F476387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 419 | 595 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100107022|Ga0068868_1001070222 |
| Length | 140 |
| Sequence | MTAYDDQNVFAKILRGEIPCFEVFRDDRSLAFLDIMPRSPGHTLVIPRAPARAILDIADDDLAAVARTGKRIAIAATAFDAEGIILQQFSEPASGQVVFHLHMHVMPVRAGIELLPAQTRKEDMAVLADHAKRMIAALGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 7 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 8 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 9 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 10 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 11 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 12 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 13 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 14 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 15 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 16 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 17 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 18 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 19 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 20 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 21 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 22 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 23 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 24 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 25 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 26 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 27 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 28 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 29 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 30 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 31 | 2906610324 | |||
| 32 | 2922368715 | |||
| 33 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 34 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 35 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 36 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 37 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 38 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 39 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 40 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 41 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 42 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 43 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 44 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 45 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 46 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 47 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 48 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 49 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 50 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 51 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 52 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 53 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 54 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 55 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 56 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 57 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 58 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 59 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 60 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 61 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 62 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 63 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 64 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 65 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 66 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 67 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 68 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 69 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 70 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 71 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 72 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 73 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 74 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 75 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 76 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 77 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 78 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 79 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 80 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 81 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 82 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 83 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 84 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 85 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 86 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 87 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 91 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 93 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 94 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 119 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 120 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 121 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 122 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 123 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 124 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 125 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 126 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 127 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 128 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 129 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 130 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 131 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 132 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 135 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 136 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 140 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 141 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 142 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 143 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 145 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 146 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 232 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 233 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 239 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 240 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 241 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 242 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 243 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 265 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 266 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 267 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 268 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 269 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 333 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 334 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 374 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 375 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 376 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 377 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 385 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 393 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 394 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 395 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 396 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 397 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 398 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 