F476387

General Info

Members Datasets Scaffolds Average Seq Length
705 419 595 141

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100107022|Ga0068868_1001070222
Length 140
Sequence MTAYDDQNVFAKILRGEIPCFEVFRDDRSLAFLDIMPRSPGHTLVIPRAPARAILDIADDDLAAVARTGKRIAIAATAFDAEGIILQQFSEPASGQVVFHLHMHVMPVRAGIELLPAQTRKEDMAVLADHAKRMIAALGS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
7 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
8 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
9 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
10 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
11 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
12 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
13 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
14 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
15 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
16 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
17 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
18 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
19 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
20 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
21 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
22 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
23 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
24 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
25 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
26 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
27 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
28 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
29 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
30 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
31 2906610324
32 2922368715
33 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
34 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
35 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
36 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
37 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
38 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
39 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
40 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
41 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
42 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
43 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
44 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
45 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
46 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
47 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
48 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
49 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
50 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
51 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
52 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
53 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
54 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
55 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
56 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
57 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
58 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
59 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
60 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
61 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
62 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
63 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
64 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
65 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
66 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
67 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
68 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
69 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
70 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
71 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
72 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
73 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
74 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
75 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
76 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
77 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
78 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
79 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
80 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
81 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
82 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
83 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
84 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
87 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
88 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
91 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
92 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
96 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
99 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
100 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
103 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
104 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
107 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
112 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
119 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
120 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
121 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
122 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
123 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
124 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
125 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
126 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
127 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
128 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
129 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
130 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
131 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
132 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
135 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
136 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
139 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
140 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
143 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
145 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
146 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
149 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
150 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
151 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
155 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
156 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
157 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
158 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
159 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
160 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
161 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
162 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
163 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
164 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
165 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
166 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
232 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
233 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
234 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
235 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
239 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
240 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
241 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
242 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
243 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
246 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
264 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
265 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
277 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
278 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
294 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
363 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
373 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
374 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
375 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
381 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
385 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
388 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
393 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
394 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
395 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
396 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
397 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
398 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
399 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
400 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
401 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
402 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
403 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
404 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
405 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
406 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
407 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
408 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
409 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
410 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
411 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
412 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
413 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
414 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
415 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
416 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
417 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
