 Bacteria 5624
275 Ga0207706_10076375 3300025933 Bacteria 2946
276 Ga0207706_10342136 3300025933 Bacteria 1301
277 Ga0207686_10008053 3300025934 Bacteria 5686
278 Ga0207686_10075825 3300025934 Bacteria 2178
279 Ga0207686_10256030 3300025934 Bacteria 1281
280 Ga0207709_10055713 3300025935 Unclassified 2444
281 Ga0207709_10129303 3300025935 Bacteria 1719
282 Ga0207709_10229450 3300025935 Bacteria 1344
283 Ga0207709_10357606 3300025935 Bacteria 1104
284 Ga0207709_10755456 3300025935 Unclassified 782
285 Ga0207670_10041414 3300025936 Bacteria 3029
286 Ga0207670_10224528 3300025936 Bacteria 1439
287 Ga0207669_10026984 3300025937 Bacteria 3135
288 Ga0207669_10077719 3300025937 Bacteria 2112
289 Ga0207669_10229405 3300025937 Unclassified 1369
290 Ga0207669_10349006 3300025937 Bacteria 1142
291 Ga0207704_10013025 3300025938 Bacteria 4147
292 Ga0207704_10194214 3300025938 Bacteria 1479
293 Ga0207704_10315831 3300025938 Bacteria 1203
294 Ga0207691_10015174 3300025940 Bacteria 7330
295 Ga0207691_10068001 3300025940 Bacteria 3219
296 Ga0207691_10091844 3300025940 Bacteria 2719
297 Ga0207691_10099680 3300025940 Bacteria 2594
298 Ga0207691_10351922 3300025940 Unclassified 1260
299 Ga0207689_10170984 3300025942 Bacteria 1791
300 Ga0207689_10384975 3300025942 Bacteria 1168
301 Ga0207689_10562761 3300025942 Unclassified 958
302 Ga0207661_10006850 3300025944 Bacteria 8077
303 Ga0207661_10159116 3300025944 Bacteria 1958
304 Ga0207679_10077118 3300025945 Bacteria 2534
305 Ga0207679_10405091 3300025945 Unclassified 1201
306 Ga0207667_10618980 3300025949 Bacteria 1090
307 Ga0207667_10673744 3300025949 Unclassified 1038
308 Ga0207651_10439339 3300025960 Bacteria 1117
309 Ga0207712_10114770 3300025961 Bacteria 2026
310 Ga0207668_10045504 3300025972 Bacteria 2994
311 Ga0207668_10526862 3300025972 Bacteria 1020
312 Ga0207640_10267676 3300025981 Bacteria 1335
313 Ga0207658_10596603 3300025986 Bacteria 992
314 Ga0207677_10084159 3300026023 Bacteria 2292
315 Ga0207677_10165622 3300026023 Bacteria 1722
316 Ga0207677_10394039 3300026023 Unclassified 1172
317 Ga0207677_10396474 3300026023 Bacteria 1169
318 Ga0207703_10177796 3300026035 Bacteria 1876
319 Ga0207639_10009827 3300026041 Bacteria 6612
320 Ga0207639_10252529 3300026041 Bacteria 1538
321 Ga0207678_10040907 3300026067 Bacteria 4019
322 Ga0207678_10064008 3300026067 Bacteria 3160
323 Ga0207678_10141276 3300026067 Bacteria 2055
324 Ga0207678_10455522 3300026067 Bacteria 1112
325 Ga0207708_10029150 3300026075 Bacteria 4181
326 Ga0207708_10071594 3300026075 Bacteria 2656
327 Ga0207708_10139977 3300026075 Bacteria 1897
328 Ga0207708_10497305 3300026075 Unclassified 1021
329 Ga0207702_10028914 3300026078 Bacteria 4610
330 Ga0207702_10484214 3300026078 Bacteria 1204
331 Ga0207648_10059070 3300026089 Bacteria 3344
332 Ga0207648_10082012 3300026089 Bacteria 2812
333 Ga0207648_10484480 3300026089 Bacteria 1130
334 Ga0207676_10024777 3300026095 Bacteria 4444
335 Ga0207676_10421086 3300026095 Bacteria 1252
336 Ga0207674_10340850 3300026116 Bacteria 1449
337 Ga0207675_100504826 3300026118 Unclassified 1204
338 Ga0207683_10006492 3300026121 Bacteria 10011
339 Ga0207683_10040843 3300026121 Bacteria 4050
340 Ga0207683_10069950 3300026121 Bacteria 3100
341 Ga0207683_10269823 3300026121 Bacteria 1554
342 Ga0207683_10297316 3300026121 Bacteria 1477
343 Ga0207698_10222047 3300026142 Bacteria 1708
344 Ga0207698_10541106 3300026142 Bacteria 1140
345 Ga0207428_10000616 3300027907 Bacteria 42107
346 Ga0207428_10015169 3300027907 Bacteria 6668
347 Ga0207428_10086222 3300027907 Unclassified 2444
348 Ga0207428_10177793 3300027907 Bacteria 1609
349 Ga0268266_10044661 3300028379 Bacteria 3788
350 Ga0268266_11108335 3300028379 Bacteria 766
351 Ga0307408_100253735 3300031548 Bacteria 1452
352 Ga0307405_10021940 3300031731 Bacteria 3600
353 Ga0307405_10050742 3300031731 Unclassified 2571
354 Ga0307405_10372766 3300031731 Unclassified 1108
355 Ga0307413_10040164 3300031824 Bacteria 2728
356 Ga0307406_10024504 3300031901 Bacteria 3605
357 Ga0307406_10111617 3300031901 Unclassified 1884
358 Ga0307406_10178661 3300031901 Bacteria 1543
359 Ga0307407_10056789 3300031903 Bacteria 2268
360 Ga0307412_10013446 3300031911 Bacteria 4802
361 Ga0307409_100027370 3300031995 Bacteria 4039
362 Ga0307409_100089066 3300031995 Bacteria 2521
363 Ga0307409_100176533 3300031995 Bacteria 1886
364 Ga0307409_100224583 3300031995 Bacteria 1698
365 Ga0307416_100007300 3300032002 Bacteria 7010
366 Ga0307416_100037867 3300032002 Bacteria 3716
367 Ga0307416_100100233 3300032002 Bacteria 2518
368 Ga0307416_101068232 3300032002 Unclassified 911
369 Ga0307414_10101969 3300032004 Bacteria 2162
370 Ga0307415_100008009 3300032126 Bacteria 5828
371 Ga0307415_100009850 3300032126 Bacteria 5384
372 Ga0307415_100226645 3300032126 Bacteria 1502
373 Ga0373930_0009177 3300034816 Bacteria 1746