399 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 400 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 401 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 402 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 403 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 404 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 405 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 406 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 407 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 408 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 409 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 410 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 411 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 412 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 413 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 414 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 415 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 416 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 417 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 418 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 419 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.64 |
| Metatranscriptomes | 0 |
| Isolates | 15.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.23 |
| Nodule | 14.33 |
| Rhizoplane | 6.52 |
| Rhizosphere | 65.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10134666 | 3300001989 | Bacteria | 734 |
| 2 | JGI24737J22298_10193408 | 3300001990 | Bacteria | 600 |
| 3 | JGI25153J46596_10002528 | 3300003215 | Bacteria | 10487 |
| 4 | Ga0055539_1014096 | 3300003752 | Bacteria | 977 |
| 5 | Ga0070658_10755586 | 3300005327 | Bacteria | 844 |
| 6 | Ga0070658_11431232 | 3300005327 | Bacteria | 600 |
| 7 | Ga0070676_10235753 | 3300005328 | Bacteria | 1215 |
| 8 | Ga0070670_100051947 | 3300005331 | Bacteria | 3520 |
| 9 | Ga0068869_100012989 | 3300005334 | Bacteria | 5524 |
| 10 | Ga0070666_10066516 | 3300005335 | Bacteria | 2446 |
| 11 | Ga0070666_10379765 | 3300005335 | Bacteria | 1014 |
| 12 | Ga0070666_11103636 | 3300005335 | Bacteria | 590 |
| 13 | Ga0070680_100094004 | 3300005336 | Bacteria | 2484 |
| 14 | Ga0068868_100011843 | 3300005338 | Bacteria | 6359 |
| 15 | Ga0068868_100107022 | 3300005338 | Bacteria | 2269 |
| 16 | Ga0070660_100039424 | 3300005339 | Bacteria | 3590 |
| 17 | Ga0070691_10050896 | 3300005341 | Bacteria | 1977 |
| 18 | Ga0070691_10197565 | 3300005341 | Bacteria | 1055 |
| 19 | Ga0070661_100017917 | 3300005344 | Bacteria | 5029 |
| 20 | Ga0070661_100053218 | 3300005344 | Bacteria | 2962 |
| 21 | Ga0070661_100445373 | 3300005344 | Bacteria | 1030 |
| 22 | Ga0070661_100576466 | 3300005344 | Bacteria | 908 |
| 23 | Ga0070668_100122790 | 3300005347 | Bacteria | 2077 |
| 24 | Ga0070674_100032766 | 3300005356 | Bacteria | 3453 |
| 25 | Ga0070673_100054921 | 3300005364 | Bacteria | 3136 |
| 26 | Ga0070688_100243222 | 3300005365 | Bacteria | 1278 |
| 27 | Ga0070659_100056429 | 3300005366 | Bacteria | 3097 |
| 28 | Ga0070659_100376200 | 3300005366 | Bacteria | 1195 |
| 29 | Ga0070659_100580088 | 3300005366 | Bacteria | 962 |
| 30 | Ga0070714_100118538 | 3300005435 | Bacteria | 2352 |
| 31 | Ga0070713_101048932 | 3300005436 | Bacteria | 787 |
| 32 | Ga0070710_10697333 | 3300005437 | Bacteria | 716 |
| 33 | Ga0070663_100140964 | 3300005455 | Bacteria | 1840 |
| 34 | Ga0070663_100952155 | 3300005455 | Bacteria | 744 |
| 35 | Ga0070662_100014862 | 3300005457 | Bacteria | 5205 |
| 36 | Ga0070662_100282855 | 3300005457 | Bacteria | 1343 |
| 37 | Ga0070662_100411803 | 3300005457 | Bacteria | 1117 |
| 38 | Ga0070681_10126848 | 3300005458 | Bacteria | 2484 |
| 39 | Ga0070681_10330323 | 3300005458 | Bacteria | 1434 |
| 40 | Ga0070681_11023433 | 3300005458 | Bacteria | 746 |
| 41 | Ga0070679_100024411 | 3300005530 | Bacteria | 5924 |
| 42 | Ga0070679_100251290 | 3300005530 | Bacteria | 1724 |