418 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
419 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.64
Metatranscriptomes 0
Isolates 15.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.23
Nodule 14.33
Rhizoplane 6.52
Rhizosphere 65.96
Stem 0
Stem Tuber 0
Unclassified 4.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10134666 3300001989 Bacteria 734
2 JGI24737J22298_10193408 3300001990 Bacteria 600
3 JGI25153J46596_10002528 3300003215 Bacteria 10487
4 Ga0055539_1014096 3300003752 Bacteria 977
5 Ga0070658_10755586 3300005327 Bacteria 844
6 Ga0070658_11431232 3300005327 Bacteria 600
7 Ga0070676_10235753 3300005328 Bacteria 1215
8 Ga0070670_100051947 3300005331 Bacteria 3520
9 Ga0068869_100012989 3300005334 Bacteria 5524
10 Ga0070666_10066516 3300005335 Bacteria 2446
11 Ga0070666_10379765 3300005335 Bacteria 1014
12 Ga0070666_11103636 3300005335 Bacteria 590
13 Ga0070680_100094004 3300005336 Bacteria 2484
14 Ga0068868_100011843 3300005338 Bacteria 6359
15 Ga0068868_100107022 3300005338 Bacteria 2269
16 Ga0070660_100039424 3300005339 Bacteria 3590
17 Ga0070691_10050896 3300005341 Bacteria 1977
18 Ga0070691_10197565 3300005341 Bacteria 1055
19 Ga0070661_100017917 3300005344 Bacteria 5029
20 Ga0070661_100053218 3300005344 Bacteria 2962
21 Ga0070661_100445373 3300005344 Bacteria 1030
22 Ga0070661_100576466 3300005344 Bacteria 908
23 Ga0070668_100122790 3300005347 Bacteria 2077
24 Ga0070674_100032766 3300005356 Bacteria 3453
25 Ga0070673_100054921 3300005364 Bacteria 3136
26 Ga0070688_100243222 3300005365 Bacteria 1278
27 Ga0070659_100056429 3300005366 Bacteria 3097
28 Ga0070659_100376200 3300005366 Bacteria 1195
29 Ga0070659_100580088 3300005366 Bacteria 962
30 Ga0070714_100118538 3300005435 Bacteria 2352
31 Ga0070713_101048932 3300005436 Bacteria 787
32 Ga0070710_10697333 3300005437 Bacteria 716
33 Ga0070663_100140964 3300005455 Bacteria 1840
34 Ga0070663_100952155 3300005455 Bacteria 744
35 Ga0070662_100014862 3300005457 Bacteria 5205
36 Ga0070662_100282855 3300005457 Bacteria 1343
37 Ga0070662_100411803 3300005457 Bacteria 1117
38 Ga0070681_10126848 3300005458 Bacteria 2484
39 Ga0070681_10330323 3300005458 Bacteria 1434
40 Ga0070681_11023433 3300005458 Bacteria 746
41 Ga0070679_100024411 3300005530 Bacteria 5924
42 Ga0070679_100251290 3300005530 Bacteria 1724
43 Ga0070679_100699814 3300005530 Bacteria 956
44 Ga0070684_100013505 3300005535 Bacteria 6588
45 Ga0068853_100002730 3300005539 Bacteria 13327
46 Ga0068853_100043184 3300005539 Bacteria 3857
47 Ga0068853_100059692 3300005539 Bacteria 3295
48 Ga0068853_100647345 3300005539 Bacteria 1006
49 Ga0068853_100674358 3300005539 Bacteria 985
50 Ga0070672_102086874 3300005543 Bacteria 511
51 Ga0070695_100271705 3300005545 Bacteria 1242
52 Ga0070693_100164175 3300005547 Bacteria 1417
53 Ga0070665_100027665 3300005548 Bacteria 5710
54 Ga0070665_100135000 3300005548 Bacteria 2469
55 Ga0068855_100021753 3300005563 Bacteria 7691
56 Ga0068855_100037914 3300005563 Bacteria 5728
57 Ga0068855_100041282 3300005563 Bacteria 5469
58 Ga0068855_100182282 3300005563 Bacteria 2373
59 Ga0068855_100201724 3300005563 Bacteria 2239
60 Ga0070664_100145387 3300005564 Bacteria 2090
61 Ga0068857_100112090 3300005577 Bacteria 2452
62 Ga0068854_100159466 3300005578 Bacteria 1746
63 Ga0068854_100177197 3300005578 Bacteria 1663
64 Ga0068854_100264692 3300005578 Bacteria 1378
65 Ga0068856_100052225 3300005614 Bacteria 4030
66 Ga0068856_100217457 3300005614 Bacteria 1926
67 Ga0068852_100033963 3300005616 Bacteria 4242
68 Ga0068852_100483729 3300005616 Bacteria 1230
69 Ga0068859_100469133 3300005617 Bacteria 1355
70 Ga0068859_100690542 3300005617 Bacteria 1112
71 Ga0068864_100026873 3300005618 Bacteria 4854
72 Ga0068864_101084112 3300005618 Bacteria 797
73 Ga0068861_100187617 3300005719 Bacteria 1726
74 Ga0068851_10001428 3300005834 Bacteria 10455
75 Ga0068851_10497480 3300005834 Bacteria 730
76 Ga0068870_10912882 3300005840 Bacteria 621
77 Ga0068863_100149767 3300005841 Bacteria 2232
78 Ga0068863_100199453 3300005841 Bacteria 1925
79 Ga0068858_100030769 3300005842 Bacteria 4985
80 Ga0068862_100021523 3300005844 Bacteria 5389
81 Ga0075365_10009930 3300006038 Bacteria 5512
82 Ga0075365_10013973 3300006038 Bacteria 4820
83 Ga0075365_10038705 3300006038 Bacteria 3102
84 Ga0075365_10824199 3300006038 Bacteria 655
85 Ga0075368_10006293 3300006042 Bacteria 4141
86 Ga0075368_10026442 3300006042 Bacteria 2232
87 Ga0075363_100012247 3300006048 Bacteria 4129
88 Ga0075363_100037813 3300006048 Bacteria 2535
89 Ga0075363_100154187 3300006048 Bacteria 1298
90 Ga0075364_10037875 3300006051 Bacteria 3124
91 Ga0075364_10057502 3300006051 Bacteria 2548
92 Ga0070716_100368761 3300006173 Bacteria 1022
93 Ga0075362_10287424 3300006177 Bacteria 814
94 Ga0075367_10166607 3300006178 Bacteria 1371
95 Ga0075367_10869061 3300006178 Bacteria 575
96 Ga0075369_10031777 3300006186 Bacteria 2230
97 Ga0075369_10283598 3300006186 Bacteria 772
98 Ga0075369_10424529 3300006186 Bacteria 628
99 Ga0075366_10099054 3300006195 Bacteria 1749
100 Ga0075366_10369420 3300006195 Bacteria 881
101 Ga0097621_100110196 3300006237 Bacteria 2325
102 Ga0097621_100965932 3300006237 Bacteria 796
103 Ga0075370_10026313 3300006353 Bacteria 3222
104 Ga0075370_10168027 3300006353 Bacteria 1289
105 Ga0075370_10278837 3300006353 Bacteria 993
106 Ga0068871_100264225 3300006358 Bacteria 1502
107 Ga0068871_100378784 3300006358 Bacteria 1257
108 Ga0075434_100061594 3300006871 Bacteria 3734
109 Ga0075434_101523830 3300006871 Bacteria 678
110 Ga0068865_100263781 3300006881 Bacteria 1365
111 Ga0068865_101027694 3300006881 Bacteria 723
112 Ga0097620_100469108 3300006931 Bacteria 1355
113 Ga0097620_100690468 3300006931 Bacteria 1112
114 Ga0099824_1002409 3300006942 Bacteria 27310
115 Ga0099822_1000008 3300006943 Bacteria 76583
116 Ga0105251_10170876 3300009011 Bacteria 980
117 Ga0105240_10012556 3300009093 Bacteria 11685
118 Ga0105240_10054293 3300009093 Bacteria 5021
119 Ga0105240_10056581 3300009093 Bacteria 4907
120 Ga0105240_10135680 3300009093 Bacteria 2947
121 Ga0105245_10017461 3300009098 Bacteria 6259
122 Ga0105245_10463784 3300009098 Bacteria 1277
123 Ga0105245_10736449 3300009098 Bacteria 1021
124 Ga0105245_12925197 3300009098 Bacteria 529
125 Ga0105247_10031014 3300009101 Bacteria 3242
126 Ga0105243_10102511 3300009148 Bacteria 2378
127 Ga0105243_10870550 3300009148 Bacteria 894
128 Ga0105241_10011237 3300009174 Bacteria 6564
129 Ga0105241_10144453 3300009174 Bacteria 1941
130 Ga0105241_10154460 3300009174 Bacteria 1881
131 Ga0105241_11160333 3300009174 Bacteria 730
132 Ga0105242_10145590 3300009176 Bacteria 2061
133 Ga0105248_10071498 3300009177 Bacteria 3898
134 Ga0105248_10151393 3300009177 Bacteria 2617
135 Ga0105248_10564970 3300009177 Bacteria 1283
136 Ga0105248_10881095 3300009177 Bacteria 1011
137 Ga0105248_11334522 3300009177 Bacteria 811
138 Ga0105237_10014080 3300009545 Bacteria 8367
139 Ga0105237_10051620 3300009545 Bacteria 4130
140 Ga0105237_10103471 3300009545 Bacteria 2839
141 Ga0105237_10493780 3300009545 Bacteria 1230
142 Ga0105237_10529019 3300009545 Bacteria 1186
143 Ga0105238_10002380 3300009551 Bacteria 18868
144 Ga0105238_10532908 3300009551 Bacteria 1178
145 Ga0105238_10544596 3300009551 Bacteria 1164
146 Ga0105249_10745342 3300009553 Bacteria 1041
147 Ga0105249_10901006 3300009553 Bacteria 951
148 Ga0105239_10016742 3300010375 Bacteria 8104
149 Ga0105239_10044082 3300010375 Bacteria 4890
150 Ga0105239_10066019 3300010375 Bacteria 3975
151 Ga0105239_10078176 3300010375 Bacteria 3641
152 Ga0105239_10112511 3300010375 Bacteria 3019
153 Ga0105239_10203110 3300010375 Bacteria 2220
154 Ga0105239_10883434 3300010375 Bacteria 1026
155 Ga0105246_10009964 3300011119 Bacteria 5863
156 Ga0105246_10966735 3300011119 Bacteria 769
157 Ga0157373_10173499 3300013100 Bacteria 1517
158 Ga0157371_10027645 3300013102 Bacteria 4112
159 Ga0157371_10686540 3300013102 Bacteria 766
160 Ga0157370_10571461 3300013104 Bacteria 1036
161 Ga0157369_10003624 3300013105 Bacteria 18332
162 Ga0157369_10665566 3300013105 Bacteria 1073
163 Ga0157369_10818131 3300013105 Bacteria 957
164 Ga0157374_10144342 3300013296 Bacteria 2312
165 Ga0157374_10296236 3300013296 Bacteria 1600
166 Ga0157378_10309939 3300013297 Bacteria 1530
167 Ga0163162_10030752 3300013306 Bacteria 5321
168 Ga0163162_10244322 3300013306 Bacteria 1926
169 Ga0157372_10098144 3300013307 Bacteria 3342
170 Ga0157372_10928148 3300013307 Bacteria 1009
171 Ga0157372_11116427 3300013307 Bacteria 912
172 Ga0157375_10027157 3300013308 Bacteria 5347
173 Ga0157375_10173845 3300013308 Bacteria 2302
174 Ga0163163_10064204 3300014325 Bacteria 3643
175 Ga0163163_10102082 3300014325 Bacteria 2891
176 Ga0163163_10793068 3300014325 Bacteria 1011
177 Ga0157377_10070088 3300014745 Bacteria 2025
178 Ga0157379_10542401 3300014968 Bacteria 1081
179 Ga0157376_10015819 3300014969 Bacteria 5710
180 Ga0157376_10124095 3300014969 Bacteria 2293
181 Ga0157376_11006524 3300014969 Bacteria 856
182 Ga0157376_12633715 3300014969 Bacteria 543
183 Ga0182007_10175862 3300015262 Bacteria 738
184 Ga0213876_10024534 3300021384 Bacteria 3184
185 Ga0209677_100579 3300025253 Bacteria 20068
186 Ga0209148_1000192 3300025254 Bacteria 115724
187 Ga0209148_1009946 3300025254 Bacteria 1825
188 Ga0209233_1006130 3300025261 Bacteria 3909
189 Ga0209455_1004451 3300025272 Bacteria 4579
190 Ga0209455_1014919 3300025272 Bacteria 1733
191 Ga0209673_1053613 3300025273 Bacteria 1050
192 Ga0209564_1012844 3300025295 Bacteria 3612
193 Ga0209758_1001172 3300025297 Bacteria 33281
194 Ga0209758_1032536 3300025297 Bacteria 2114
195 Ga0207426_1076733 3300025302 Bacteria 917
196 Ga0207426_1103936 3300025302 Bacteria 728
197 Ga0209257_1013866 3300025304 Bacteria 3529
198 Ga0207656_10203527 3300025321 Bacteria 957
199 Ga0207642_10027589 3300025899 Bacteria 2326
200 Ga0207710_10041840 3300025900 Bacteria 2033
201 Ga0207710_10305251 3300025900 Bacteria 805
202 Ga0207688_10007709 3300025901 Bacteria 5864
203 Ga0207688_10431483 3300025901 Bacteria 820
204 Ga0207647_10257600 3300025904 Bacteria 1000
205 Ga0207645_10218291 3300025907 Bacteria 1256
206 Ga0207643_10073112 3300025908 Bacteria 1976
207 Ga0207643_10497794 3300025908 Bacteria 779
208 Ga0207705_10177366 3300025909 Bacteria 1607