374 Ga0373938_0070553 3300034957 Bacteria 834
375 Ga0373943_0079191 3300035170 Bacteria 1681
376 Ga0373931_0139776 3300035691 Bacteria 1401
377 Ga0373947_0001805 3300035725 Bacteria 13097
378 Ga0373925_0009072 3300037068 Bacteria 7240
379 Ga0395899_0009994 3300037312 Bacteria 7277
380 Ga0395899_0019116 3300037312 Bacteria 5207
381 Ga0395899_0027148 3300037312 Bacteria 4319
382 Ga0395899_0060632 3300037312 Bacteria 2787
383 Ga0395899_0238702 3300037312 Bacteria 1252
384 Ga0395899_0243526 3300037312 Bacteria 1237
385 Ga0395899_0263027 3300037312 Unclassified 1179
386 Ga0395899_0337494 3300037312 Bacteria 1011
387 Ga0395900_0000672 3300037418 Bacteria 45487
388 Ga0395900_0016135 3300037418 Bacteria 7609
389 Ga0395900_0019167 3300037418 Bacteria 6976
390 Ga0395900_0019349 3300037418 Bacteria 6946
391 Ga0395900_0072732 3300037418 Bacteria 3534
392 Ga0395900_0371235 3300037418 Unclassified 1400
393 Ga0395900_0411929 3300037418 Bacteria 1314
394 Ga0395900_0851726 3300037418 Unclassified 837
395 Ga0395898_0010163 3300037466 Bacteria 9849
396 Ga0395898_0012873 3300037466 Bacteria 8631
397 Ga0395898_0013953 3300037466 Bacteria 8258
398 Ga0395898_0017705 3300037466 Bacteria 7272
399 Ga0395898_0021932 3300037466 Bacteria 6469
400 Ga0395898_0026880 3300037466 Bacteria 5783
401 Ga0395898_0030915 3300037466 Bacteria 5356
402 Ga0395898_0104380 3300037466 Bacteria 2718
403 Ga0395898_0152102 3300037466 Bacteria 2214
404 Ga0395898_0165462 3300037466 Bacteria 2115
405 Ga0395898_0326656 3300037466 Bacteria 1463
406 Ga0395898_0668387 3300037466 Unclassified 981
407 Ga0395905_0016268 3300037471 Bacteria 7067
408 Ga0395905_0021201 3300037471 Bacteria 6149
409 Ga0395905_0033503 3300037471 Bacteria 4825
410 Ga0395905_0066619 3300037471 Bacteria 3372
411 Ga0395905_0076612 3300037471 Bacteria 3134
412 Ga0395905_0137279 3300037471 Unclassified 2301
413 Ga0395905_0144145 3300037471 Bacteria 2241
414 Ga0395905_0182443 3300037471 Bacteria 1970
415 Ga0395905_0199038 3300037471 Bacteria 1878
416 Ga0395905_0271508 3300037471 Unclassified 1582
417 Ga0395905_0317876 3300037471 Bacteria 1446
418 Ga0395905_0484045 3300037471 Bacteria 1137
419 Ga0395901_0003116 3300038443 Bacteria 16658
420 Ga0395901_0005130 3300038443 Bacteria 13221
421 Ga0395901_0009295 3300038443 Bacteria 9964
422 Ga0395901_0011511 3300038443 Bacteria 8965
423 Ga0395901_0036763 3300038443 Bacteria 5062
424 Ga0395901_0049487 3300038443 Bacteria 4367
425 Ga0395901_0062002 3300038443 Unclassified 3891
426 Ga0395901_0091605 3300038443 Bacteria 3182
427 Ga0395901_0129312 3300038443 Bacteria 2654
428 Ga0395901_0204064 3300038443 Bacteria 2071
429 Ga0395901_0226285 3300038443 Bacteria 1954
430 Ga0395901_0398483 3300038443 Bacteria 1414
431 Ga0395901_1118788 3300038443 Bacteria 757
432 Ga0439453_0007341 3300041408 Bacteria 1746
433 Ga0439461_0014244 3300041410 Bacteria 1510
434 Ga0451853_0017336 3300041512 Bacteria 2388
435 Ga0439431_0034869 3300041997 Bacteria 1263
436 Ga0439433_0003150 3300041999 Bacteria 3530
437 Ga0439449_0046816 3300042007 Bacteria 1602
438 Ga0439451_013274 3300042009 Bacteria 1665
439 Ga0439462_0004141 3300042015 Bacteria 3524
440 Ga0450923_049887 3300042125 Bacteria 897
441 Ga0439446_0003664 3300042156 Bacteria 3834
442 Ga0439446_0022727 3300042156 Bacteria 1779
443 Ga0439434_0018470 3300042435 Unclassified 2088
444 Ga0439434_0073923 3300042435 Bacteria 1075
445 Ga0439435_0012367 3300042436 Bacteria 2067
446 Ga0450918_017009 3300042531 Unclassified 1266
447 Ga0451576_0383715 3300045051 Bacteria 1473
448 Ga0451576_0713680 3300045051 Unclassified 1053
449 Ga0495603_0026358 3300046455 Bacteria 3512
450 Ga0495629_0187113 3300046459 Bacteria 1434
451 Ga0495641_0147132 3300046461 Bacteria 1053
452 Ga0495584_0114995 3300046491 Bacteria 1362
453 Ga0495594_0221165 3300046499 Bacteria 1080
454 Ga0495596_0065083 3300046500 Bacteria 1418
455 Ga0495630_0084956 3300046517 Bacteria 2389
456 Ga0495630_0134753 3300046517 Bacteria 1877
457 Ga0495644_0150572 3300046523 Bacteria 890
458 Ga0495663_0006977 3300046525 Bacteria 3116
459 Ga0495586_0025563 3300046535 Bacteria 3160
460 Ga0495656_0085338 3300046615 Bacteria 1434
461 Ga0495656_0172281 3300046615 Bacteria 1059
462 Ga0495658_0066558 3300046683 Bacteria 2081
463 Ga0495624_0108440 3300046690 Bacteria 1708
464 Ga0495589_0143189 3300046794 Unclassified 1144
465 Ga0495676_0475201 3300047321 Unclassified 823
466 Ga0496101_0130127 3300048904 Bacteria 1911
467 Ga0496101_0499112 3300048904 Bacteria 961
468 Ga0496101_0610686 3300048904 Bacteria 862
469 Ga0496102_0014207 3300048905 Bacteria 6918
470 Ga0496102_0574308 3300048905 Bacteria 1050
471 Ga0496102_0583173 3300048905 Bacteria 1041
472 Ga0496103_0002770 3300048906 Bacteria 10905
473 Ga0496104_0036459 3300048907 Bacteria 4598
474 Ga0496104_0038609 3300048907 Bacteria 4468
475 Ga0496104_0328130 3300048907 Bacteria 1443