| 43 | Ga0070679_100699814 | 3300005530 | Bacteria | 956 |
| 44 | Ga0070684_100013505 | 3300005535 | Bacteria | 6588 |
| 45 | Ga0068853_100002730 | 3300005539 | Bacteria | 13327 |
| 46 | Ga0068853_100043184 | 3300005539 | Bacteria | 3857 |
| 47 | Ga0068853_100059692 | 3300005539 | Bacteria | 3295 |
| 48 | Ga0068853_100647345 | 3300005539 | Bacteria | 1006 |
| 49 | Ga0068853_100674358 | 3300005539 | Bacteria | 985 |
| 50 | Ga0070672_102086874 | 3300005543 | Bacteria | 511 |
| 51 | Ga0070695_100271705 | 3300005545 | Bacteria | 1242 |
| 52 | Ga0070693_100164175 | 3300005547 | Bacteria | 1417 |
| 53 | Ga0070665_100027665 | 3300005548 | Bacteria | 5710 |
| 54 | Ga0070665_100135000 | 3300005548 | Bacteria | 2469 |
| 55 | Ga0068855_100021753 | 3300005563 | Bacteria | 7691 |
| 56 | Ga0068855_100037914 | 3300005563 | Bacteria | 5728 |
| 57 | Ga0068855_100041282 | 3300005563 | Bacteria | 5469 |
| 58 | Ga0068855_100182282 | 3300005563 | Bacteria | 2373 |
| 59 | Ga0068855_100201724 | 3300005563 | Bacteria | 2239 |
| 60 | Ga0070664_100145387 | 3300005564 | Bacteria | 2090 |
| 61 | Ga0068857_100112090 | 3300005577 | Bacteria | 2452 |
| 62 | Ga0068854_100159466 | 3300005578 | Bacteria | 1746 |
| 63 | Ga0068854_100177197 | 3300005578 | Bacteria | 1663 |
| 64 | Ga0068854_100264692 | 3300005578 | Bacteria | 1378 |
| 65 | Ga0068856_100052225 | 3300005614 | Bacteria | 4030 |
| 66 | Ga0068856_100217457 | 3300005614 | Bacteria | 1926 |
| 67 | Ga0068852_100033963 | 3300005616 | Bacteria | 4242 |
| 68 | Ga0068852_100483729 | 3300005616 | Bacteria | 1230 |
| 69 | Ga0068859_100469133 | 3300005617 | Bacteria | 1355 |
| 70 | Ga0068859_100690542 | 3300005617 | Bacteria | 1112 |
| 71 | Ga0068864_100026873 | 3300005618 | Bacteria | 4854 |
| 72 | Ga0068864_101084112 | 3300005618 | Bacteria | 797 |
| 73 | Ga0068861_100187617 | 3300005719 | Bacteria | 1726 |
| 74 | Ga0068851_10001428 | 3300005834 | Bacteria | 10455 |
| 75 | Ga0068851_10497480 | 3300005834 | Bacteria | 730 |
| 76 | Ga0068870_10912882 | 3300005840 | Bacteria | 621 |
| 77 | Ga0068863_100149767 | 3300005841 | Bacteria | 2232 |
| 78 | Ga0068863_100199453 | 3300005841 | Bacteria | 1925 |
| 79 | Ga0068858_100030769 | 3300005842 | Bacteria | 4985 |
| 80 | Ga0068862_100021523 | 3300005844 | Bacteria | 5389 |
| 81 | Ga0075365_10009930 | 3300006038 | Bacteria | 5512 |
| 82 | Ga0075365_10013973 | 3300006038 | Bacteria | 4820 |
| 83 | Ga0075365_10038705 | 3300006038 | Bacteria | 3102 |
| 84 | Ga0075365_10824199 | 3300006038 | Bacteria | 655 |
| 85 | Ga0075368_10006293 | 3300006042 | Bacteria | 4141 |
| 86 | Ga0075368_10026442 | 3300006042 | Bacteria | 2232 |
| 87 | Ga0075363_100012247 | 3300006048 | Bacteria | 4129 |
| 88 | Ga0075363_100037813 | 3300006048 | Bacteria | 2535 |
| 89 | Ga0075363_100154187 | 3300006048 | Bacteria | 1298 |
| 90 | Ga0075364_10037875 | 3300006051 | Bacteria | 3124 |
| 91 | Ga0075364_10057502 | 3300006051 | Bacteria | 2548 |
| 92 | Ga0070716_100368761 | 3300006173 | Bacteria | 1022 |
| 93 | Ga0075362_10287424 | 3300006177 | Bacteria | 814 |
| 94 | Ga0075367_10166607 | 3300006178 | Bacteria | 1371 |
| 95 | Ga0075367_10869061 | 3300006178 | Bacteria | 575 |
| 96 | Ga0075369_10031777 | 3300006186 | Bacteria | 2230 |
| 97 | Ga0075369_10283598 | 3300006186 | Bacteria | 772 |
| 98 | Ga0075369_10424529 | 3300006186 | Bacteria | 628 |
| 99 | Ga0075366_10099054 | 3300006195 | Bacteria | 1749 |
| 100 | Ga0075366_10369420 | 3300006195 | Bacteria | 881 |
| 101 | Ga0097621_100110196 | 3300006237 | Bacteria | 2325 |
| 102 | Ga0097621_100965932 | 3300006237 | Bacteria | 796 |
| 103 | Ga0075370_10026313 | 3300006353 | Bacteria | 3222 |
| 104 | Ga0075370_10168027 | 3300006353 | Bacteria | 1289 |
| 105 | Ga0075370_10278837 | 3300006353 | Bacteria | 993 |
| 106 | Ga0068871_100264225 | 3300006358 | Bacteria | 1502 |
| 107 | Ga0068871_100378784 | 3300006358 | Bacteria | 1257 |