209 Ga0207654_10025820 3300025911 Bacteria 3175
210 Ga0207654_10069305 3300025911 Bacteria 2090
211 Ga0207654_10114710 3300025911 Bacteria 1682
212 Ga0207707_10008321 3300025912 Bacteria 9000
213 Ga0207695_10000059 3300025913 Bacteria 363920
214 Ga0207695_10084064 3300025913 Bacteria 3214
215 Ga0207695_10427864 3300025913 Bacteria 1208
216 Ga0207695_10551712 3300025913 Bacteria 1034
217 Ga0207671_10034984 3300025914 Bacteria 3730
218 Ga0207671_10179144 3300025914 Bacteria 1649
219 Ga0207671_11522855 3300025914 Bacteria 516
220 Ga0207693_10542838 3300025915 Bacteria 907
221 Ga0207660_10003996 3300025917 Bacteria 9612
222 Ga0207660_10430424 3300025917 Bacteria 1065
223 Ga0207657_10012885 3300025919 Bacteria 8222
224 Ga0207649_10282619 3300025920 Bacteria 1207
225 Ga0207652_10003241 3300025921 Bacteria 13496
226 Ga0207652_10281524 3300025921 Bacteria 1500
227 Ga0207694_10035977 3300025924 Bacteria 3799
228 Ga0207694_10163417 3300025924 Bacteria 1799
229 Ga0207694_10384305 3300025924 Bacteria 1165
230 Ga0207659_10342455 3300025926 Bacteria 1238
231 Ga0207687_10035730 3300025927 Bacteria 3382
232 Ga0207687_10307215 3300025927 Bacteria 1279
233 Ga0207664_10053927 3300025929 Bacteria 3185
234 Ga0207690_10036782 3300025932 Bacteria 3173
235 Ga0207706_10042645 3300025933 Bacteria 4021
236 Ga0207706_10112999 3300025933 Bacteria 2389
237 Ga0207706_10603871 3300025933 Bacteria 942
238 Ga0207686_10045398 3300025934 Bacteria 2703
239 Ga0207686_10370462 3300025934 Bacteria 1083
240 Ga0207669_10171092 3300025937 Bacteria 1546
241 Ga0207669_11233494 3300025937 Bacteria 634
242 Ga0207704_10198041 3300025938 Bacteria 1467
243 Ga0207704_10685755 3300025938 Bacteria 847
244 Ga0207665_10308765 3300025939 Bacteria 1184
245 Ga0207711_10091655 3300025941 Bacteria 2673
246 Ga0207711_10142090 3300025941 Bacteria 2160
247 Ga0207711_10760273 3300025941 Bacteria 903
248 Ga0207689_10009165 3300025942 Bacteria 8561
249 Ga0207689_10313046 3300025942 Bacteria 1302
250 Ga0207661_10175019 3300025944 Bacteria 1870
251 Ga0207679_10408188 3300025945 Bacteria 1196
252 Ga0207667_10011866 3300025949 Bacteria 10092
253 Ga0207667_10144601 3300025949 Bacteria 2448
254 Ga0207667_10171674 3300025949 Bacteria 2228
255 Ga0207667_10792027 3300025949 Bacteria 945
256 Ga0207651_10508027 3300025960 Bacteria 1043
257 Ga0207712_10939591 3300025961 Bacteria 766
258 Ga0207668_10036850 3300025972 Bacteria 3268
259 Ga0207640_10216224 3300025981 Bacteria 1464
260 Ga0207658_10292695 3300025986 Bacteria 1400
261 Ga0207677_10109801 3300026023 Bacteria 2051
262 Ga0207703_10168390 3300026035 Bacteria 1925
263 Ga0207703_10316877 3300026035 Bacteria 1427
264 Ga0207639_10083712 3300026041 Bacteria 2532
265 Ga0207639_10143478 3300026041 Bacteria 1992
266 Ga0207639_10550556 3300026041 Bacteria 1059
267 Ga0207639_10571866 3300026041 Bacteria 1039
268 Ga0207678_10011885 3300026067 Bacteria 7645
269 Ga0207678_10039272 3300026067 Bacteria 4108
270 Ga0207678_10044237 3300026067 Bacteria 3852
271 Ga0207678_10068989 3300026067 Bacteria 3032
272 Ga0207678_10138362 3300026067 Bacteria 2078
273 Ga0207678_10258805 3300026067 Bacteria 1491
274 Ga0207678_11079981 3300026067 Bacteria 711
275 Ga0207678_11511901 3300026067 Bacteria 592
276 Ga0207702_10000365 3300026078 Bacteria 51814
277 Ga0207702_10033574 3300026078 Bacteria 4287
278 Ga0207702_10700567 3300026078 Bacteria 998
279 Ga0207702_11658530 3300026078 Bacteria 632
280 Ga0207641_10226886 3300026088 Bacteria 1734
281 Ga0207676_10150700 3300026095 Bacteria 2002
282 Ga0207676_10371576 3300026095 Bacteria 1328
283 Ga0207676_11353793 3300026095 Bacteria 707
284 Ga0207674_10070435 3300026116 Bacteria 3516
285 Ga0207675_100040838 3300026118 Bacteria 4333
286 Ga0207683_10255906 3300026121 Bacteria 1598
287 Ga0207683_10274146 3300026121 Bacteria 1541
288 Ga0207683_10378320 3300026121 Bacteria 1301
289 Ga0207698_10169467 3300026142 Bacteria 1921
290 Ga0207698_10244293 3300026142 Bacteria 1638
291 Ga0207698_10329124 3300026142 Bacteria 1434
292 Ga0207698_10341562 3300026142 Bacteria 1410
293 Ga0209589_1000026 3300027357 Bacteria 158154
294 Ga0209489_100046 3300027361 Bacteria 158154
295 Ga0209700_100047 3300027363 Bacteria 158154
296 Ga0209813_10065678 3300027866 Bacteria 1169
297 Ga0268266_10001416 3300028379 Bacteria 28634
298 Ga0268266_10283187 3300028379 Bacteria 1542
299 Ga0268266_10616803 3300028379 Bacteria 1042
300 Ga0268265_10026336 3300028380 Bacteria 4137
301 Ga0268264_11461186 3300028381 Bacteria 694
302 Ga0265334_10009855 3300028573 Bacteria 4038
303 Ga0265332_10007132 3300031238 Bacteria 5062
304 Ga0265328_10021657 3300031239 Bacteria 2451
305 Ga0265331_10118034 3300031250 Bacteria 1214
306 Ga0315911_1000019 3300033442 Bacteria 146597
307 Ga0373958_0046881 3300034819 Bacteria 902
308 Ga0373928_0017056 3300035084 Bacteria 1492
309 Ga0373940_0074034 3300035088 Bacteria 996
310 Ga0373941_0038668 3300035115 Bacteria 1462
311 Ga0373960_0040807 3300035121 Bacteria 1341
312 Ga0373955_0516419 3300035172 Bacteria 730
313 Ga0373942_0041238 3300035207 Bacteria 1261
314 Ga0373931_0007699 3300035691 Bacteria 5084
315 Ga0373927_0111194 3300035695 Bacteria 1785
316 Ga0373933_0616568 3300035724 Bacteria 713
317 Ga0373947_0363270 3300035725 Bacteria 973
318 Ga0373937_0095666 3300036401 Bacteria 2754
319 Ga0373937_0472755 3300036401 Bacteria 1191
320 Ga0373925_1130120 3300037068 Bacteria 644
321 Ga0395899_0073736 3300037312 Bacteria 2495
322 Ga0395899_0226227 3300037312 Bacteria 1294
323 Ga0395900_0000696 3300037418 Bacteria 44867
324 Ga0395900_0580630 3300037418 Bacteria 1063
325 Ga0395898_0016802 3300037466 Bacteria 7477
326 Ga0395898_0689833 3300037466 Bacteria 963
327 Ga0395905_0281150 3300037471 Bacteria 1550
328 Ga0395905_1806822 3300037471 Bacteria 517
329 Ga0436364_0377201 3300037853 Bacteria 2232
330 Ga0395901_0014471 3300038443 Bacteria 8026
331 Ga0395901_0077395 3300038443 Bacteria 3471
332 Ga0395901_0518625 3300038443 Bacteria 1211
333 Ga0436365_0136133 3300039437 Bacteria 3027
334 Ga0436365_1288596 3300039437 Bacteria 766
335 Ga0451789_0697845 3300041443 Bacteria 665
336 Ga0451833_0312650 3300041491 Bacteria 826
337 Ga0451853_3498500 3300041512 Bacteria 1000
338 Ga0466961_0887382 3300044693 Bacteria 531
339 Ga0466963_0109721 3300044694 Bacteria 1893
340 Ga0466964_0125423 3300044706 Bacteria 1163
341 Ga0466968_0282512 3300044735 Bacteria 795
342 Ga0466957_0115407 3300044842 Bacteria 1707
343 Ga0466957_0176265 3300044842 Bacteria 1394
344 Ga0466957_0413652 3300044842 Bacteria 924
345 Ga0466959_0213911 3300045049 Bacteria 1339
346 Ga0466967_0255739 3300045976 Bacteria 1674
347 Ga0466967_0570664 3300045976 Bacteria 1115
348 Ga0495592_0129660 3300046454 Bacteria 1765
349 Ga0495629_0289111 3300046459 Bacteria 1124
350 Ga0495651_0120070 3300046462 Bacteria 1932
351 Ga0495651_0463045 3300046462 Bacteria 817
352 Ga0495662_0244024 3300046476 Bacteria 885
353 Ga0495664_0046484 3300046477 Bacteria 2575
354 Ga0495664_0319308 3300046477 Bacteria 937
355 Ga0495607_0100722 3300046501 Bacteria 1548
356 Ga0495606_0031454 3300046507 Bacteria 3690
357 Ga0495608_0032064 3300046511 Bacteria 3552
358 Ga0495620_0058090 3300046515 Bacteria 1621
359 Ga0495628_0022190 3300046516 Bacteria 5217
360 Ga0495628_0089190 3300046516 Bacteria 2389
361 Ga0495630_0261524 3300046517 Bacteria 1322
362 Ga0495648_0052628 3300046524 Bacteria 2472
363 Ga0495652_0123930 3300046529 Bacteria 2056
364 Ga0495652_0203365 3300046529 Bacteria 1501
365 Ga0495652_0458828 3300046529 Bacteria 891
366 Ga0495640_0038299 3300046533 Bacteria 3373
367 Ga0495586_0251788 3300046535 Bacteria 1008
368 Ga0495587_0026203 3300046536 Bacteria 3557
369 Ga0495597_0124966 3300046542 Bacteria 1070
370 Ga0495645_0026529 3300046543 Bacteria 4206
371 Ga0495622_0006816 3300046557 Bacteria 5302
372 Ga0495667_0078724 3300046559 Bacteria 2143
373 Ga0495667_0087436 3300046559 Bacteria 2021
374 Ga0495668_0134556 3300046616 Bacteria 1353
375 Ga0495634_0203795 3300046642 Bacteria 1228
376 Ga0495625_0669550 3300046660 Bacteria 616
377 Ga0495661_0310283 3300046665 Bacteria 787
378 Ga0495588_0005975 3300046674 Bacteria 5458
379 Ga0495657_0030658 3300046675 Bacteria 3764
380 Ga0495599_0165805 3300046678 Bacteria 1364
381 Ga0495623_0006002 3300046679 Bacteria 7902
382 Ga0495623_0252227 3300046679 Bacteria 992
383 Ga0495646_0096828 3300046680 Bacteria 1696
384 Ga0495613_0041099 3300046689 Bacteria 3425
385 Ga0495613_0937418 3300046689 Bacteria 559
386 Ga0495624_0103721 3300046690 Bacteria 1750
387 Ga0495624_0111161 3300046690 Bacteria 1685
388 Ga0495624_0139212 3300046690 Bacteria 1487
389 Ga0495671_0478180 3300046692 Bacteria 595
390 Ga0495600_0021601 3300046809 Bacteria 4124
391 Ga0495600_0305428 3300046809 Bacteria 1003
392 Ga0495600_0681432 3300046809 Bacteria 619
393 Ga0495581_0438448 3300047315 Bacteria 761
394 Ga0495604_0001041 3300047317 Bacteria 23066
395 Ga0495604_0246443 3300047317 Bacteria 1220
396 Ga0495604_0312322 3300047317 Bacteria 1053
397 Ga0495674_0099449 3300047319 Bacteria 2476
398 Ga0495676_0425032 3300047321 Bacteria 879
399 Ga0495680_0007821 3300047322 Bacteria 9763
400 Ga0495680_0089468 3300047322 Bacteria 2311
401 Ga0495683_0069612 3300047323 Bacteria 1729
402 Ga0495675_0010362 3300047444 Bacteria 5826
403 Ga0495673_0116687 3300047469 Bacteria 1061
404 Ga0495684_0361823 3300047471 Bacteria 1027
405 Ga0495686_0097863 3300047472 Bacteria 1773
406 Ga0495686_0488498 3300047472 Bacteria 650
407 Ga0495602_0004605 3300048088 Bacteria 14387
408 Ga0495602_0180667 3300048088 Bacteria 1628
409 Ga0495602_0320032 3300048088 Bacteria 1129
410 Ga0496100_0718102 3300048903 Bacteria 780
411 Ga0496101_0019887 3300048904 Bacteria 4591
412 Ga0496101_0773193 3300048904 Bacteria 758
413 Ga0496103_0017706 3300048906 Bacteria 4266
414 Ga0496103_0487739 3300048906 Bacteria 789
415 Ga0496104_0029834 3300048907 Bacteria 5062
416 Ga0496104_0085298 3300048907 Bacteria 3014
417 Ga0496104_0187543 3300048907 Bacteria 1979
418 Ga0496104_0433058 3300048907 Bacteria 1227
419 Ga0496104_1179006 3300048907 Bacteria 669
420 Ga0496105_0015797 3300048908 Bacteria 6023
421 Ga0496105_0051245 3300048908 Bacteria 3410
422 Ga0496105_0326930 3300048908 Bacteria 1228
423 Ga0496106_0013613 3300048909 Bacteria 6005