476 Ga0496104_0346003 3300048907 Bacteria 1399
477 Ga0496105_0071558 3300048908 Bacteria 2866
478 Ga0496106_0227132 3300048909 Bacteria 1490
479 Ga0496107_0068959 3300048910 Bacteria 2566
480 Ga0496108_0031277 3300048911 Bacteria 4415
481 Ga0496108_0116015 3300048911 Bacteria 2293
482 Ga0496108_0465927 3300048911 Unclassified 1104
483 Ga0496110_0051029 3300048913 Bacteria 3634
484 Ga0496110_0126882 3300048913 Bacteria 2302
485 Ga0496110_0205939 3300048913 Bacteria 1788
486 Ga0496110_0224234 3300048913 Bacteria 1709
487 Ga0496111_0018202 3300048914 Bacteria 4864
488 Ga0496111_0032088 3300048914 Bacteria 3744
489 Ga0496111_0088175 3300048914 Bacteria 2272
490 Ga0496112_0484127 3300048915 Archaea 1174
491 Ga0496113_0156754 3300048916 Bacteria 1799
492 Ga0496114_0049486 3300048917 Bacteria 3497
493 Ga0496114_0101503 3300048917 Bacteria 2457
494 Ga0496114_0220192 3300048917 Bacteria 1666
495 Ga0501031_0008367 3300049568 Bacteria 6728
496 Ga0501031_0009260 3300049568 Bacteria 6399
497 Ga0501031_0025391 3300049568 Bacteria 3864
498 Ga0501031_0218843 3300049568 Bacteria 1240
499 Ga0501032_0019947 3300049569 Bacteria 4679
500 Ga0501032_0054782 3300049569 Bacteria 2684
501 Ga0501033_0016515 3300049570 Bacteria 5589
502 Ga0501033_0096748 3300049570 Bacteria 2157
503 Ga0501033_0120851 3300049570 Bacteria 1901
504 Ga0501033_0136568 3300049570 Bacteria 1774
505 Ga0501033_0329138 3300049570 Bacteria 1072
506 Ga0501034_0150188 3300049571 Bacteria 2306
507 Ga0501034_0271792 3300049571 Unclassified 1636
508 Ga0501036_0004235 3300049572 Bacteria 11568
509 Ga0501036_0016320 3300049572 Bacteria 6204
510 Ga0501036_0019484 3300049572 Bacteria 5698
511 Ga0501036_0022712 3300049572 Bacteria 5280
512 Ga0501036_0041300 3300049572 Bacteria 3903
513 Ga0501036_0063480 3300049572 Bacteria 3127
514 Ga0501037_0042351 3300049573 Bacteria 3346
515 Ga0501037_0122830 3300049573 Bacteria 1866
516 Ga0501037_0288839 3300049573 Bacteria 1141
517 Ga0501038_0021115 3300049574 Bacteria 5849
518 Ga0501038_0022053 3300049574 Bacteria 5711
519 Ga0501038_0028893 3300049574 Bacteria 4921
520 Ga0501039_0029315 3300049575 Bacteria 4238
521 Ga0501039_0062172 3300049575 Bacteria 2893
522 Ga0501039_0067219 3300049575 Bacteria 2783
523 Ga0501039_0074183 3300049575 Bacteria 2644
524 Ga0501039_0091517 3300049575 Bacteria 2370
525 Ga0501039_0186062 3300049575 Bacteria 1633
526 Ga0501039_0610964 3300049575 Unclassified 854
527 Ga0501040_0010581 3300049576 Bacteria 6032
528 Ga0501040_0011857 3300049576 Bacteria 5702
529 Ga0501040_0014319 3300049576 Bacteria 5225
530 Ga0501040_0025565 3300049576 Bacteria 3970
531 Ga0501040_0063898 3300049576 Bacteria 2533
532 Ga0501040_0217892 3300049576 Bacteria 1358
533 Ga0501040_0286854 3300049576 Bacteria 1176
534 Ga0501041_0006637 3300049577 Bacteria 6778
535 Ga0501041_0007584 3300049577 Bacteria 6371
536 Ga0501041_0008596 3300049577 Bacteria 6013
537 Ga0501041_0009544 3300049577 Bacteria 5721
538 Ga0501041_0019049 3300049577 Bacteria 4092
539 Ga0501041_0482825 3300049577 Unclassified 788
540 Ga0501042_0000441 3300049578 Bacteria 21218
541 Ga0501042_0002574 3300049578 Bacteria 11148
542 Ga0501042_0014381 3300049578 Bacteria 5401
543 Ga0501042_0022949 3300049578 Bacteria 4359
544 Ga0501042_0052522 3300049578 Bacteria 2907
545 Ga0501042_0135859 3300049578 Bacteria 1773
546 Ga0501042_0137837 3300049578 Bacteria 1759
547 Ga0501042_0469104 3300049578 Unclassified 913
548 Ga0501043_0057963 3300049579 Bacteria 3040
549 Ga0501043_0108777 3300049579 Bacteria 2177
550 Ga0501043_0455890 3300049579 Unclassified 960
551 Ga0501046_0002052 3300049580 Bacteria 19128
552 Ga0501046_0005519 3300049580 Bacteria 11295
553 Ga0501046_0032575 3300049580 Bacteria 4220
554 Ga0501046_0280174 3300049580 Bacteria 1221
555 Ga0501046_0431988 3300049580 Bacteria 948
556 Ga0501046_0536598 3300049580 Bacteria 835
557 Ga0501047_0379163 3300049581 Bacteria 1249
558 Ga0501047_0674864 3300049581 Bacteria 852
559 Ga0501048_0002595 3300049582 Bacteria 13845
560 Ga0501048_0011844 3300049582 Bacteria 6502
561 Ga0501048_0017118 3300049582 Bacteria 5342
562 Ga0501048_0063657 3300049582 Bacteria 2608
563 Ga0501048_0088042 3300049582 Bacteria 2190
564 Ga0501048_0176836 3300049582 Bacteria 1512
565 Ga0501048_0376595 3300049582 Bacteria 1013
566 Ga0501048_0595288 3300049582 Unclassified 794
567 Ga0501067_0403792 3300049583 Unclassified 762
568 Ga0501068_0001633 3300049584 Bacteria 11967
569 Ga0501068_0033710 3300049584 Bacteria 3050
570 Ga0501068_0053928 3300049584 Bacteria 2435
571 Ga0501068_0159986 3300049584 Bacteria 1419
572 Ga0501068_0168004 3300049584 Bacteria 1383
573 Ga0501068_0168969 3300049584 Bacteria 1380
574 Ga0501069_0104424 3300049585 Bacteria 1610
575 Ga0501069_0228693 3300049585 Unclassified 1082
576 Ga0501069_0243499 3300049585 Unclassified 1048
577 Ga0501070_0080649 3300049586 Bacteria 2693