| 108 | Ga0075434_100061594 | 3300006871 | Bacteria | 3734 |
| 109 | Ga0075434_101523830 | 3300006871 | Bacteria | 678 |
| 110 | Ga0068865_100263781 | 3300006881 | Bacteria | 1365 |
| 111 | Ga0068865_101027694 | 3300006881 | Bacteria | 723 |
| 112 | Ga0097620_100469108 | 3300006931 | Bacteria | 1355 |
| 113 | Ga0097620_100690468 | 3300006931 | Bacteria | 1112 |
| 114 | Ga0099824_1002409 | 3300006942 | Bacteria | 27310 |
| 115 | Ga0099822_1000008 | 3300006943 | Bacteria | 76583 |
| 116 | Ga0105251_10170876 | 3300009011 | Bacteria | 980 |
| 117 | Ga0105240_10012556 | 3300009093 | Bacteria | 11685 |
| 118 | Ga0105240_10054293 | 3300009093 | Bacteria | 5021 |
| 119 | Ga0105240_10056581 | 3300009093 | Bacteria | 4907 |
| 120 | Ga0105240_10135680 | 3300009093 | Bacteria | 2947 |
| 121 | Ga0105245_10017461 | 3300009098 | Bacteria | 6259 |
| 122 | Ga0105245_10463784 | 3300009098 | Bacteria | 1277 |
| 123 | Ga0105245_10736449 | 3300009098 | Bacteria | 1021 |
| 124 | Ga0105245_12925197 | 3300009098 | Bacteria | 529 |
| 125 | Ga0105247_10031014 | 3300009101 | Bacteria | 3242 |
| 126 | Ga0105243_10102511 | 3300009148 | Bacteria | 2378 |
| 127 | Ga0105243_10870550 | 3300009148 | Bacteria | 894 |
| 128 | Ga0105241_10011237 | 3300009174 | Bacteria | 6564 |
| 129 | Ga0105241_10144453 | 3300009174 | Bacteria | 1941 |
| 130 | Ga0105241_10154460 | 3300009174 | Bacteria | 1881 |
| 131 | Ga0105241_11160333 | 3300009174 | Bacteria | 730 |
| 132 | Ga0105242_10145590 | 3300009176 | Bacteria | 2061 |
| 133 | Ga0105248_10071498 | 3300009177 | Bacteria | 3898 |
| 134 | Ga0105248_10151393 | 3300009177 | Bacteria | 2617 |
| 135 | Ga0105248_10564970 | 3300009177 | Bacteria | 1283 |
| 136 | Ga0105248_10881095 | 3300009177 | Bacteria | 1011 |
| 137 | Ga0105248_11334522 | 3300009177 | Bacteria | 811 |
| 138 | Ga0105237_10014080 | 3300009545 | Bacteria | 8367 |
| 139 | Ga0105237_10051620 | 3300009545 | Bacteria | 4130 |
| 140 | Ga0105237_10103471 | 3300009545 | Bacteria | 2839 |
| 141 | Ga0105237_10493780 | 3300009545 | Bacteria | 1230 |
| 142 | Ga0105237_10529019 | 3300009545 | Bacteria | 1186 |
| 143 | Ga0105238_10002380 | 3300009551 | Bacteria | 18868 |
| 144 | Ga0105238_10532908 | 3300009551 | Bacteria | 1178 |
| 145 | Ga0105238_10544596 | 3300009551 | Bacteria | 1164 |
| 146 | Ga0105249_10745342 | 3300009553 | Bacteria | 1041 |
| 147 | Ga0105249_10901006 | 3300009553 | Bacteria | 951 |
| 148 | Ga0105239_10016742 | 3300010375 | Bacteria | 8104 |
| 149 | Ga0105239_10044082 | 3300010375 | Bacteria | 4890 |
| 150 | Ga0105239_10066019 | 3300010375 | Bacteria | 3975 |
| 151 | Ga0105239_10078176 | 3300010375 | Bacteria | 3641 |
| 152 | Ga0105239_10112511 | 3300010375 | Bacteria | 3019 |
| 153 | Ga0105239_10203110 | 3300010375 | Bacteria | 2220 |
| 154 | Ga0105239_10883434 | 3300010375 | Bacteria | 1026 |
| 155 | Ga0105246_10009964 | 3300011119 | Bacteria | 5863 |
| 156 | Ga0105246_10966735 | 3300011119 | Bacteria | 769 |
| 157 | Ga0157373_10173499 | 3300013100 | Bacteria | 1517 |
| 158 | Ga0157371_10027645 | 3300013102 | Bacteria | 4112 |
| 159 | Ga0157371_10686540 | 3300013102 | Bacteria | 766 |
| 160 | Ga0157370_10571461 | 3300013104 | Bacteria | 1036 |
| 161 | Ga0157369_10003624 | 3300013105 | Bacteria | 18332 |
| 162 | Ga0157369_10665566 | 3300013105 | Bacteria | 1073 |
| 163 | Ga0157369_10818131 | 3300013105 | Bacteria | 957 |
| 164 | Ga0157374_10144342 | 3300013296 | Bacteria | 2312 |
| 165 | Ga0157374_10296236 | 3300013296 | Bacteria | 1600 |
| 166 | Ga0157378_10309939 | 3300013297 | Bacteria | 1530 |
| 167 | Ga0163162_10030752 | 3300013306 | Bacteria | 5321 |
| 168 | Ga0163162_10244322 | 3300013306 | Bacteria | 1926 |
| 169 | Ga0157372_10098144 | 3300013307 | Bacteria | 3342 |
| 170 | Ga0157372_10928148 | 3300013307 | Bacteria | 1009 |
| 171 | Ga0157372_11116427 | 3300013307 | Bacteria | 912 |
| 172 | Ga0157375_10027157 | 3300013308 | Bacteria | 5347 |
| 173 | Ga0157375_10173845 | 3300013308 | Bacteria | 2302 |