424 Ga0496106_0034705 3300048909 Bacteria 3769
425 Ga0496106_0115194 3300048909 Bacteria 2096
426 Ga0496106_0737333 3300048909 Bacteria 784
427 Ga0496106_1089059 3300048909 Bacteria 626
428 Ga0496107_0002239 3300048910 Bacteria 12464
429 Ga0496107_0750740 3300048910 Bacteria 716
430 Ga0496107_0794907 3300048910 Bacteria 693
431 Ga0496107_0828641 3300048910 Bacteria 676
432 Ga0496108_0007089 3300048911 Bacteria 9077
433 Ga0496108_0042575 3300048911 Bacteria 3791
434 Ga0496108_0907341 3300048911 Unclassified 756
435 Ga0496109_0171217 3300048912 Bacteria 2037
436 Ga0496109_0691728 3300048912 Bacteria 957
437 Ga0496110_0019982 3300048913 Bacteria 5646
438 Ga0496110_0222460 3300048913 Bacteria 1717
439 Ga0496110_0259579 3300048913 Bacteria 1581
440 Ga0496111_0033999 3300048914 Bacteria 3638
441 Ga0496112_0000004 3300048915 Bacteria 553294
442 Ga0496112_0016426 3300048915 Bacteria 6934
443 Ga0496112_0041775 3300048915 Bacteria 4487
444 Ga0496113_0087349 3300048916 Bacteria 2397
445 Ga0496113_0478955 3300048916 Bacteria 1000
446 Ga0496113_0860176 3300048916 Bacteria 718
447 Ga0496113_1470146 3300048916 Bacteria 526
448 Ga0496114_0004928 3300048917 Bacteria 10402
449 Ga0496114_0044223 3300048917 Bacteria 3694
450 Ga0496114_0401489 3300048917 Bacteria 1214
451 Ga0496114_0452516 3300048917 Unclassified 1137
452 Ga0496114_0645780 3300048917 Bacteria 931
453 Ga0496114_1653304 3300048917 Bacteria 528
454 Ga0496115_0005238 3300048918 Bacteria 9424
455 Ga0496116_0042244 3300048919 Bacteria 3119
456 Ga0496116_0266202 3300048919 Bacteria 841
457 Ga0496117_0086414 3300048920 Bacteria 2038
458 Ga0496117_0169051 3300048920 Bacteria 1271
459 Ga0496118_0020050 3300048921 Bacteria 5947
460 Ga0496120_0211018 3300048923 Bacteria 934
461 Ga0496121_0020703 3300048924 Bacteria 6490
462 Ga0496121_0038297 3300048924 Bacteria 4249
463 Ga0496121_0182096 3300048924 Bacteria 1515
464 Ga0496121_0446577 3300048924 Bacteria 834
465 Ga0496124_0413352 3300048927 Bacteria 932
466 Ga0496125_0313904 3300048928 Bacteria 954
467 Ga0496126_0085030 3300048929 Bacteria 2789
468 Ga0496126_0555728 3300048929 Bacteria 910
469 Ga0501031_0016891 3300049568 Bacteria 4740
470 Ga0501031_0250116 3300049568 Bacteria 1152
471 Ga0501031_0324483 3300049568 Bacteria 997
472 Ga0501032_0004084 3300049569 Bacteria 11063
473 Ga0501032_0034855 3300049569 Bacteria 3442
474 Ga0501032_0050709 3300049569 Bacteria 2798
475 Ga0501032_0084741 3300049569 Bacteria 2107
476 Ga0501032_0549447 3300049569 Bacteria 736
477 Ga0501033_0000060 3300049570 Bacteria 103159
478 Ga0501033_0025632 3300049570 Bacteria 4442
479 Ga0501033_0057020 3300049570 Bacteria 2887
480 Ga0501034_0000117 3300049571 Bacteria 144865
481 Ga0501034_0027174 3300049571 Bacteria 5821
482 Ga0501034_0047099 3300049571 Bacteria 4355
483 Ga0501034_0508735 3300049571 Bacteria 1117
484 Ga0501034_0545178 3300049571 Bacteria 1070
485 Ga0501036_0000188 3300049572 Bacteria 41101
486 Ga0501036_0088879 3300049572 Bacteria 2610
487 Ga0501036_0208515 3300049572 Bacteria 1642
488 Ga0501036_0210467 3300049572 Bacteria 1634
489 Ga0501037_0000402 3300049573 Bacteria 36091
490 Ga0501037_0064879 3300049573 Bacteria 2660
491 Ga0501037_0094044 3300049573 Bacteria 2167
492 Ga0501037_0423010 3300049573 Bacteria 911
493 Ga0501038_0000540 3300049574 Bacteria 33178
494 Ga0501038_0002993 3300049574 Bacteria 15751
495 Ga0501038_0032560 3300049574 Bacteria 4598
496 Ga0501038_0105152 3300049574 Bacteria 2345
497 Ga0501038_0216242 3300049574 Bacteria 1531
498 Ga0501038_0247101 3300049574 Bacteria 1414
499 Ga0501039_0000431 3300049575 Bacteria 30281
500 Ga0501039_0146322 3300049575 Bacteria 1856
501 Ga0501039_0218513 3300049575 Bacteria 1498
502 Ga0501039_0417020 3300049575 Bacteria 1054
503 Ga0501040_0130248 3300049576 Bacteria 1768
504 Ga0501040_0192361 3300049576 Bacteria 1448
505 Ga0501042_0025253 3300049578 Bacteria 4172
506 Ga0501042_0053024 3300049578 Bacteria 2893
507 Ga0501043_0001032 3300049579 Bacteria 24462
508 Ga0501043_0018314 3300049579 Bacteria 5491
509 Ga0501043_0023614 3300049579 Bacteria 4822
510 Ga0501043_0273384 3300049579 Bacteria 1296
511 Ga0501046_0002670 3300049580 Bacteria 16628
512 Ga0501046_0019018 3300049580 Bacteria 5701
513 Ga0501046_0100506 3300049580 Bacteria 2219
514 Ga0501046_0189165 3300049580 Bacteria 1536
515 Ga0501046_0443497 3300049580 Bacteria 934
516 Ga0501047_0000246 3300049581 Bacteria 64361
517 Ga0501047_0022391 3300049581 Bacteria 6068
518 Ga0501047_0089916 3300049581 Bacteria 2947
519 Ga0501047_0112133 3300049581 Bacteria 2609
520 Ga0501047_0337561 3300049581 Bacteria 1345
521 Ga0501048_0000878 3300049582 Bacteria 22207
522 Ga0501048_1016618 3300049582 Bacteria 596
523 Ga0501067_0000320 3300049583 Bacteria 26233
524 Ga0501067_0532386 3300049583 Bacteria 658
525 Ga0501068_0004312 3300049584 Bacteria 7724
526 Ga0501068_0007826 3300049584 Bacteria 5920
527 Ga0501069_0003261 3300049585 Bacteria 8324
528 Ga0501070_0000779 3300049586 Bacteria 28961
529 Ga0501070_0042897 3300049586 Bacteria 3766
530 Ga0501071_0119341 3300049587 Bacteria 1954
531 Ga0501072_0241226 3300049588 Bacteria 1439
532 Ga0501072_0263340 3300049588 Bacteria 1372
533 Ga0501072_0285821 3300049588 Bacteria 1311
534 Ga0501073_0000093 3300049589 Bacteria 56882
535 Ga0501074_0000127 3300049590 Bacteria 38795
536 Ga0501074_0021500 3300049590 Bacteria 4684
537 Ga0501074_0373520 3300049590 Bacteria 1011
538 Ga0501076_0177507 3300049592 Bacteria 1736
539 Ga0501076_1079084 3300049592 Bacteria 661
540 Ga0501077_0202273 3300049593 Bacteria 1262
541 Ga0501079_0013697 3300049741 Bacteria 6184
542 Ga0501079_0046768 3300049741 Bacteria 3339
543 Ga0501080_0001845 3300049742 Bacteria 18181
544 Ga0501080_0012725 3300049742 Bacteria 7716
545 Ga0501080_0055276 3300049742 Bacteria 3697
546 Ga0501080_0179782 3300049742 Bacteria 1947
547 Ga0501083_0004463 3300049744 Bacteria 9887
548 Ga0501083_0018238 3300049744 Bacteria 4891
549 Ga0501083_0171879 3300049744 Bacteria 1416
550 Ga0501035_0000798 3300049822 Bacteria 33520
551 Ga0501035_0009234 3300049822 Bacteria 9169
552 Ga0501035_0165102 3300049822 Bacteria 1915
553 Ga0501035_0245458 3300049822 Bacteria 1522
554 Ga0501035_0292094 3300049822 Bacteria 1375
555 Ga0501044_0001581 3300049823 Bacteria 26656
556 Ga0501044_0018220 3300049823 Bacteria 7530
557 Ga0501044_0039565 3300049823 Bacteria 4918
558 Ga0501044_0621452 3300049823 Bacteria 972
559 Ga0501045_0012744 3300049824 Bacteria 5923
560 Ga0501045_0161957 3300049824 Bacteria 1665
561 Ga0501045_0737620 3300049824 Bacteria 726
562 nmdc:mga03n38_51576_c1 3300050490 Bacteria 1838
563 nmdc:mga00v17_96973_c1 3300050491 Bacteria 1858
564 nmdc:mga0yw44_16739_c1 3300050492 Bacteria 3970
565 nmdc:mga0yw44_55099_c1 3300050492 Bacteria 2419
566 nmdc:mga0k408_385866_c1 3300050493 Bacteria 834
567 nmdc:mga06z11_220546_c1 3300050494 Bacteria 1108
568 nmdc:mga06z11_777982_c1 3300050494 Bacteria 583
569 nmdc:mga04h51_12432_c1 3300050495 Bacteria 2389
570 nmdc:mga04h51_58265_c1 3300050495 Bacteria 1316
571 nmdc:mga07m45_462860_c1 3300050496 Bacteria 735
572 nmdc:mga07m45_50497_c1 3300050496 Bacteria 2344
573 nmdc:mga08y16_830837_c1 3300050511 Bacteria 914
574 nmdc:mga0n895_395533_c1 3300050512 Bacteria 1398
575 nmdc:mga0n895_46805_c1 3300050512 Bacteria 4227
576 nmdc:mga0a205_1186142_c1 3300050515 Bacteria 611
577 nmdc:mga0sz30_118129_c1 3300050516 Bacteria 1165
578 nmdc:mga0sz30_130189_c1 3300050516 Bacteria 1108
579 nmdc:mga0sz30_178087_c1 3300050516 Bacteria 943
580 Ga0495601_0195030 3300053077 Bacteria 1324
581 Ga0495601_0304960 3300053077 Bacteria 1037
582 Ga0495601_0666579 3300053077 Bacteria 665
583 Ga0495595_0036053 3300053084 Bacteria 2243
584 Ga0495619_0034689 3300053085 Bacteria 3281
585 Ga0495619_0045567 3300053085 Bacteria 2882
586 Ga0500553_243484 3300053101 Bacteria 556
587 Ga0500557_000066 3300053105 Bacteria 41202
588 Ga0500595_017221 3300053119 Bacteria 2672
589 Ga0500636_0217595 3300053177 Bacteria 998
590 Ga0500636_0263922 3300053177 Bacteria 870
591 Ga0500625_002177 3300053729 Bacteria 7216
592 Ga0501084_0000963 3300054114 Bacteria 22308
593 Ga0501082_0002692 3300060353 Bacteria 15526
594 Ga0501082_0152367 3300060353 Bacteria 2008
595 Ga0466962_0023059 3300061719 Bacteria 2993

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2744054633 2745077845 133
2 iso_pu_bacteria 2507262055 2507505590 135
3 iso_pu_bacteria 2508501042 2508695851 135
4 iso_pu_bacteria 2515154112 2515623988 135
5 iso_pu_bacteria 2874590934 2874591612 135
6 iso_pu_bacteria 2874645413 2874645966 135
7 iso_pu_bacteria 2876771140 2876772061 135
8 iso_pu_bacteria 2876818435 2876819282 135
9 iso_pu_bacteria 2879074833 2879075519 135
10 iso_pu_bacteria 2879127579 2879127994 135
11 iso_pu_bacteria 2879142872 2879143293 135
12 iso_pu_bacteria 2935648319 2935649034 135
13 iso_pu_bacteria 2935656913 2935658194 135
14 iso_pu_bacteria 2935769743 2935774143 135
15 iso_pu_bacteria 2935777560 2935783723 135
16 iso_pu_bacteria 2935785616 2935789140 135
17 iso_pu_bacteria 2935975950 2935982180 135
18 iso_pu_bacteria 2935984226 2935985319 135
19 iso_pu_bacteria 2936011229 2936012413 135
20 iso_pu_bacteria 2936019824 2936020506 135
21 iso_pu_bacteria 2936028420 2936029706 135
22 iso_pu_bacteria 2936046547 2936051829 135
23 iso_pu_bacteria 2936055302 2936056917 135
24 iso_pu_bacteria 8016522445 8016525851 135
25 iso_pu_bacteria 8016530956 8016539451 135
26 iso_pu_bacteria 8016539877 8016543740 135
27 iso_pu_bacteria 8016557553 8016557975 135
28 iso_pu_bacteria 8016566248 8016569141 135
29 iso_pu_bacteria 8016575299 8016581779 135
30 iso_pu_bacteria 8016595262 8016595991 135
31 iso_pu_bacteria 8016603502 8016606863 135
32 iso_pu_bacteria 8016613128 8016618770 135
33 iso_pu_bacteria 8016622563 8016622763 135
34 iso_pu_bacteria 8016630954 8016635254 135
35 iso_pu_bacteria 8019530166 8019530731 135
36 iso_pu_bacteria 8019538911 8019540854 135
37 iso_pu_bacteria 8019547302 8019549762 135
38 iso_pu_bacteria 8019619141 8019623327 135
39 iso_pu_bacteria 8019629233 8019629768 135
40 iso_pu_bacteria 8019638758 8019640848 135
41 iso_pu_bacteria 8019659431 8019666614 135
42 iso_pu_bacteria 8019668869 8019676349 135
43 iso_pu_bacteria 2513237094 2513642296 137
44 iso_pu_bacteria 2513237096 2513660735 137
45 iso_pu_bacteria 2513237137 2513863030 137