578 Ga0501070_0110290 3300049586 Bacteria 2274
579 Ga0501070_0367836 3300049586 Bacteria 1166
580 Ga0501070_0483736 3300049586 Bacteria 995
581 Ga0501071_0012115 3300049587 Bacteria 5833
582 Ga0501071_0012611 3300049587 Bacteria 5739
583 Ga0501071_0014388 3300049587 Bacteria 5410
584 Ga0501071_0048698 3300049587 Bacteria 3049
585 Ga0501071_0065122 3300049587 Bacteria 2646
586 Ga0501071_0119307 3300049587 Bacteria 1954
587 Ga0501071_0214379 3300049587 Bacteria 1448
588 Ga0501071_0565721 3300049587 Bacteria 873
589 Ga0501072_0000735 3300049588 Bacteria 23877
590 Ga0501072_0006457 3300049588 Bacteria 8927
591 Ga0501072_0008774 3300049588 Bacteria 7675
592 Ga0501072_0020922 3300049588 Bacteria 5071
593 Ga0501072_0036036 3300049588 Bacteria 3877
594 Ga0501072_0086824 3300049588 Bacteria 2482
595 Ga0501072_0147449 3300049588 Bacteria 1876
596 Ga0501072_0364342 3300049588 Bacteria 1147
597 Ga0501073_0030002 3300049589 Bacteria 3884
598 Ga0501074_0002379 3300049590 Bacteria 13109
599 Ga0501074_0025235 3300049590 Bacteria 4318
600 Ga0501074_0083473 3300049590 Bacteria 2290
601 Ga0501074_0302040 3300049590 Unclassified 1137
602 Ga0501075_0012546 3300049591 Bacteria 6026
603 Ga0501075_0032012 3300049591 Bacteria 3906
604 Ga0501075_0124610 3300049591 Bacteria 1961
605 Ga0501075_0126200 3300049591 Bacteria 1948
606 Ga0501075_0176216 3300049591 Unclassified 1631
607 Ga0501076_0008053 3300049592 Bacteria 7700
608 Ga0501076_0021974 3300049592 Bacteria 4900
609 Ga0501076_0026124 3300049592 Bacteria 4520
610 Ga0501076_0044145 3300049592 Bacteria 3514
611 Ga0501076_0066295 3300049592 Bacteria 2881
612 Ga0501076_0157351 3300049592 Bacteria 1850
613 Ga0501076_0228651 3300049592 Unclassified 1520
614 Ga0501076_0249705 3300049592 Bacteria 1451
615 Ga0501076_0287867 3300049592 Bacteria 1346
616 Ga0501077_0000885 3300049593 Bacteria 18007
617 Ga0501077_0025285 3300049593 Bacteria 3771
618 Ga0501077_0038111 3300049593 Bacteria 3060
619 Ga0501077_0073148 3300049593 Bacteria 2171
620 Ga0501077_0115122 3300049593 Bacteria 1704
621 Ga0501077_0156503 3300049593 Bacteria 1446
622 Ga0501077_0219525 3300049593 Unclassified 1208
623 Ga0501233_020491 3300049668 Bacteria 1412
624 Ga0501079_0009303 3300049741 Bacteria 7448
625 Ga0501079_0070893 3300049741 Bacteria 2691
626 Ga0501079_0082959 3300049741 Bacteria 2479
627 Ga0501079_0083661 3300049741 Bacteria 2468
628 Ga0501079_0125792 3300049741 Bacteria 1994
629 Ga0501080_0002230 3300049742 Bacteria 16845
630 Ga0501080_0017960 3300049742 Bacteria 6547
631 Ga0501080_0021884 3300049742 Bacteria 5921
632 Ga0501080_0027304 3300049742 Bacteria 5308
633 Ga0501080_0061509 3300049742 Bacteria 3496
634 Ga0501080_0170262 3300049742 Bacteria 2009
635 Ga0501080_0748257 3300049742 Bacteria 860
636 Ga0501081_0005847 3300049743 Bacteria 7961
637 Ga0501081_0008382 3300049743 Bacteria 6710
638 Ga0501081_0055723 3300049743 Bacteria 2731
639 Ga0501081_0065503 3300049743 Bacteria 2525
640 Ga0501081_0075562 3300049743 Bacteria 2352
641 Ga0501081_0282834 3300049743 Bacteria 1215
642 Ga0501081_0590508 3300049743 Bacteria 831
643 Ga0501083_0063983 3300049744 Bacteria 2452
644 Ga0501083_0238022 3300049744 Bacteria 1185
645 Ga0501035_0022962 3300049822 Bacteria 5726
646 Ga0501035_0029556 3300049822 Bacteria 4999
647 Ga0501035_0029940 3300049822 Bacteria 4965
648 Ga0501035_0776175 3300049822 Bacteria 767
649 Ga0501044_0133072 3300049823 Bacteria 2480
650 Ga0501045_0000823 3300049824 Bacteria 20069
651 Ga0501045_0009423 3300049824 Bacteria 6830
652 Ga0501045_0039661 3300049824 Bacteria 3426
653 Ga0501045_0074044 3300049824 Bacteria 2508
654 Ga0501045_0085081 3300049824 Bacteria 2333
655 Ga0501045_0176644 3300049824 Bacteria 1591
656 Ga0501045_0470065 3300049824 Unclassified 934
657 nmdc:mga00v17_281630_c1 3300050491 Bacteria 1079
658 nmdc:mga0yw44_27835_c1 3300050492 Bacteria 3243
659 nmdc:mga05p37_16558_c1 3300050507 Bacteria 8881
660 nmdc:mga05p37_40133_c1 3300050507 Bacteria 5747
661 nmdc:mga05p37_43395_c1 3300050507 Bacteria 4870
662 nmdc:mga05p37_452670_c1 3300050507 Bacteria 1485
663 nmdc:mga05p37_87920_c1 3300050507 Bacteria 3831
664 nmdc:mga09592_15345_c1 3300050508 Bacteria 6256
665 nmdc:mga09592_246881_c1 3300050508 Bacteria 1547
666 nmdc:mga0qj67_348709_c1 3300050509 Bacteria 1197
667 nmdc:mga0qj67_448208_c1 3300050509 Bacteria 1040
668 nmdc:mga06r32_34305_c1 3300050510 Bacteria 4784
669 nmdc:mga06r32_6256_c1 3300050510 Bacteria 10688
670 nmdc:mga08y16_108075_c1 3300050511 Bacteria 2896
671 nmdc:mga08y16_19639_c1 3300050511 Bacteria 7126
672 nmdc:mga08y16_444438_c1 3300050511 Bacteria 1323
673 nmdc:mga08y16_47453_c1 3300050511 Bacteria 4495
674 nmdc:mga08y16_91910_c1 3300050511 Bacteria 3162
675 nmdc:mga0n895_45637_c1 3300050512 Bacteria 4277
676 nmdc:mga0n895_517307_c1 3300050512 Bacteria 1201
677 nmdc:mga0rr50_2921_c1 3300050513 Bacteria 9757
678 nmdc:mga08x19_5927_c1 3300050514 Bacteria 7231