| 174 | Ga0163163_10064204 | 3300014325 | Bacteria | 3643 |
| 175 | Ga0163163_10102082 | 3300014325 | Bacteria | 2891 |
| 176 | Ga0163163_10793068 | 3300014325 | Bacteria | 1011 |
| 177 | Ga0157377_10070088 | 3300014745 | Bacteria | 2025 |
| 178 | Ga0157379_10542401 | 3300014968 | Bacteria | 1081 |
| 179 | Ga0157376_10015819 | 3300014969 | Bacteria | 5710 |
| 180 | Ga0157376_10124095 | 3300014969 | Bacteria | 2293 |
| 181 | Ga0157376_11006524 | 3300014969 | Bacteria | 856 |
| 182 | Ga0157376_12633715 | 3300014969 | Bacteria | 543 |
| 183 | Ga0182007_10175862 | 3300015262 | Bacteria | 738 |
| 184 | Ga0213876_10024534 | 3300021384 | Bacteria | 3184 |
| 185 | Ga0209677_100579 | 3300025253 | Bacteria | 20068 |
| 186 | Ga0209148_1000192 | 3300025254 | Bacteria | 115724 |
| 187 | Ga0209148_1009946 | 3300025254 | Bacteria | 1825 |
| 188 | Ga0209233_1006130 | 3300025261 | Bacteria | 3909 |
| 189 | Ga0209455_1004451 | 3300025272 | Bacteria | 4579 |
| 190 | Ga0209455_1014919 | 3300025272 | Bacteria | 1733 |
| 191 | Ga0209673_1053613 | 3300025273 | Bacteria | 1050 |
| 192 | Ga0209564_1012844 | 3300025295 | Bacteria | 3612 |
| 193 | Ga0209758_1001172 | 3300025297 | Bacteria | 33281 |
| 194 | Ga0209758_1032536 | 3300025297 | Bacteria | 2114 |
| 195 | Ga0207426_1076733 | 3300025302 | Bacteria | 917 |
| 196 | Ga0207426_1103936 | 3300025302 | Bacteria | 728 |
| 197 | Ga0209257_1013866 | 3300025304 | Bacteria | 3529 |
| 198 | Ga0207656_10203527 | 3300025321 | Bacteria | 957 |
| 199 | Ga0207642_10027589 | 3300025899 | Bacteria | 2326 |
| 200 | Ga0207710_10041840 | 3300025900 | Bacteria | 2033 |
| 201 | Ga0207710_10305251 | 3300025900 | Bacteria | 805 |
| 202 | Ga0207688_10007709 | 3300025901 | Bacteria | 5864 |
| 203 | Ga0207688_10431483 | 3300025901 | Bacteria | 820 |
| 204 | Ga0207647_10257600 | 3300025904 | Bacteria | 1000 |
| 205 | Ga0207645_10218291 | 3300025907 | Bacteria | 1256 |
| 206 | Ga0207643_10073112 | 3300025908 | Bacteria | 1976 |
| 207 | Ga0207643_10497794 | 3300025908 | Bacteria | 779 |
| 208 | Ga0207705_10177366 | 3300025909 | Bacteria | 1607 |
| 209 | Ga0207654_10025820 | 3300025911 | Bacteria | 3175 |
| 210 | Ga0207654_10069305 | 3300025911 | Bacteria | 2090 |
| 211 | Ga0207654_10114710 | 3300025911 | Bacteria | 1682 |
| 212 | Ga0207707_10008321 | 3300025912 | Bacteria | 9000 |
| 213 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 214 | Ga0207695_10084064 | 3300025913 | Bacteria | 3214 |
| 215 | Ga0207695_10427864 | 3300025913 | Bacteria | 1208 |
| 216 | Ga0207695_10551712 | 3300025913 | Bacteria | 1034 |
| 217 | Ga0207671_10034984 | 3300025914 | Bacteria | 3730 |
| 218 | Ga0207671_10179144 | 3300025914 | Bacteria | 1649 |
| 219 | Ga0207671_11522855 | 3300025914 | Bacteria | 516 |
| 220 | Ga0207693_10542838 | 3300025915 | Bacteria | 907 |
| 221 | Ga0207660_10003996 | 3300025917 | Bacteria | 9612 |
| 222 | Ga0207660_10430424 | 3300025917 | Bacteria | 1065 |
| 223 | Ga0207657_10012885 | 3300025919 | Bacteria | 8222 |
| 224 | Ga0207649_10282619 | 3300025920 | Bacteria | 1207 |
| 225 | Ga0207652_10003241 | 3300025921 | Bacteria | 13496 |
| 226 | Ga0207652_10281524 | 3300025921 | Bacteria | 1500 |
| 227 | Ga0207694_10035977 | 3300025924 | Bacteria | 3799 |
| 228 | Ga0207694_10163417 | 3300025924 | Bacteria | 1799 |
| 229 | Ga0207694_10384305 | 3300025924 | Bacteria | 1165 |
| 230 | Ga0207659_10342455 | 3300025926 | Bacteria | 1238 |
| 231 | Ga0207687_10035730 | 3300025927 | Bacteria | 3382 |
| 232 | Ga0207687_10307215 | 3300025927 | Bacteria | 1279 |
| 233 | Ga0207664_10053927 | 3300025929 | Bacteria | 3185 |
| 234 | Ga0207690_10036782 | 3300025932 | Bacteria | 3173 |
| 235 | Ga0207706_10042645 | 3300025933 | Bacteria | 4021 |
| 236 | Ga0207706_10112999 | 3300025933 | Bacteria | 2389 |
| 237 | Ga0207706_10603871 | 3300025933 | Bacteria | 942 |
| 238 | Ga0207686_10045398 | 3300025934 | Bacteria | 2703 |