46 iso_pu_bacteria 2513237145 2513922531 137
47 iso_pu_bacteria 2528768022 2528852110 137
48 iso_pu_bacteria 2824600985 2824609114 137
49 iso_pu_bacteria 2824609381 2824615644 137
50 iso_pu_bacteria 2824661429 2824670904 137
51 iso_pu_bacteria 2824704595 2824713009 137
52 iso_pu_bacteria 2824753945 2824763358 137
53 iso_pu_bacteria 2824763712 2824773217 137
54 iso_pu_bacteria 2844315083 2844315825 137
55 iso_pu_bacteria 2879099564 2879106736 137
56 iso_pu_bacteria 2885409591 2885414298 137
57 iso_pu_bacteria 2903727486 2903730875 137
58 iso_pu_bacteria 2904711408 2904714145 137
59 iso_pu_bacteria 2906602504 2906603698 137
60 iso_pu_bacteria 2906610324 2906614166 137
61 iso_pu_bacteria 2922368715 2922369112 137
62 iso_pu_bacteria 2929615660 2929618973 137
63 iso_pu_bacteria 2929624759 2929631050 137
64 iso_pu_bacteria 2932784394 2932789014 137
65 iso_pu_bacteria 2932794094 2932799943 137
66 iso_pu_bacteria 2932801729 2932808867 137
67 iso_pu_bacteria 2932809354 2932814348 137
68 iso_pu_bacteria 2932818245 2932820474 137
69 iso_pu_bacteria 2932828146 2932834507 137
70 iso_pu_bacteria 2933577622 2933580317 137
71 iso_pu_bacteria 2935616580 2935624489 137
72 iso_pu_bacteria 2935638405 2935645879 137
73 iso_pu_bacteria 2935665750 2935673446 137
74 iso_pu_bacteria 2935675223 2935682623 137
75 iso_pu_bacteria 2935684952 2935686763 137
76 iso_pu_bacteria 2935694250 2935701558 137
77 iso_pu_bacteria 2935703347 2935710468 137
78 iso_pu_bacteria 2935713505 2935716451 137
79 iso_pu_bacteria 2935722832 2935723424 137
80 iso_pu_bacteria 2935732158 2935734980 137
81 iso_pu_bacteria 2935741537 2935744229 137
82 iso_pu_bacteria 2935750917 2935752729 137
83 iso_pu_bacteria 2935760218 2935764724 137
84 iso_pu_bacteria 2935801545 2935806165 137
85 iso_pu_bacteria 2935810662 2935816931 137
86 iso_pu_bacteria 2935827899 2935835220 137
87 iso_pu_bacteria 2935837841 2935841398 137
88 iso_pu_bacteria 2935855204 2935863034 137
89 iso_pu_bacteria 2935864058 2935871844 137
90 iso_pu_bacteria 2935873716 2935882265 137
91 iso_pu_bacteria 2935883170 2935883262 137
92 iso_pu_bacteria 2935959822 2935966446 137
93 iso_pu_bacteria 2935992306 2936000164 137
94 iso_pu_bacteria 2936002035 2936010078 137
95 iso_pu_bacteria 2936037263 2936043922 137
96 iso_pu_bacteria 2940556831 2940558642 137
97 iso_pu_bacteria 2941531003 2941535676 137
98 iso_pu_bacteria 2941538514 2941543624 137
99 iso_pu_bacteria 3005718088 3005718643 137
100 iso_pu_bacteria 8016511872 8016517786 137
101 iso_pu_bacteria 8017057580 8017058842 137
102 iso_pu_bacteria 8019576017 8019576811 137
103 iso_pu_bacteria 8019586578 8019594864 137
104 iso_pu_bacteria 8019597564 8019606875 137
105 iso_pu_bacteria 8019608314 8019611633 137
106 iso_pu_bacteria 8019648815 8019652945 137
107 iso_pu_bacteria 8055742211 8055742822 137
108 iso_pu_bacteria 8056967851 8056975644 137
109 3300005344 Ga0070661_100445373 Ga0070661_1004453732 139
110 3300005543 Ga0070672_102086874 Ga0070672_1020868741 139
111 3300006186 Ga0075369_10424529 Ga0075369_104245292 139
112 3300006353 Ga0075370_10278837 Ga0075370_102788372 139
113 3300009177 Ga0105248_10881095 Ga0105248_108810952 139
114 3300025941 Ga0207711_10760273 Ga0207711_107602731 139
115 3300025981 Ga0207640_10216224 Ga0207640_102162242 139
116 3300026078 Ga0207702_10700567 Ga0207702_107005672 139
117 3300041491 Ga0451833_0312650 Ga0451833_0312650_184_603 139
118 3300041512 Ga0451853_3498500 Ga0451853_3498500_533_952 139
119 3300048907 Ga0496104_1179006 Ga0496104_1179006_153_572 139
120 3300048917 Ga0496114_0645780 Ga0496114_0645780_380_799 139
121 3300053105 Ga0500557_000066 Ga0500557_000066_5659_6078 139
122 3300053177 Ga0500636_0263922 Ga0500636_0263922_66_485 139
123 3300053729 Ga0500625_002177 Ga0500625_002177_1370_1789 139
124 3300005338 Ga0068868_100107022 Ga0068868_1001070222 140
125 3300009098 Ga0105245_12925197 Ga0105245_129251971 140
126 3300009177 Ga0105248_10564970 Ga0105248_105649702 140
127 3300025915 Ga0207693_10542838 Ga0207693_105428382 140
128 3300025927 Ga0207687_10307215 Ga0207687_103072152 140
129 3300046454 Ga0495592_0129660 Ga0495592_0129660_1212_1634 140
130 3300046462 Ga0495651_0120070 Ga0495651_0120070_1232_1654 140
131 3300046476 Ga0495662_0244024 Ga0495662_0244024_433_855 140
132 3300046477 Ga0495664_0046484 Ga0495664_0046484_479_901 140
133 3300046511 Ga0495608_0032064 Ga0495608_0032064_1161_1583 140
134 3300046516 Ga0495628_0022190 Ga0495628_0022190_2312_2734 140
135 3300046517 Ga0495630_0261524 Ga0495630_0261524_447_869 140
136 3300046529 Ga0495652_0203365 Ga0495652_0203365_88_510 140
137 3300046533 Ga0495640_0038299 Ga0495640_0038299_2151_2573 140
138 3300046536 Ga0495587_0026203 Ga0495587_0026203_1109_1531 140
139 3300046543 Ga0495645_0026529 Ga0495645_0026529_2146_2568 140
140 3300046559 Ga0495667_0078724 Ga0495667_0078724_1418_1840 140
141 3300046675 Ga0495657_0030658 Ga0495657_0030658_163_585 140
142 3300046678 Ga0495599_0165805 Ga0495599_0165805_327_749 140
143 3300046679 Ga0495623_0006002 Ga0495623_0006002_3705_4127 140
144 3300046680 Ga0495646_0096828 Ga0495646_0096828_231_653 140
145 3300046689 Ga0495613_0041099 Ga0495613_0041099_1101_1523 140
146 3300046690 Ga0495624_0139212 Ga0495624_0139212_416_838 140
147 3300046809 Ga0495600_0021601 Ga0495600_0021601_856_1278 140
148 3300047317 Ga0495604_0001041 Ga0495604_0001041_15322_15744 140
149 3300047319 Ga0495674_0099449 Ga0495674_0099449_729_1151 140
150 3300047322 Ga0495680_0007821 Ga0495680_0007821_8464_8886 140
151 3300047444 Ga0495675_0010362 Ga0495675_0010362_175_597 140
152 3300047471 Ga0495684_0361823 Ga0495684_0361823_304_726 140
153 3300048088 Ga0495602_0004605 Ga0495602_0004605_13834_14256 140
154 3300048924 Ga0496121_0446577 Ga0496121_0446577_55_477 140
155 3300049580 Ga0501046_0189165 Ga0501046_0189165_191_613 140
156 3300049581 Ga0501047_0089916 Ga0501047_0089916_2151_2573 140
157 3300049582 Ga0501048_1016618 Ga0501048_1016618_160_582 140
158 3300049583 Ga0501067_0532386 Ga0501067_0532386_125_547 140
159 3300049586 Ga0501070_0042897 Ga0501070_0042897_227_649 140
160 3300049590 Ga0501074_0021500 Ga0501074_0021500_722_1144 140
161 3300049742 Ga0501080_0012725 Ga0501080_0012725_1061_1483 140
162 3300053084 Ga0495595_0036053 Ga0495595_0036053_859_1281 140
163 3300053085 Ga0495619_0034689 Ga0495619_0034689_131_553 140
164 3300001989 JGI24739J22299_10134666 JGI24739J22299_101346661 141
165 3300001990 JGI24737J22298_10193408 JGI24737J22298_101934081 141
166 3300003215 JGI25153J46596_10002528 JGI25153J46596_100025285 141
167 3300003752 Ga0055539_1014096 Ga0055539_10140962 141
168 3300005327 Ga0070658_10755586 Ga0070658_107555861 141
169 3300005327 Ga0070658_11431232 Ga0070658_114312321 141
170 3300005328 Ga0070676_10235753 Ga0070676_102357532 141
171 3300005331 Ga0070670_100051947 Ga0070670_1000519473 141
172 3300005334 Ga0068869_100012989 Ga0068869_1000129892 141
173 3300005335 Ga0070666_10066516 Ga0070666_100665165 141
174 3300005335 Ga0070666_10379765 Ga0070666_103797652 141
175 3300005335 Ga0070666_11103636 Ga0070666_111036361 141
176 3300005336 Ga0070680_100094004 Ga0070680_1000940044 141
177 3300005338 Ga0068868_100011843 Ga0068868_1000118433 141
178 3300005339 Ga0070660_100039424 Ga0070660_1000394243 141
179 3300005341 Ga0070691_10050896 Ga0070691_100508963 141
180 3300005341 Ga0070691_10197565 Ga0070691_101975651 141
181 3300005344 Ga0070661_100017917 Ga0070661_1000179173 141
182 3300005344 Ga0070661_100053218 Ga0070661_1000532183 141
183 3300005344 Ga0070661_100576466 Ga0070661_1005764662 141
184 3300005347 Ga0070668_100122790 Ga0070668_1001227902 141
185 3300005356 Ga0070674_100032766 Ga0070674_1000327663 141
186 3300005364 Ga0070673_100054921 Ga0070673_1000549212 141
187 3300005365 Ga0070688_100243222 Ga0070688_1002432222 141
188 3300005366 Ga0070659_100056429 Ga0070659_1000564293 141
189 3300005366 Ga0070659_100376200 Ga0070659_1003762002 141
190 3300005366 Ga0070659_100580088 Ga0070659_1005800882 141
191 3300005435 Ga0070714_100118538 Ga0070714_1001185383 141
192 3300005436 Ga0070713_101048932 Ga0070713_1010489322 141
193 3300005437 Ga0070710_10697333 Ga0070710_106973332 141
194 3300005455 Ga0070663_100140964 Ga0070663_1001409642 141
195 3300005455 Ga0070663_100952155 Ga0070663_1009521552 141
196 3300005457 Ga0070662_100014862 Ga0070662_1000148625 141
197 3300005457 Ga0070662_100282855 Ga0070662_1002828552 141
198 3300005457 Ga0070662_100411803 Ga0070662_1004118032 141
199 3300005458 Ga0070681_10126848 Ga0070681_101268484 141
200 3300005458 Ga0070681_10330323 Ga0070681_103303232 141
201 3300005458 Ga0070681_11023433 Ga0070681_110234331 141
202 3300005530 Ga0070679_100024411 Ga0070679_1000244117 141
203 3300005530 Ga0070679_100251290 Ga0070679_1002512902 141
204 3300005530 Ga0070679_100699814 Ga0070679_1006998141 141
205 3300005535 Ga0070684_100013505 Ga0070684_1000135053 141
206 3300005539 Ga0068853_100002730 Ga0068853_1000027306 141
207 3300005539 Ga0068853_100043184 Ga0068853_1000431844 141
208 3300005539 Ga0068853_100059692 Ga0068853_1000596922 141
209 3300005539 Ga0068853_100647345 Ga0068853_1006473452 141
210 3300005539 Ga0068853_100674358 Ga0068853_1006743582 141
211 3300005545 Ga0070695_100271705 Ga0070695_1002717052 141
212 3300005547 Ga0070693_100164175 Ga0070693_1001641753 141
213 3300005548 Ga0070665_100027665 Ga0070665_1000276655 141
214 3300005548 Ga0070665_100135000 Ga0070665_1001350003 141
215 3300005563 Ga0068855_100021753 Ga0068855_1000217533 141
216 3300005563 Ga0068855_100037914 Ga0068855_1000379145 141
217 3300005563 Ga0068855_100041282 Ga0068855_1000412824 141
218 3300005563 Ga0068855_100182282 Ga0068855_1001822822 141
219 3300005563 Ga0068855_100201724 Ga0068855_1002017244 141
220 3300005564 Ga0070664_100145387 Ga0070664_1001453871 141
221 3300005577 Ga0068857_100112090 Ga0068857_1001120903 141
222 3300005578 Ga0068854_100159466 Ga0068854_1001594662 141
223 3300005578 Ga0068854_100177197 Ga0068854_1001771973 141
224 3300005578 Ga0068854_100264692 Ga0068854_1002646922 141
225 3300005614 Ga0068856_100052225 Ga0068856_1000522253 141
226 3300005614 Ga0068856_100217457 Ga0068856_1002174571 141
227 3300005616 Ga0068852_100033963 Ga0068852_1000339633 141
228 3300005616 Ga0068852_100483729 Ga0068852_1004837292 141