679 nmdc:mga0a205_123505_c1 3300050515 Bacteria 2489
680 Ga0495655_0002969 3300053083 Bacteria 2750
681 Ga0501084_0010166 3300054114 Bacteria 7780
682 Ga0501084_0019340 3300054114 Bacteria 5674
683 Ga0501084_0048439 3300054114 Bacteria 3557
684 Ga0501084_0093846 3300054114 Bacteria 2520
685 Ga0501084_0120349 3300054114 Bacteria 2207
686 Ga0501084_0145148 3300054114 Bacteria 1998
687 Ga0501084_0179559 3300054114 Bacteria 1787
688 Ga0590075_013270 3300059424 Bacteria 2006
689 Ga0590075_043626 3300059424 Unclassified 1147
690 Ga0590077_034813 3300059426 Bacteria 1108
691 Ga0501082_0007159 3300060353 Bacteria 9616
692 Ga0501082_0041366 3300060353 Bacteria 3973
693 Ga0501082_0061741 3300060353 Bacteria 3225
694 Ga0501082_0300647 3300060353 Unclassified 1397
695 Ga0501082_0361290 3300060353 Bacteria 1266
696 Ga0501082_0548241 3300060353 Bacteria 1011
697 Ga0501082_0570733 3300060353 Unclassified 990
698 Ga0501082_0597795 3300060353 Bacteria 965
699 Ga0530510_0003263 3300061734 Bacteria 11151
700 Ga0530510_0018543 3300061734 Bacteria 4933
701 Ga0530510_0041743 3300061734 Bacteria 3312
702 Ga0530510_0054130 3300061734 Bacteria 2900
703 Ga0530510_0161726 3300061734 Bacteria 1656
704 Ga0530510_0180253 3300061734 Bacteria 1566
705 Ga0530510_0378003 3300061734 Bacteria 1066
706 Ga0395900_0027625
707 JGI24743J22301_10048364
708 JGI24738J21930_10007013
709 Ga0070658_10014552
710 Ga0070683_100030326
711 Ga0070683_100105303
712 Ga0070683_100214150
713 Ga0070690_100139104
714 Ga0070670_100538741
715 Ga0068869_100252251
716 Ga0068869_100265028
717 Ga0068869_100338183
718 Ga0070666_10214050
719 Ga0070680_100123408
720 Ga0070682_100430250
721 Ga0068868_100253424
722 Ga0068868_100262957
723 Ga0070660_100074437
724 Ga0070689_100062289
725 Ga0070689_100111475
726 Ga0070661_100033838
727 Ga0070661_100291093
728 Ga0070692_10022650
729 Ga0070692_10096548
730 Ga0070692_10183089
731 Ga0070668_100303001
732 Ga0070669_100296296
733 Ga0070675_100050447
734 Ga0070675_100101673
735 Ga0070675_100104384
736 Ga0070675_100132329
737 Ga0070675_100248494
738 Ga0070675_100322583
739 Ga0070671_100048938
740 Ga0070671_100111102
741 Ga0070671_100353299
742 Ga0070674_100030030
743 Ga0070674_100050159
744 Ga0070674_100059972
745 Ga0070674_100281708
746 Ga0070674_100407407
747 Ga0070673_100039231
748 Ga0070673_100198579
749 Ga0070688_100036085
750 Ga0070688_100089827
751 Ga0070659_100071734
752 Ga0070659_100374455
753 Ga0070659_100401753
754 Ga0070667_100283509
755 Ga0070703_10153159
756 Ga0070714_100460514
757 Ga0070701_10042963
758 Ga0070701_10190687
759 Ga0070701_10439882
760 Ga0070711_100181434
761 Ga0070705_100084770
762 Ga0070700_100015707
763 Ga0070700_100042746
764 Ga0070694_100662394
765 Ga0070708_100030728
766 Ga0070663_100249067
767 Ga0070678_100025390
768 Ga0070678_100145655
769 Ga0070678_100277516
770 Ga0070678_100338090
771 Ga0070662_100059385
772 Ga0070662_100312888
773 Ga0070662_100315041
774 Ga0070681_10036083
775 Ga0070681_10118500
776 Ga0068867_100062420
777 Ga0068867_100215746
778 Ga0068867_100936208
779 Ga0070685_10152277
780 Ga0070706_100548974
781 Ga0070698_100165233
782 Ga0070699_100057094
783 Ga0070679_100002810
784 Ga0070679_100311215
785 Ga0070684_100001001
786 Ga0070684_100086582
787 Ga0070684_100089423
788 Ga0070684_100143229
789 Ga0070684_100272546
790 Ga0070697_100821624
791 Ga0068853_100040586
792 Ga0070672_100078785
793 Ga0070672_100103769
794 Ga0070686_100059129
795 Ga0070686_100070653
796 Ga0070686_100208275
797 Ga0070695_100341999
798 Ga0070696_100408586
799 Ga0070696_100571954
800 Ga0070693_100002648
801 Ga0070693_100381266
802 Ga0070665_100061791
803 Ga0070665_100272407
804 Ga0070665_100635100
805 Ga0070704_100203563
806 Ga0068855_100120961
807 Ga0068855_100514263
808 Ga0070664_100081999
809 Ga0070664_100265488
810 Ga0070664_100455141
811 Ga0070664_100734637
812 Ga0068854_100068446
813 Ga0068854_100068936
814 Ga0068854_100157985
815 Ga0068854_100599098
816 Ga0068856_100022134
817 Ga0068856_100655765
818 Ga0070702_100078783
819 Ga0070702_100328558
820 Ga0068852_100044266
821 Ga0068852_100698048
822 Ga0068859_101148816
823 Ga0068864_100010668
824 Ga0068864_100139626
825 Ga0068866_10045660
826 Ga0068861_100120831
827 Ga0068861_100497312
828 Ga0068851_10207547
829 Ga0068851_10218550
830 Ga0068870_10017694
831 Ga0068863_100319115
832 Ga0068863_100405395
833 Ga0068858_100031474
834 Ga0068860_100228134
835 Ga0068862_100330968
836 Ga0068862_100335245
837 Ga0081455_10001861
838 Ga0081455_10034264
839 Ga0081455_10036893
840 Ga0081455_10046668
841 Ga0081455_10204763
842 Ga0081455_10380441
843 Ga0081455_10462538
844 Ga0081539_10001335
845 Ga0081539_10139239
846 Ga0075365_10044653
847 Ga0075432_10004132
848 Ga0097621_100056538
849 Ga0097621_100245042
850 Ga0068871_100144363
851 Ga0068871_100167649
852 Ga0068871_100487270
853 Ga0075428_100028279