229 3300005617 Ga0068859_100469133 Ga0068859_1004691332 141
230 3300005617 Ga0068859_100690542 Ga0068859_1006905422 141
231 3300005618 Ga0068864_100026873 Ga0068864_1000268734 141
232 3300005618 Ga0068864_101084112 Ga0068864_1010841122 141
233 3300005719 Ga0068861_100187617 Ga0068861_1001876172 141
234 3300005834 Ga0068851_10001428 Ga0068851_1000142810 141
235 3300005834 Ga0068851_10497480 Ga0068851_104974802 141
236 3300005840 Ga0068870_10912882 Ga0068870_109128821 141
237 3300005841 Ga0068863_100149767 Ga0068863_1001497672 141
238 3300005841 Ga0068863_100199453 Ga0068863_1001994533 141
239 3300005842 Ga0068858_100030769 Ga0068858_1000307695 141
240 3300005844 Ga0068862_100021523 Ga0068862_1000215232 141
241 3300006038 Ga0075365_10009930 Ga0075365_100099304 141
242 3300006038 Ga0075365_10013973 Ga0075365_100139732 141
243 3300006038 Ga0075365_10038705 Ga0075365_100387052 141
244 3300006038 Ga0075365_10824199 Ga0075365_108241992 141
245 3300006042 Ga0075368_10006293 Ga0075368_100062932 141
246 3300006042 Ga0075368_10026442 Ga0075368_100264422 141
247 3300006048 Ga0075363_100012247 Ga0075363_1000122472 141
248 3300006048 Ga0075363_100037813 Ga0075363_1000378132 141
249 3300006048 Ga0075363_100154187 Ga0075363_1001541871 141
250 3300006051 Ga0075364_10037875 Ga0075364_100378753 141
251 3300006051 Ga0075364_10057502 Ga0075364_100575022 141
252 3300006173 Ga0070716_100368761 Ga0070716_1003687612 141
253 3300006177 Ga0075362_10287424 Ga0075362_102874242 141
254 3300006178 Ga0075367_10166607 Ga0075367_101666072 141
255 3300006178 Ga0075367_10869061 Ga0075367_108690611 141
256 3300006186 Ga0075369_10031777 Ga0075369_100317773 141
257 3300006186 Ga0075369_10283598 Ga0075369_102835982 141
258 3300006195 Ga0075366_10099054 Ga0075366_100990543 141
259 3300006195 Ga0075366_10369420 Ga0075366_103694202 141
260 3300006237 Ga0097621_100110196 Ga0097621_1001101963 141
261 3300006237 Ga0097621_100965932 Ga0097621_1009659321 141
262 3300006353 Ga0075370_10026313 Ga0075370_100263132 141
263 3300006353 Ga0075370_10168027 Ga0075370_101680272 141
264 3300006358 Ga0068871_100264225 Ga0068871_1002642252 141
265 3300006358 Ga0068871_100378784 Ga0068871_1003787841 141
266 3300006871 Ga0075434_100061594 Ga0075434_1000615943 141
267 3300006871 Ga0075434_101523830 Ga0075434_1015238301 141
268 3300006881 Ga0068865_100263781 Ga0068865_1002637812 141
269 3300006881 Ga0068865_101027694 Ga0068865_1010276942 141
270 3300006931 Ga0097620_100469108 Ga0097620_1004691082 141
271 3300006931 Ga0097620_100690468 Ga0097620_1006904682 141
272 3300006942 Ga0099824_1002409 Ga0099824_100240923 141
273 3300006943 Ga0099822_1000008 Ga0099822_100000868 141
274 3300009011 Ga0105251_10170876 Ga0105251_101708762 141
275 3300009093 Ga0105240_10012556 Ga0105240_1001255612 141
276 3300009093 Ga0105240_10054293 Ga0105240_100542933 141
277 3300009093 Ga0105240_10056581 Ga0105240_100565812 141
278 3300009093 Ga0105240_10135680 Ga0105240_101356802 141
279 3300009098 Ga0105245_10017461 Ga0105245_100174612 141
280 3300009098 Ga0105245_10463784 Ga0105245_104637841 141
281 3300009098 Ga0105245_10736449 Ga0105245_107364492 141
282 3300009101 Ga0105247_10031014 Ga0105247_100310142 141
283 3300009148 Ga0105243_10102511 Ga0105243_101025113 141
284 3300009148 Ga0105243_10870550 Ga0105243_108705502 141
285 3300009174 Ga0105241_10011237 Ga0105241_100112372 141
286 3300009174 Ga0105241_10144453 Ga0105241_101444532 141
287 3300009174 Ga0105241_10154460 Ga0105241_101544603 141
288 3300009174 Ga0105241_11160333 Ga0105241_111603331 141
289 3300009176 Ga0105242_10145590 Ga0105242_101455902 141
290 3300009177 Ga0105248_10071498 Ga0105248_100714981 141
291 3300009177 Ga0105248_10151393 Ga0105248_101513932 141
292 3300009177 Ga0105248_11334522 Ga0105248_113345221 141
293 3300009545 Ga0105237_10014080 Ga0105237_100140808 141
294 3300009545 Ga0105237_10051620 Ga0105237_100516202 141
295 3300009545 Ga0105237_10103471 Ga0105237_101034713 141
296 3300009545 Ga0105237_10493780 Ga0105237_104937801 141
297 3300009545 Ga0105237_10529019 Ga0105237_105290192 141
298 3300009551 Ga0105238_10002380 Ga0105238_1000238014 141
299 3300009551 Ga0105238_10532908 Ga0105238_105329082 141
300 3300009551 Ga0105238_10544596 Ga0105238_105445962 141
301 3300009553 Ga0105249_10745342 Ga0105249_107453422 141
302 3300009553 Ga0105249_10901006 Ga0105249_109010062 141
303 3300010375 Ga0105239_10016742 Ga0105239_100167422 141
304 3300010375 Ga0105239_10044082 Ga0105239_100440822 141
305 3300010375 Ga0105239_10066019 Ga0105239_100660193 141
306 3300010375 Ga0105239_10078176 Ga0105239_100781762 141
307 3300010375 Ga0105239_10112511 Ga0105239_101125112 141
308 3300010375 Ga0105239_10203110 Ga0105239_102031102 141
309 3300010375 Ga0105239_10883434 Ga0105239_108834342 141
310 3300011119 Ga0105246_10009964 Ga0105246_100099642 141
311 3300011119 Ga0105246_10966735 Ga0105246_109667352 141
312 3300013100 Ga0157373_10173499 Ga0157373_101734992 141
313 3300013102 Ga0157371_10027645 Ga0157371_100276452 141
314 3300013102 Ga0157371_10686540 Ga0157371_106865401 141
315 3300013104 Ga0157370_10571461 Ga0157370_105714612 141
316 3300013105 Ga0157369_10003624 Ga0157369_100036245 141
317 3300013105 Ga0157369_10665566 Ga0157369_106655662 141
318 3300013105 Ga0157369_10818131 Ga0157369_108181312 141
319 3300013296 Ga0157374_10144342 Ga0157374_101443422 141
320 3300013296 Ga0157374_10296236 Ga0157374_102962363 141
321 3300013297 Ga0157378_10309939 Ga0157378_103099392 141
322 3300013306 Ga0163162_10030752 Ga0163162_100307522 141
323 3300013306 Ga0163162_10244322 Ga0163162_102443223 141
324 3300013307 Ga0157372_10098144 Ga0157372_100981442 141
325 3300013307 Ga0157372_10928148 Ga0157372_109281482 141
326 3300013307 Ga0157372_11116427 Ga0157372_111164272 141
327 3300013308 Ga0157375_10027157 Ga0157375_100271572 141
328 3300013308 Ga0157375_10173845 Ga0157375_101738451 141
329 3300014325 Ga0163163_10064204 Ga0163163_100642044 141
330 3300014325 Ga0163163_10102082 Ga0163163_101020822 141
331 3300014325 Ga0163163_10793068 Ga0163163_107930682 141
332 3300014745 Ga0157377_10070088 Ga0157377_100700882 141
333 3300014968 Ga0157379_10542401 Ga0157379_105424012 141
334 3300014969 Ga0157376_10015819 Ga0157376_100158195 141
335 3300014969 Ga0157376_10124095 Ga0157376_101240952 141
336 3300014969 Ga0157376_11006524 Ga0157376_110065241 141
337 3300014969 Ga0157376_12633715 Ga0157376_126337151 141
338 3300015262 Ga0182007_10175862 Ga0182007_101758621 141
339 3300021384 Ga0213876_10024534 Ga0213876_100245342 141
340 3300025253 Ga0209677_100579 Ga0209677_10057912 141
341 3300025254 Ga0209148_1000192 Ga0209148_100019211 141
342 3300025254 Ga0209148_1009946 Ga0209148_10099463 141
343 3300025261 Ga0209233_1006130 Ga0209233_10061305 141
344 3300025272 Ga0209455_1004451 Ga0209455_10044512 141
345 3300025272 Ga0209455_1014919 Ga0209455_10149193 141
346 3300025273 Ga0209673_1053613 Ga0209673_10536132 141
347 3300025295 Ga0209564_1012844 Ga0209564_10128444 141
348 3300025297 Ga0209758_1001172 Ga0209758_100117213 141
349 3300025297 Ga0209758_1032536 Ga0209758_10325363 141
350 3300025302 Ga0207426_1076733 Ga0207426_10767332 141
351 3300025302 Ga0207426_1103936 Ga0207426_11039361 141
352 3300025304 Ga0209257_1013866 Ga0209257_10138663 141
353 3300025321 Ga0207656_10203527 Ga0207656_102035272 141
354 3300025899 Ga0207642_10027589 Ga0207642_100275893 141
355 3300025900 Ga0207710_10041840 Ga0207710_100418402 141
356 3300025900 Ga0207710_10305251 Ga0207710_103052512 141
357 3300025901 Ga0207688_10007709 Ga0207688_100077094 141
358 3300025901 Ga0207688_10431483 Ga0207688_104314831 141
359 3300025904 Ga0207647_10257600 Ga0207647_102576002 141
360 3300025907 Ga0207645_10218291 Ga0207645_102182912 141
361 3300025908 Ga0207643_10073112 Ga0207643_100731122 141
362 3300025908 Ga0207643_10497794 Ga0207643_104977942 141
363 3300025909 Ga0207705_10177366 Ga0207705_101773663 141
364 3300025911 Ga0207654_10025820 Ga0207654_100258202 141
365 3300025911 Ga0207654_10069305 Ga0207654_100693051 141
366 3300025911 Ga0207654_10114710 Ga0207654_101147102 141
367 3300025912 Ga0207707_10008321 Ga0207707_100083216 141
368 3300025913 Ga0207695_10000059 Ga0207695_10000059288 141
369 3300025913 Ga0207695_10084064 Ga0207695_100840643 141
370 3300025913 Ga0207695_10427864 Ga0207695_104278641 141
371 3300025913 Ga0207695_10551712 Ga0207695_105517122 141
372 3300025914 Ga0207671_10034984 Ga0207671_100349842 141
373 3300025914 Ga0207671_10179144 Ga0207671_101791442 141
374 3300025914 Ga0207671_11522855 Ga0207671_115228551 141
375 3300025917 Ga0207660_10003996 Ga0207660_100039966 141
376 3300025917 Ga0207660_10430424 Ga0207660_104304241 141
377 3300025919 Ga0207657_10012885 Ga0207657_100128855 141
378 3300025920 Ga0207649_10282619 Ga0207649_102826192 141
379 3300025921 Ga0207652_10003241 Ga0207652_1000324111 141
380 3300025921 Ga0207652_10281524 Ga0207652_102815242 141
381 3300025924 Ga0207694_10035977 Ga0207694_100359773 141
382 3300025924 Ga0207694_10163417 Ga0207694_101634172 141
383 3300025924 Ga0207694_10384305 Ga0207694_103843052 141
384 3300025926 Ga0207659_10342455 Ga0207659_103424552 141
385 3300025927 Ga0207687_10035730 Ga0207687_100357303 141
386 3300025929 Ga0207664_10053927 Ga0207664_100539276 141
387 3300025932 Ga0207690_10036782 Ga0207690_100367822 141
388 3300025933 Ga0207706_10042645 Ga0207706_100426452 141
389 3300025933 Ga0207706_10112999 Ga0207706_101129992 141
390 3300025933 Ga0207706_10603871 Ga0207706_106038712 141
391 3300025934 Ga0207686_10045398 Ga0207686_100453982 141
392 3300025934 Ga0207686_10370462 Ga0207686_103704622 141
393 3300025937 Ga0207669_10171092 Ga0207669_101710923 141
394 3300025937 Ga0207669_11233494 Ga0207669_112334941 141
395 3300025938 Ga0207704_10198041 Ga0207704_101980412 141
396 3300025938 Ga0207704_10685755 Ga0207704_106857552 141
397 3300025939 Ga0207665_10308765 Ga0207665_103087652 141
398 3300025941 Ga0207711_10091655 Ga0207711_100916553 141
399 3300025941 Ga0207711_10142090 Ga0207711_101420903 141
400 3300025942 Ga0207689_10009165 Ga0207689_100091658 141
401 3300025942 Ga0207689_10313046 Ga0207689_103130462 141
402 3300025944 Ga0207661_10175019 Ga0207661_101750191 141
403 3300025945 Ga0207679_10408188 Ga0207679_104081882 141
404 3300025949 Ga0207667_10011866 Ga0207667_100118667 141
405 3300025949 Ga0207667_10144601 Ga0207667_101446013 141
406 3300025949 Ga0207667_10171674 Ga0207667_101716741 141
407 3300025949 Ga0207667_10792027 Ga0207667_107920271 141
408 3300025960 Ga0207651_10508027 Ga0207651_105080272 141
409 3300025961 Ga0207712_10939591 Ga0207712_109395911 141
410 3300025972 Ga0207668_10036850 Ga0207668_100368503 141
411 3300025986 Ga0207658_10292695 Ga0207658_102926952 141
412 3300026023 Ga0207677_10109801 Ga0207677_101098012 141
413 3300026035 Ga0207703_10168390 Ga0207703_101683902 141
414 3300026035 Ga0207703_10316877 Ga0207703_103168772 141
415 3300026041 Ga0207639_10083712 Ga0207639_100837124 141
416 3300026041 Ga0207639_10143478 Ga0207639_101434782 141
417 3300026041 Ga0207639_10550556 Ga0207639_105505562 141
418 3300026041 Ga0207639_10571866 Ga0207639_105718662 141
419 3300026067 Ga0207678_10011885 Ga0207678_100118854 141
420 3300026067 Ga0207678_10039272 Ga0207678_100392722 141
421 3300026067 Ga0207678_10044237 Ga0207678_100442372 141
422 3300026067 Ga0207678_10068989 Ga0207678_100689893 141
423 3300026067 Ga0207678_10138362 Ga0207678_101383622 141
424 3300026067 Ga0207678_10258805 Ga0207678_102588052 141
425 3300026067 Ga0207678_11079981 Ga0207678_110799812 141
426 3300026067 Ga0207678_11511901 Ga0207678_115119011 141
427 3300026078 Ga0207702_10000365 Ga0207702_1000036556 141
428 3300026078 Ga0207702_10033574 Ga0207702_100335743 141
429 3300026078 Ga0207702_11658530 Ga0207702_116585302 141
430 3300026088 Ga0207641_10226886 Ga0207641_102268862 141
431 3300026095 Ga0207676_10150700 Ga0207676_101507001 141
432 3300026095 Ga0207676_10371576 Ga0207676_103715762 141
433 3300026095 Ga0207676_11353793 Ga0207676_113537931 141
434 3300026116 Ga0207674_10070435 Ga0207674_100704353 141
435 3300026118 Ga0207675_100040838 Ga0207675_1000408382 141
436 3300026121 Ga0207683_10255906 Ga0207683_102559061 141
437 3300026121 Ga0207683_10274146 Ga0207683_102741462 141
438 3300026121 Ga0207683_10378320 Ga0207683_103783202 141
439 3300026142 Ga0207698_10169467 Ga0207698_101694673 141
440 3300026142 Ga0207698_10244293 Ga0207698_102442933 141
441 3300026142 Ga0207698_10329124 Ga0207698_103291242 141
442 3300026142 Ga0207698_10341562 Ga0207698_103415623 141
443 3300027357 Ga0209589_1000026 Ga0209589_100002688 141
444 3300027361 Ga0209489_100046 Ga0209489_10004688 141
445 3300027363 Ga0209700_100047 Ga0209700_10004788 141
446 3300027866 Ga0209813_10065678 Ga0209813_100656781 141
447 3300028379 Ga0268266_10001416 Ga0268266_1000141622 141
448 3300028379 Ga0268266_10283187 Ga0268266_102831873 141
449 3300028379 Ga0268266_10616803 Ga0268266_106168032 141
450 3300028380 Ga0268265_10026336 Ga0268265_100263362 141
451 3300028381 Ga0268264_11461186 Ga0268264_114611861 141
452 3300028573 Ga0265334_10009855 Ga0265334_100098553 141
453 3300031238 Ga0265332_10007132 Ga0265332_100071321 141
454 3300031239 Ga0265328_10021657 Ga0265328_100216573 141
455 3300031250 Ga0265331_10118034 Ga0265331_101180342 141
456 3300033442 Ga0315911_1000019 Ga0315911_100001913 141
457 3300034819 Ga0373958_0046881 Ga0373958_0046881_59_484 141
458 3300035084 Ga0373928_0017056 Ga0373928_0017056_905_1330 141
459 3300035088 Ga0373940_0074034 Ga0373940_0074034_546_971 141
460 3300035115 Ga0373941_0038668 Ga0373941_0038668_195_620 141
461 3300035121 Ga0373960_0040807 Ga0373960_0040807_365_790 141
462 3300035172 Ga0373955_0516419 Ga0373955_0516419_165_590 141
463 3300035207 Ga0373942_0041238 Ga0373942_0041238_773_1198 141
464 3300035691 Ga0373931_0007699 Ga0373931_0007699_1764_2189 141
465 3300035695 Ga0373927_0111194 Ga0373927_0111194_1339_1764 141
466 3300035724 Ga0373933_0616568 Ga0373933_0616568_260_685 141
467 3300035725 Ga0373947_0363270 Ga0373947_0363270_190_615 141
468 3300036401 Ga0373937_0095666 Ga0373937_0095666_1315_1740 141
469 3300036401 Ga0373937_0472755 Ga0373937_0472755_691_1116 141
470 3300037068 Ga0373925_1130120 Ga0373925_1130120_140_565 141
471 3300037312 Ga0395899_0073736 Ga0395899_0073736_1320_1745 141
472 3300037312 Ga0395899_0226227 Ga0395899_0226227_382_807 141
473 3300037418 Ga0395900_0000696 Ga0395900_0000696_26112_26558 141
474 3300037418 Ga0395900_0580630 Ga0395900_0580630_599_1024 141
475 3300037466 Ga0395898_0016802 Ga0395898_0016802_6967_7413 141
476 3300037466 Ga0395898_0689833 Ga0395898_0689833_60_485 141
477 3300037471 Ga0395905_0281150 Ga0395905_0281150_172_597 141
478 3300037471 Ga0395905_1806822 Ga0395905_1806822_35_481 141
479 3300037853 Ga0436364_0377201 Ga0436364_0377201_493_921 141
480 3300038443 Ga0395901_0014471 Ga0395901_0014471_6560_7006 141
481 3300038443 Ga0395901_0077395 Ga0395901_0077395_1956_2381 141
482 3300038443 Ga0395901_0518625 Ga0395901_0518625_347_781 141
483 3300039437 Ga0436365_0136133 Ga0436365_0136133_1392_1820 141
484 3300039437 Ga0436365_1288596 Ga0436365_1288596_247_675 141
485 3300041443 Ga0451789_0697845 Ga0451789_0697845_61_621 141
486 3300044693 Ga0466961_0887382 Ga0466961_0887382_43_471 141
487 3300044694 Ga0466963_0109721 Ga0466963_0109721_1420_1845 141
488 3300044706 Ga0466964_0125423 Ga0466964_0125423_399_824 141
489 3300044735 Ga0466968_0282512 Ga0466968_0282512_261_686 141
490 3300044842 Ga0466957_0115407 Ga0466957_0115407_1131_1592 141
491 3300044842 Ga0466957_0176265 Ga0466957_0176265_136_594 141
492 3300044842 Ga0466957_0413652 Ga0466957_0413652_167_610 141
493 3300045049 Ga0466959_0213911 Ga0466959_0213911_467_895 141
494 3300045976 Ga0466967_0255739 Ga0466967_0255739_454_879 141
495 3300045976 Ga0466967_0570664 Ga0466967_0570664_676_1104 141
496 3300046459 Ga0495629_0289111 Ga0495629_0289111_156_581 141
497 3300046462 Ga0495651_0463045 Ga0495651_0463045_222_653 141
498 3300046477 Ga0495664_0319308 Ga0495664_0319308_57_488 141
499 3300046501 Ga0495607_0100722 Ga0495607_0100722_644_1069 141
500 3300046507 Ga0495606_0031454 Ga0495606_0031454_1886_2311 141
501 3300046515 Ga0495620_0058090 Ga0495620_0058090_174_599 141
502 3300046516 Ga0495628_0089190 Ga0495628_0089190_1545_1970 141
503 3300046524 Ga0495648_0052628 Ga0495648_0052628_575_1000 141
504 3300046529 Ga0495652_0123930 Ga0495652_0123930_836_1261 141
505 3300046529 Ga0495652_0458828 Ga0495652_0458828_254_679 141
506 3300046535 Ga0495586_0251788 Ga0495586_0251788_227_652 141
507 3300046542 Ga0495597_0124966 Ga0495597_0124966_322_747 141
508 3300046557 Ga0495622_0006816 Ga0495622_0006816_2773_3198 141
509 3300046559 Ga0495667_0087436 Ga0495667_0087436_1198_1629 141
510 3300046616 Ga0495668_0134556 Ga0495668_0134556_521_946 141
511 3300046642 Ga0495634_0203795 Ga0495634_0203795_149_580 141
512 3300046660 Ga0495625_0669550 Ga0495625_0669550_160_585 141
513 3300046665 Ga0495661_0310283 Ga0495661_0310283_317_742 141
514 3300046674 Ga0495588_0005975 Ga0495588_0005975_4623_5048 141
515 3300046679 Ga0495623_0252227 Ga0495623_0252227_191_616 141
516 3300046689 Ga0495613_0937418 Ga0495613_0937418_116_547 141
517 3300046690 Ga0495624_0103721 Ga0495624_0103721_963_1388 141
518 3300046690 Ga0495624_0111161 Ga0495624_0111161_411_836 141
519 3300046692 Ga0495671_0478180 Ga0495671_0478180_97_522 141
520 3300046809 Ga0495600_0305428 Ga0495600_0305428_213_638 141
521 3300046809 Ga0495600_0681432 Ga0495600_0681432_125_556 141
522 3300047315 Ga0495581_0438448 Ga0495581_0438448_44_469 141
523 3300047317 Ga0495604_0246443 Ga0495604_0246443_737_1162 141
524 3300047317 Ga0495604_0312322 Ga0495604_0312322_318_749 141
525 3300047321 Ga0495676_0425032 Ga0495676_0425032_229_654 141
526 3300047322 Ga0495680_0089468 Ga0495680_0089468_168_599 141
527 3300047323 Ga0495683_0069612 Ga0495683_0069612_553_978 141
528 3300047469 Ga0495673_0116687 Ga0495673_0116687_74_499 141
529 3300047472 Ga0495686_0097863 Ga0495686_0097863_1335_1760 141
530 3300047472 Ga0495686_0488498 Ga0495686_0488498_194_619 141
531 3300048088 Ga0495602_0180667 Ga0495602_0180667_368_793 141
532 3300048088 Ga0495602_0320032 Ga0495602_0320032_107_532 141
533 3300048903 Ga0496100_0718102 Ga0496100_0718102_69_494 141
534 3300048904 Ga0496101_0019887 Ga0496101_0019887_567_992 141
535 3300048904 Ga0496101_0773193 Ga0496101_0773193_167_592 141
536 3300048906 Ga0496103_0017706 Ga0496103_0017706_675_1100 141
537 3300048906 Ga0496103_0487739 Ga0496103_0487739_188_613 141
538 3300048907 Ga0496104_0029834 Ga0496104_0029834_1815_2240 141
539 3300048907 Ga0496104_0085298 Ga0496104_0085298_1413_1838 141
540 3300048907 Ga0496104_0187543 Ga0496104_0187543_226_651 141
541 3300048907 Ga0496104_0433058 Ga0496104_0433058_481_906 141
542 3300048908 Ga0496105_0015797 Ga0496105_0015797_3567_3992 141
543 3300048908 Ga0496105_0051245 Ga0496105_0051245_2583_3008 141
544 3300048908 Ga0496105_0326930 Ga0496105_0326930_11_436 141
545 3300048909 Ga0496106_0013613 Ga0496106_0013613_2593_3018 141
546 3300048909 Ga0496106_0034705 Ga0496106_0034705_1539_1964 141
547 3300048909 Ga0496106_0115194 Ga0496106_0115194_1503_1928 141
548 3300048909 Ga0496106_0737333 Ga0496106_0737333_31_456 141
549 3300048909 Ga0496106_1089059 Ga0496106_1089059_72_497 141
550 3300048910 Ga0496107_0002239 Ga0496107_0002239_3516_3941 141
551 3300048910 Ga0496107_0750740 Ga0496107_0750740_62_487 141
552 3300048910 Ga0496107_0794907 Ga0496107_0794907_188_613 141
553 3300048910 Ga0496107_0828641 Ga0496107_0828641_40_465 141
554 3300048911 Ga0496108_0007089 Ga0496108_0007089_2220_2645 141
555 3300048911 Ga0496108_0042575 Ga0496108_0042575_2131_2556 141
556 3300048911 Ga0496108_0907341 Ga0496108_0907341_163_588 141
557 3300048912 Ga0496109_0171217 Ga0496109_0171217_80_505 141
558 3300048912 Ga0496109_0691728 Ga0496109_0691728_76_501 141
559 3300048913 Ga0496110_0019982 Ga0496110_0019982_3280_3705 141
560 3300048913 Ga0496110_0222460 Ga0496110_0222460_1077_1502 141
561 3300048913 Ga0496110_0259579 Ga0496110_0259579_385_810 141
562 3300048914 Ga0496111_0033999 Ga0496111_0033999_2902_3327 141
563 3300048915 Ga0496112_0000004 Ga0496112_0000004_479452_479877 141
564 3300048915 Ga0496112_0016426 Ga0496112_0016426_2857_3282 141
565 3300048915 Ga0496112_0041775 Ga0496112_0041775_3931_4356 141
566 3300048916 Ga0496113_0087349 Ga0496113_0087349_1789_2214 141
567 3300048916 Ga0496113_0478955 Ga0496113_0478955_209_634 141
568 3300048916 Ga0496113_0860176 Ga0496113_0860176_243_668 141
569 3300048916 Ga0496113_1470146 Ga0496113_1470146_23_448 141