854 Ga0075428_100144090
855 Ga0075428_100359630
856 Ga0075428_100682445
857 Ga0075430_100644725
858 Ga0075431_100006254
859 Ga0075431_100041551
860 Ga0075431_100292724
861 Ga0075433_10045622
862 Ga0075433_10149203
863 Ga0075434_100400816
864 Ga0075429_100038392
865 Ga0075429_100043419
866 Ga0068865_100024294
867 Ga0068865_100147614
868 Ga0075436_100019331
869 Ga0097620_101148696
870 Ga0111539_10060383
871 Ga0111539_10073822
872 Ga0111539_10200581
873 Ga0111539_10210949
874 Ga0111539_10261331
875 Ga0111539_11365623
876 Ga0105245_10045161
877 Ga0105245_10047827
878 Ga0105245_10231403
879 Ga0105245_10235222
880 Ga0105245_10266091
881 Ga0105245_10328797
882 Ga0105245_11029712
883 Ga0105247_10051620
884 Ga0114129_10085229
885 Ga0114129_10090048
886 Ga0114129_10290134
887 Ga0114129_10767583
888 Ga0114129_10829694
889 Ga0105243_10032600
890 Ga0105243_10070969
891 Ga0105243_10202073
892 Ga0105243_10364113
893 Ga0105243_10404113
894 Ga0105243_10621653
895 Ga0105243_11277198
896 Ga0105241_10083061
897 Ga0105242_10056351
898 Ga0105242_10079642
899 Ga0105242_10346173
900 Ga0105242_10459762
901 Ga0105242_10540647
902 Ga0105248_10059033
903 Ga0105248_10772830
904 Ga0105248_10903844
905 Ga0105238_10097055
906 Ga0105238_10176567
907 Ga0105238_10307207
908 Ga0105249_10189391
909 Ga0105249_10196626
910 Ga0105239_10006421
911 Ga0105239_10213106
912 Ga0105239_10965761
913 Ga0105246_10021900
914 Ga0105246_10086556
915 Ga0105246_10126267
916 Ga0105246_10339463
917 Ga0157371_10054594
918 Ga0157371_10255448
919 Ga0157378_10276171
920 Ga0157378_10279811
921 Ga0157378_10309536
922 Ga0163162_10105934
923 Ga0163162_10172847
924 Ga0163162_10185649
925 Ga0157372_10230245
926 Ga0157372_10337114
927 Ga0157375_10126712
928 Ga0157375_10142029
929 Ga0157375_10156153
930 Ga0157375_10262534
931 Ga0157375_10498123
932 Ga0157375_10672747
933 Ga0163163_10028019
934 Ga0163163_10033206
935 Ga0163163_10682824
936 Ga0157380_10101514
937 Ga0157380_10414655
938 Ga0157380_10615235
939 Ga0157377_10052379
940 Ga0157377_10233924
941 Ga0157379_10164367
942 Ga0157379_10191131
943 Ga0157376_10055228
944 Ga0157376_10422039
945 Ga0157376_10452161
946 Ga0157376_10647728
947 Ga0163161_10034765
948 Ga0207642_10365664
949 Ga0207710_10044822
950 Ga0207688_10007691
951 Ga0207688_10026359
952 Ga0207688_10043270
953 Ga0207645_10033387
954 Ga0207643_10009991
955 Ga0207643_10054627
956 Ga0207643_10102730
957 Ga0207684_10410682
958 Ga0207707_10070930
959 Ga0207707_10587799
960 Ga0207693_10296657
961 Ga0207663_10247214
962 Ga0207660_10097822
963 Ga0207662_10198230
964 Ga0207657_10005767
965 Ga0207652_10091740
966 Ga0207659_10065165
967 Ga0207659_10067506
968 Ga0207659_10131737
969 Ga0207659_10152138
970 Ga0207659_10190862
971 Ga0207687_10018548
972 Ga0207687_10096847
973 Ga0207687_10190056
974 Ga0207687_10221833
975 Ga0207687_10372083
976 Ga0207644_10095645
977 Ga0207644_10239232
978 Ga0207690_10175690
979 Ga0207706_10022764
980 Ga0207706_10076375
981 Ga0207706_10342136
982 Ga0207686_10008053
983 Ga0207686_10075825
984 Ga0207686_10256030
985 Ga0207709_10055713
986 Ga0207709_10129303
987 Ga0207709_10229450
988 Ga0207709_10357606
989 Ga0207709_10755456
990 Ga0207670_10041414
991 Ga0207670_10224528
992 Ga0207669_10026984
993 Ga0207669_10077719
994 Ga0207669_10229405
995 Ga0207669_10349006
996 Ga0207704_10013025
997 Ga0207704_10194214
998 Ga0207704_10315831
999 Ga0207691_10015174
1000 Ga0207691_10068001
1001 Ga0207691_10091844
1002 Ga0207691_10099680
1003 Ga0207691_10351922
1004 Ga0207689_10170984
1005 Ga0207689_10384975
1006 Ga0207689_10562761
1007 Ga0207661_10006850
1008 Ga0207661_10159116
1009 Ga0207679_10077118
1010 Ga0207679_10405091
1011 Ga0207667_10618980
1012 Ga0207667_10673744
1013 Ga0207651_10439339
1014 Ga0207712_10114770
1015 Ga0207668_10045504
1016 Ga0207668_10526862
1017 Ga0207640_10267676
1018 Ga0207658_10596603
1019 Ga0207677_10084159
1020 Ga0207677_10165622
1021 Ga0207677_10394039
1022 Ga0207677_10396474
1023 Ga0207703_10177796
1024 Ga0207639_10009827
1025 Ga0207639_10252529
1026 Ga0207678_10040907
1027 Ga0207678_10064008
1028 Ga0207678_10141276
1029 Ga0207678_10455522
1030 Ga0207708_10029150
1031 Ga0207708_10071594
1032 Ga0207708_10139977
1033 Ga0207708_10497305
1034 Ga0207702_10028914
1035 Ga0207702_10484214
1036 Ga0207648_10059070
1037 Ga0207648_10082012
1038 Ga0207648_10484480
1039 Ga0207676_10024777
1040 Ga0207676_10421086
1041 Ga0207674_10340850
1042 Ga0207675_100504826
1043 Ga0207683_10006492
1044 Ga0207683_10040843
1045 Ga0207683_10069950
1046 Ga0207683_10269823
1047 Ga0207683_10297316
1048 Ga0207698_10222047
1049 Ga0207698_10541106
1050 Ga0207428_10000616
1051 Ga0207428_10015169
1052 Ga0207428_10086222
1053 Ga0207428_10177793
1054 Ga0268266_10044661
1055 Ga0268266_11108335
1056 Ga0307408_100253735
1057 Ga0307405_10021940
1058 Ga0307405_10050742
1059 Ga0307405_10372766
1060 Ga0307413_10040164
1061 Ga0307406_10024504
1062 Ga0307406_10111617
1063 Ga0307406_10178661
1064 Ga0307407_10056789
1065 Ga0307412_10013446
1066 Ga0307409_100027370
1067 Ga0307409_100089066
1068 Ga0307409_100176533
1069 Ga0307409_100224583
1070 Ga0307416_100007300
1071 Ga0307416_100037867
1072 Ga0307416_100100233
1073 Ga0307416_101068232
1074 Ga0307414_10101969
1075 Ga0307415_100008009
1076 Ga0307415_100009850
1077 Ga0307415_100226645
1078 Ga0373930_0009177
1079 Ga0373938_0070553
1080 Ga0373943_0079191
1081 Ga0373931_0139776
1082 Ga0373947_0001805
1083 Ga0373925_0009072
1084 Ga0395899_0009994
1085 Ga0395899_0019116
1086 Ga0395899_0027148
1087 Ga0395899_0060632
1088 Ga0395899_0238702
1089 Ga0395899_0243526
1090 Ga0395899_0263027
1091 Ga0395899_0337494
1092 Ga0395900_0000672
1093 Ga0395900_0016135
1094 Ga0395900_0019167
1095 Ga0395900_0019349
1096 Ga0395900_0072732
1097 Ga0395900_0371235
1098 Ga0395900_0411929
1099 Ga0395900_0851726
1100 Ga0395898_0010163
1101 Ga0395898_0012873
1102 Ga0395898_0013953
1103 Ga0395898_0017705
1104 Ga0395898_0021932
1105 Ga0395898_0026880
1106 Ga0395898_0030915
1107 Ga0395898_0104380
1108 Ga0395898_0152102
1109 Ga0395898_0165462
1110 Ga0395898_0326656
1111 Ga0395898_0668387
1112 Ga0395905_0016268
1113 Ga0395905_0021201
1114 Ga0395905_0033503
1115 Ga0395905_0066619
1116 Ga0395905_0076612
1117 Ga0395905_0137279
1118 Ga0395905_0144145
1119 Ga0395905_0182443
1120 Ga0395905_0199038
1121 Ga0395905_0271508
1122 Ga0395905_0317876
1123 Ga0395905_0484045
1124 Ga0395901_0003116
1125 Ga0395901_0005130
1126 Ga0395901_0009295
1127 Ga0395901_0011511
1128 Ga0395901_0036763
1129 Ga0395901_0049487
1130 Ga0395901_0062002
1131 Ga0395901_0091605
1132 Ga0395901_0129312
1133 Ga0395901_0204064
1134 Ga0395901_0226285
1135 Ga0395901_0398483
1136 Ga0395901_1118788
1137 Ga0439453_0007341
1138 Ga0439461_0014244
1139 Ga0451853_0017336
1140 Ga0439431_0034869
1141 Ga0439433_0003150
1142 Ga0439449_0046816
1143 Ga0439451_013274
1144 Ga0439462_0004141
1145 Ga0450923_049887
1146 Ga0439446_0003664
1147 Ga0439446_0022727
1148 Ga0439434_0018470
1149 Ga0439434_0073923
1150 Ga0439435_0012367
1151 Ga0450918_017009
1152 Ga0451576_0383715
1153 Ga0451576_0713680
1154 Ga0495603_0026358
1155 Ga0495629_0187113
1156 Ga0495641_0147132
1157 Ga0495584_0114995
1158 Ga0495594_0221165
1159 Ga0495596_0065083
1160 Ga0495630_0084956
1161 Ga0495630_0134753
1162 Ga0495644_0150572
1163 Ga0495663_0006977
1164 Ga0495586_0025563
1165 Ga0495656_0085338
1166 Ga0495656_0172281
1167 Ga0495658_0066558
1168 Ga0495624_0108440
1169 Ga0495589_0143189
1170 Ga0495676_0475201
1171 Ga0496101_0130127
1172 Ga0496101_0499112
1173 Ga0496101_0610686
1174 Ga0496102_0014207
1175 Ga0496102_0574308
1176 Ga0496102_0583173
1177 Ga0496103_0002770
1178 Ga0496104_0036459
1179 Ga0496104_0038609
1180 Ga0496104_0328130
1181 Ga0496104_0346003
1182 Ga0496105_0071558
1183 Ga0496106_0227132
1184 Ga0496107_0068959
1185 Ga0496108_0031277
1186 Ga0496108_0116015
1187 Ga0496108_0465927
1188 Ga0496110_0051029
1189 Ga0496110_0126882
1190 Ga0496110_0205939
1191 Ga0496110_0224234
1192 Ga0496111_0018202
1193 Ga0496111_0032088
1194 Ga0496111_0088175
1195 Ga0496112_0484127
1196 Ga0496113_0156754
1197 Ga0496114_0049486
1198 Ga0496114_0101503
1199 Ga0496114_0220192
1200 Ga0501031_0008367
1201 Ga0501031_0009260
1202 Ga0501031_0025391
1203 Ga0501031_0218843
1204 Ga0501032_0019947
1205 Ga0501032_0054782
1206 Ga0501033_0016515
1207 Ga0501033_0096748
1208 Ga0501033_0120851
1209 Ga0501033_0136568
1210 Ga0501033_0329138
1211 Ga0501034_0150188
1212 Ga0501034_0271792
1213 Ga0501036_0004235
1214 Ga0501036_0016320
1215 Ga0501036_0019484
1216 Ga0501036_0022712
1217 Ga0501036_0041300
1218 Ga0501036_0063480
1219 Ga0501037_0042351
1220 Ga0501037_0122830
1221 Ga0501037_0288839
1222 Ga0501038_0021115
1223 Ga0501038_0022053
1224 Ga0501038_0028893
1225 Ga0501039_0029315
1226 Ga0501039_0062172
1227 Ga0501039_0067219
1228 Ga0501039_0074183
1229 Ga0501039_0091517
1230 Ga0501039_0186062
1231 Ga0501039_0610964
1232 Ga0501040_0010581
1233 Ga0501040_0011857
1234 Ga0501040_0014319
1235 Ga0501040_0025565
1236 Ga0501040_0063898
1237 Ga0501040_0217892
1238 Ga0501040_0286854
1239 Ga0501041_0006637
1240 Ga0501041_0007584
1241 Ga0501041_0008596
1242 Ga0501041_0009544
1243 Ga0501041_0019049
1244 Ga0501041_0482825
1245 Ga0501042_0000441
1246 Ga0501042_0002574
1247 Ga0501042_0014381
1248 Ga0501042_0022949
1249 Ga0501042_0052522
1250 Ga0501042_0135859
1251 Ga0501042_0137837
1252 Ga0501042_0469104
1253 Ga0501043_0057963
1254 Ga0501043_0108777
1255 Ga0501043_0455890
1256 Ga0501046_0002052
1257 Ga0501046_0005519
1258 Ga0501046_0032575
1259 Ga0501046_0280174
1260 Ga0501046_0431988
1261 Ga0501046_0536598
1262 Ga0501047_0379163
1263 Ga0501047_0674864
1264 Ga0501048_0002595
1265 Ga0501048_0011844
1266 Ga0501048_0017118
1267 Ga0501048_0063657
1268 Ga0501048_0088042
1269 Ga0501048_0176836
1270 Ga0501048_0376595