570 3300048917 Ga0496114_0004928 Ga0496114_0004928_4502_4927 141
571 3300048917 Ga0496114_0044223 Ga0496114_0044223_1709_2134 141
572 3300048917 Ga0496114_0401489 Ga0496114_0401489_376_801 141
573 3300048917 Ga0496114_0452516 Ga0496114_0452516_197_622 141
574 3300048917 Ga0496114_1653304 Ga0496114_1653304_14_439 141
575 3300048918 Ga0496115_0005238 Ga0496115_0005238_3274_3699 141
576 3300048919 Ga0496116_0042244 Ga0496116_0042244_484_909 141
577 3300048919 Ga0496116_0266202 Ga0496116_0266202_389_817 141
578 3300048920 Ga0496117_0086414 Ga0496117_0086414_1462_1887 141
579 3300048920 Ga0496117_0169051 Ga0496117_0169051_498_926 141
580 3300048921 Ga0496118_0020050 Ga0496118_0020050_197_625 141
581 3300048923 Ga0496120_0211018 Ga0496120_0211018_221_646 141
582 3300048924 Ga0496121_0020703 Ga0496121_0020703_4880_5305 141
583 3300048924 Ga0496121_0038297 Ga0496121_0038297_1175_1600 141
584 3300048924 Ga0496121_0182096 Ga0496121_0182096_943_1368 141
585 3300048927 Ga0496124_0413352 Ga0496124_0413352_442_867 141
586 3300048928 Ga0496125_0313904 Ga0496125_0313904_160_585 141
587 3300048929 Ga0496126_0085030 Ga0496126_0085030_245_673 141
588 3300048929 Ga0496126_0555728 Ga0496126_0555728_202_627 141
589 3300049568 Ga0501031_0016891 Ga0501031_0016891_1247_1675 141
590 3300049568 Ga0501031_0250116 Ga0501031_0250116_279_704 141
591 3300049568 Ga0501031_0324483 Ga0501031_0324483_277_711 141
592 3300049569 Ga0501032_0004084 Ga0501032_0004084_7944_8372 141
593 3300049569 Ga0501032_0034855 Ga0501032_0034855_1058_1492 141
594 3300049569 Ga0501032_0050709 Ga0501032_0050709_1132_1569 141
595 3300049569 Ga0501032_0084741 Ga0501032_0084741_1181_1606 141
596 3300049569 Ga0501032_0549447 Ga0501032_0549447_13_447 141
597 3300049570 Ga0501033_0000060 Ga0501033_0000060_95084_95512 141
598 3300049570 Ga0501033_0025632 Ga0501033_0025632_2733_3158 141
599 3300049570 Ga0501033_0057020 Ga0501033_0057020_638_1072 141
600 3300049571 Ga0501034_0000117 Ga0501034_0000117_129749_130177 141
601 3300049571 Ga0501034_0027174 Ga0501034_0027174_1607_2032 141
602 3300049571 Ga0501034_0047099 Ga0501034_0047099_2730_3164 141
603 3300049571 Ga0501034_0508735 Ga0501034_0508735_399_833 141
604 3300049571 Ga0501034_0545178 Ga0501034_0545178_374_808 141
605 3300049572 Ga0501036_0000188 Ga0501036_0000188_17330_17758 141
606 3300049572 Ga0501036_0088879 Ga0501036_0088879_862_1299 141
607 3300049572 Ga0501036_0208515 Ga0501036_0208515_361_786 141
608 3300049572 Ga0501036_0210467 Ga0501036_0210467_542_970 141
609 3300049573 Ga0501037_0000402 Ga0501037_0000402_12690_13118 141
610 3300049573 Ga0501037_0064879 Ga0501037_0064879_987_1412 141
611 3300049573 Ga0501037_0094044 Ga0501037_0094044_1102_1539 141
612 3300049573 Ga0501037_0423010 Ga0501037_0423010_22_459 141
613 3300049574 Ga0501038_0000540 Ga0501038_0000540_9517_9945 141
614 3300049574 Ga0501038_0002993 Ga0501038_0002993_12712_13146 141
615 3300049574 Ga0501038_0032560 Ga0501038_0032560_3107_3541 141
616 3300049574 Ga0501038_0105152 Ga0501038_0105152_1424_1849 141
617 3300049574 Ga0501038_0216242 Ga0501038_0216242_189_617 141
618 3300049574 Ga0501038_0247101 Ga0501038_0247101_510_947 141
619 3300049575 Ga0501039_0000431 Ga0501039_0000431_18787_19215 141
620 3300049575 Ga0501039_0146322 Ga0501039_0146322_629_1066 141
621 3300049575 Ga0501039_0218513 Ga0501039_0218513_102_536 141
622 3300049575 Ga0501039_0417020 Ga0501039_0417020_130_564 141
623 3300049576 Ga0501040_0130248 Ga0501040_0130248_1292_1729 141
624 3300049576 Ga0501040_0192361 Ga0501040_0192361_465_893 141
625 3300049578 Ga0501042_0025253 Ga0501042_0025253_1008_1436 141
626 3300049578 Ga0501042_0053024 Ga0501042_0053024_1852_2289 141
627 3300049579 Ga0501043_0001032 Ga0501043_0001032_8681_9109 141
628 3300049579 Ga0501043_0018314 Ga0501043_0018314_206_631 141
629 3300049579 Ga0501043_0023614 Ga0501043_0023614_616_1053 141
630 3300049579 Ga0501043_0273384 Ga0501043_0273384_599_1033 141
631 3300049580 Ga0501046_0002670 Ga0501046_0002670_16117_16545 141
632 3300049580 Ga0501046_0019018 Ga0501046_0019018_524_961 141
633 3300049580 Ga0501046_0100506 Ga0501046_0100506_502_927 141
634 3300049580 Ga0501046_0443497 Ga0501046_0443497_444_878 141
635 3300049581 Ga0501047_0000246 Ga0501047_0000246_14616_15044 141
636 3300049581 Ga0501047_0022391 Ga0501047_0022391_1175_1600 141
637 3300049581 Ga0501047_0112133 Ga0501047_0112133_897_1331 141
638 3300049581 Ga0501047_0337561 Ga0501047_0337561_242_676 141
639 3300049582 Ga0501048_0000878 Ga0501048_0000878_4039_4467 141
640 3300049583 Ga0501067_0000320 Ga0501067_0000320_4196_4624 141
641 3300049584 Ga0501068_0004312 Ga0501068_0004312_4670_5098 141
642 3300049584 Ga0501068_0007826 Ga0501068_0007826_965_1402 141
643 3300049585 Ga0501069_0003261 Ga0501069_0003261_2789_3217 141
644 3300049586 Ga0501070_0000779 Ga0501070_0000779_25478_25906 141
645 3300049587 Ga0501071_0119341 Ga0501071_0119341_633_1061 141
646 3300049588 Ga0501072_0241226 Ga0501072_0241226_421_858 141
647 3300049588 Ga0501072_0263340 Ga0501072_0263340_247_675 141
648 3300049588 Ga0501072_0285821 Ga0501072_0285821_844_1272 141
649 3300049589 Ga0501073_0000093 Ga0501073_0000093_42621_43049 141
650 3300049590 Ga0501074_0000127 Ga0501074_0000127_23108_23536 141
651 3300049590 Ga0501074_0373520 Ga0501074_0373520_179_616 141
652 3300049592 Ga0501076_0177507 Ga0501076_0177507_1017_1445 141
653 3300049592 Ga0501076_1079084 Ga0501076_1079084_103_540 141
654 3300049593 Ga0501077_0202273 Ga0501077_0202273_648_1085 141
655 3300049741 Ga0501079_0013697 Ga0501079_0013697_3211_3639 141
656 3300049741 Ga0501079_0046768 Ga0501079_0046768_451_888 141
657 3300049742 Ga0501080_0001845 Ga0501080_0001845_13058_13486 141
658 3300049742 Ga0501080_0055276 Ga0501080_0055276_1175_1612 141
659 3300049742 Ga0501080_0179782 Ga0501080_0179782_138_572 141
660 3300049744 Ga0501083_0004463 Ga0501083_0004463_6719_7147 141
661 3300049744 Ga0501083_0018238 Ga0501083_0018238_536_973 141
662 3300049744 Ga0501083_0171879 Ga0501083_0171879_601_1026 141
663 3300049822 Ga0501035_0000798 Ga0501035_0000798_17332_17760 141
664 3300049822 Ga0501035_0009234 Ga0501035_0009234_4477_4902 141
665 3300049822 Ga0501035_0165102 Ga0501035_0165102_259_696 141
666 3300049822 Ga0501035_0245458 Ga0501035_0245458_444_872 141
667 3300049822 Ga0501035_0292094 Ga0501035_0292094_461_898 141
668 3300049823 Ga0501044_0001581 Ga0501044_0001581_16640_17068 141
669 3300049823 Ga0501044_0018220 Ga0501044_0018220_4346_4780 141
670 3300049823 Ga0501044_0039565 Ga0501044_0039565_3319_3744 141
671 3300049823 Ga0501044_0621452 Ga0501044_0621452_121_555 141
672 3300049824 Ga0501045_0012744 Ga0501045_0012744_5182_5610 141
673 3300049824 Ga0501045_0161957 Ga0501045_0161957_541_978 141
674 3300049824 Ga0501045_0737620 Ga0501045_0737620_118_555 141
675 3300050490 nmdc:mga03n38_51576_c1 nmdc:mga03n38_51576_c1_878_1303 141
676 3300050491 nmdc:mga00v17_96973_c1 nmdc:mga00v17_96973_c1_1099_1524 141
677 3300050492 nmdc:mga0yw44_16739_c1 nmdc:mga0yw44_16739_c1_3235_3669 141
678 3300050492 nmdc:mga0yw44_55099_c1 nmdc:mga0yw44_55099_c1_1416_1841 141
679 3300050493 nmdc:mga0k408_385866_c1 nmdc:mga0k408_385866_c1_302_727 141
680 3300050494 nmdc:mga06z11_220546_c1 nmdc:mga06z11_220546_c1_370_804 141
681 3300050494 nmdc:mga06z11_777982_c1 nmdc:mga06z11_777982_c1_46_564 141
682 3300050495 nmdc:mga04h51_12432_c1 nmdc:mga04h51_12432_c1_1302_1727 141
683 3300050495 nmdc:mga04h51_58265_c1 nmdc:mga04h51_58265_c1_81_515 141
684 3300050496 nmdc:mga07m45_462860_c1 nmdc:mga07m45_462860_c1_140_565 141
685 3300050496 nmdc:mga07m45_50497_c1 nmdc:mga07m45_50497_c1_507_932 141
686 3300050511 nmdc:mga08y16_830837_c1 nmdc:mga08y16_830837_c1_250_675 141
687 3300050512 nmdc:mga0n895_395533_c1 nmdc:mga0n895_395533_c1_923_1348 141
688 3300050512 nmdc:mga0n895_46805_c1 nmdc:mga0n895_46805_c1_1263_1694 141
689 3300050515 nmdc:mga0a205_1186142_c1 nmdc:mga0a205_1186142_c1_80_505 141
690 3300050516 nmdc:mga0sz30_118129_c1 nmdc:mga0sz30_118129_c1_57_482 141
691 3300050516 nmdc:mga0sz30_130189_c1 nmdc:mga0sz30_130189_c1_11_445 141
692 3300050516 nmdc:mga0sz30_178087_c1 nmdc:mga0sz30_178087_c1_278_703 141
693 3300053077 Ga0495601_0195030 Ga0495601_0195030_495_923 141
694 3300053077 Ga0495601_0304960 Ga0495601_0304960_437_862 141
695 3300053077 Ga0495601_0666579 Ga0495601_0666579_179_610 141
696 3300053085 Ga0495619_0045567 Ga0495619_0045567_761_1186 141
697 3300053101 Ga0500553_243484 Ga0500553_243484_98_523 141
698 3300053119 Ga0500595_017221 Ga0500595_017221_2035_2460 141
699 3300053177 Ga0500636_0217595 Ga0500636_0217595_193_618 141
700 3300054114 Ga0501084_0000963 Ga0501084_0000963_12593_13021 141
701 3300060353 Ga0501082_0002692 Ga0501082_0002692_7164_7592 141
702 3300060353 Ga0501082_0152367 Ga0501082_0152367_890_1327 141
703 3300061719 Ga0466962_0023059 Ga0466962_0023059_1351_1776 141
704 iso_pu_bacteria 2524023205 2524440043 141
705 iso_pu_bacteria 2885374607 2885379798 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

15

111

0.97

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

7

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8762 2 138
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8654 3 138
3lb5-assembly1.cif.gz_B crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8639 2 138
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.8554 2 138
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.853 3 138
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8853 22 107 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.879 22 106 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8742 7 104 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8654 3 138 3.30.428.10
3lb5A00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.853 3 138 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A0G1HG29-F1-model_v4 Histidine triad (HIT) protein 0.9392 5 89 GO:0003824
GO:0009117
AF-A0A7U6KQ42-F1-model_v4 HIT domain-containing protein 0.919 2 86 GO:0003824
GO:0009117
AF-A0A7C2WB85-F1-model_v4 HIT family protein 0.9044 6 114 GO:0003824
GO:0009117
AF-A5UQ73-F1-model_v4 Histidine triad (HIT) protein 0.8959 20 106 GO:0003824
AF-A0A0L0LFD5-F1-model_v4 Histidine triad (HIT) protein 0.8922 2 111 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map