1271 Ga0501048_0595288
1272 Ga0501067_0403792
1273 Ga0501068_0001633
1274 Ga0501068_0033710
1275 Ga0501068_0053928
1276 Ga0501068_0159986
1277 Ga0501068_0168004
1278 Ga0501068_0168969
1279 Ga0501069_0104424
1280 Ga0501069_0228693
1281 Ga0501069_0243499
1282 Ga0501070_0080649
1283 Ga0501070_0110290
1284 Ga0501070_0367836
1285 Ga0501070_0483736
1286 Ga0501071_0012115
1287 Ga0501071_0012611
1288 Ga0501071_0014388
1289 Ga0501071_0048698
1290 Ga0501071_0065122
1291 Ga0501071_0119307
1292 Ga0501071_0214379
1293 Ga0501071_0565721
1294 Ga0501072_0000735
1295 Ga0501072_0006457
1296 Ga0501072_0008774
1297 Ga0501072_0020922
1298 Ga0501072_0036036
1299 Ga0501072_0086824
1300 Ga0501072_0147449
1301 Ga0501072_0364342
1302 Ga0501073_0030002
1303 Ga0501074_0002379
1304 Ga0501074_0025235
1305 Ga0501074_0083473
1306 Ga0501074_0302040
1307 Ga0501075_0012546
1308 Ga0501075_0032012
1309 Ga0501075_0124610
1310 Ga0501075_0126200
1311 Ga0501075_0176216
1312 Ga0501076_0008053
1313 Ga0501076_0021974
1314 Ga0501076_0026124
1315 Ga0501076_0044145
1316 Ga0501076_0066295
1317 Ga0501076_0157351
1318 Ga0501076_0228651
1319 Ga0501076_0249705
1320 Ga0501076_0287867
1321 Ga0501077_0000885
1322 Ga0501077_0025285
1323 Ga0501077_0038111
1324 Ga0501077_0073148
1325 Ga0501077_0115122
1326 Ga0501077_0156503
1327 Ga0501077_0219525
1328 Ga0501233_020491
1329 Ga0501079_0009303
1330 Ga0501079_0070893
1331 Ga0501079_0082959
1332 Ga0501079_0083661
1333 Ga0501079_0125792
1334 Ga0501080_0002230
1335 Ga0501080_0017960
1336 Ga0501080_0021884
1337 Ga0501080_0027304
1338 Ga0501080_0061509
1339 Ga0501080_0170262
1340 Ga0501080_0748257
1341 Ga0501081_0005847
1342 Ga0501081_0008382
1343 Ga0501081_0055723
1344 Ga0501081_0065503
1345 Ga0501081_0075562
1346 Ga0501081_0282834
1347 Ga0501081_0590508
1348 Ga0501083_0063983
1349 Ga0501083_0238022
1350 Ga0501035_0022962
1351 Ga0501035_0029556
1352 Ga0501035_0029940
1353 Ga0501035_0776175
1354 Ga0501044_0133072
1355 Ga0501045_0000823
1356 Ga0501045_0009423
1357 Ga0501045_0039661
1358 Ga0501045_0074044
1359 Ga0501045_0085081
1360 Ga0501045_0176644
1361 Ga0501045_0470065
1362 nmdc:mga00v17_281630_c1
1363 nmdc:mga0yw44_27835_c1
1364 nmdc:mga05p37_16558_c1
1365 nmdc:mga05p37_40133_c1
1366 nmdc:mga05p37_43395_c1
1367 nmdc:mga05p37_452670_c1
1368 nmdc:mga05p37_87920_c1
1369 nmdc:mga09592_15345_c1
1370 nmdc:mga09592_246881_c1
1371 nmdc:mga0qj67_348709_c1
1372 nmdc:mga0qj67_448208_c1
1373 nmdc:mga06r32_34305_c1
1374 nmdc:mga06r32_6256_c1
1375 nmdc:mga08y16_108075_c1
1376 nmdc:mga08y16_19639_c1
1377 nmdc:mga08y16_444438_c1
1378 nmdc:mga08y16_47453_c1
1379 nmdc:mga08y16_91910_c1
1380 nmdc:mga0n895_45637_c1
1381 nmdc:mga0n895_517307_c1
1382 nmdc:mga0rr50_2921_c1
1383 nmdc:mga08x19_5927_c1
1384 nmdc:mga0a205_123505_c1
1385 Ga0495655_0002969
1386 Ga0501084_0010166
1387 Ga0501084_0019340
1388 Ga0501084_0048439
1389 Ga0501084_0093846
1390 Ga0501084_0120349
1391 Ga0501084_0145148
1392 Ga0501084_0179559
1393 Ga0590075_013270
1394 Ga0590075_043626
1395 Ga0590077_034813
1396 Ga0501082_0007159
1397 Ga0501082_0041366
1398 Ga0501082_0061741
1399 Ga0501082_0300647
1400 Ga0501082_0361290
1401 Ga0501082_0548241
1402 Ga0501082_0570733
1403 Ga0501082_0597795
1404 Ga0530510_0003263
1405 Ga0530510_0018543
1406 Ga0530510_0041743
1407 Ga0530510_0054130
1408 Ga0530510_0161726
1409 Ga0530510_0180253
1410 Ga0530510_0378003

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

37

226

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7912 20 166
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7862 9 162
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.7686 19 159
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7512 8 162
3pv0-assembly1.cif.gz_F crystal structure of a pre-translocation state mbp-maltose transporter complex without nucleotide 0.7512 11 162
ID Description Score Start End Superfamily
af_P9WG11_24_299_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8709 19 157 1.10.3720.10
af_P07654_38_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8704 17 157 1.10.3720.10
af_Q58419_14_276_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8456 19 157 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8206 7 224 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7913 1 224 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7W0WC32-F1-model_v4 Amino acid ABC transporter permease 0.9882 1 167 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W0WC32-F1-model_v4 Amino acid ABC transporter permease 0.9766 1 167 GO:0006865
GO:0022857
GO:0043190
AF-A0A4P6EMV3-F1-model_v4 ABC transporter permease subunit 0.9489 2 148 GO:0006865
GO:0022857
GO:0043190
AF-A0A538MMI1-F1-model_v4 ABC transporter permease subunit 0.945 1 128 GO:0006865
GO:0022857
GO:0043190
AF-A0A538MMI1-F1-model_v4 ABC transporter permease subunit 0.938 1 128 GO:0006865
GO:0022857
GO:0043190

Map