| 239 | Ga0207686_10370462 | 3300025934 | Bacteria | 1083 |
| 240 | Ga0207669_10171092 | 3300025937 | Bacteria | 1546 |
| 241 | Ga0207669_11233494 | 3300025937 | Bacteria | 634 |
| 242 | Ga0207704_10198041 | 3300025938 | Bacteria | 1467 |
| 243 | Ga0207704_10685755 | 3300025938 | Bacteria | 847 |
| 244 | Ga0207665_10308765 | 3300025939 | Bacteria | 1184 |
| 245 | Ga0207711_10091655 | 3300025941 | Bacteria | 2673 |
| 246 | Ga0207711_10142090 | 3300025941 | Bacteria | 2160 |
| 247 | Ga0207711_10760273 | 3300025941 | Bacteria | 903 |
| 248 | Ga0207689_10009165 | 3300025942 | Bacteria | 8561 |
| 249 | Ga0207689_10313046 | 3300025942 | Bacteria | 1302 |
| 250 | Ga0207661_10175019 | 3300025944 | Bacteria | 1870 |
| 251 | Ga0207679_10408188 | 3300025945 | Bacteria | 1196 |
| 252 | Ga0207667_10011866 | 3300025949 | Bacteria | 10092 |
| 253 | Ga0207667_10144601 | 3300025949 | Bacteria | 2448 |
| 254 | Ga0207667_10171674 | 3300025949 | Bacteria | 2228 |
| 255 | Ga0207667_10792027 | 3300025949 | Bacteria | 945 |
| 256 | Ga0207651_10508027 | 3300025960 | Bacteria | 1043 |
| 257 | Ga0207712_10939591 | 3300025961 | Bacteria | 766 |
| 258 | Ga0207668_10036850 | 3300025972 | Bacteria | 3268 |
| 259 | Ga0207640_10216224 | 3300025981 | Bacteria | 1464 |
| 260 | Ga0207658_10292695 | 3300025986 | Bacteria | 1400 |
| 261 | Ga0207677_10109801 | 3300026023 | Bacteria | 2051 |
| 262 | Ga0207703_10168390 | 3300026035 | Bacteria | 1925 |
| 263 | Ga0207703_10316877 | 3300026035 | Bacteria | 1427 |
| 264 | Ga0207639_10083712 | 3300026041 | Bacteria | 2532 |
| 265 | Ga0207639_10143478 | 3300026041 | Bacteria | 1992 |
| 266 | Ga0207639_10550556 | 3300026041 | Bacteria | 1059 |
| 267 | Ga0207639_10571866 | 3300026041 | Bacteria | 1039 |
| 268 | Ga0207678_10011885 | 3300026067 | Bacteria | 7645 |
| 269 | Ga0207678_10039272 | 3300026067 | Bacteria | 4108 |
| 270 | Ga0207678_10044237 | 3300026067 | Bacteria | 3852 |
| 271 | Ga0207678_10068989 | 3300026067 | Bacteria | 3032 |
| 272 | Ga0207678_10138362 | 3300026067 | Bacteria | 2078 |
| 273 | Ga0207678_10258805 | 3300026067 | Bacteria | 1491 |
| 274 | Ga0207678_11079981 | 3300026067 | Bacteria | 711 |
| 275 | Ga0207678_11511901 | 3300026067 | Bacteria | 592 |
| 276 | Ga0207702_10000365 | 3300026078 | Bacteria | 51814 |
| 277 | Ga0207702_10033574 | 3300026078 | Bacteria | 4287 |
| 278 | Ga0207702_10700567 | 3300026078 | Bacteria | 998 |
| 279 | Ga0207702_11658530 | 3300026078 | Bacteria | 632 |
| 280 | Ga0207641_10226886 | 3300026088 | Bacteria | 1734 |
| 281 | Ga0207676_10150700 | 3300026095 | Bacteria | 2002 |
| 282 | Ga0207676_10371576 | 3300026095 | Bacteria | 1328 |
| 283 | Ga0207676_11353793 | 3300026095 | Bacteria | 707 |
| 284 | Ga0207674_10070435 | 3300026116 | Bacteria | 3516 |
| 285 | Ga0207675_100040838 | 3300026118 | Bacteria | 4333 |
| 286 | Ga0207683_10255906 | 3300026121 | Bacteria | 1598 |
| 287 | Ga0207683_10274146 | 3300026121 | Bacteria | 1541 |
| 288 | Ga0207683_10378320 | 3300026121 | Bacteria | 1301 |
| 289 | Ga0207698_10169467 | 3300026142 | Bacteria | 1921 |
| 290 | Ga0207698_10244293 | 3300026142 | Bacteria | 1638 |
| 291 | Ga0207698_10329124 | 3300026142 | Bacteria | 1434 |
| 292 | Ga0207698_10341562 | 3300026142 | Bacteria | 1410 |
| 293 | Ga0209589_1000026 | 3300027357 | Bacteria | 158154 |
| 294 | Ga0209489_100046 | 3300027361 | Bacteria | 158154 |
| 295 | Ga0209700_100047 | 3300027363 | Bacteria | 158154 |
| 296 | Ga0209813_10065678 | 3300027866 | Bacteria | 1169 |
| 297 | Ga0268266_10001416 | 3300028379 | Bacteria | 28634 |
| 298 | Ga0268266_10283187 | 3300028379 | Bacteria | 1542 |
| 299 | Ga0268266_10616803 | 3300028379 | Bacteria | 1042 |
| 300 | Ga0268265_10026336 | 3300028380 | Bacteria | 4137 |
| 301 | Ga0268264_11461186 | 3300028381 | Bacteria | 694 |
| 302 | Ga0265334_10009855 | 3300028573 | Bacteria | 4038 |
| 303 | Ga0265332_10007132 | 3300031238 | Bacteria | 5062 |
| 304 | Ga0265328_10021657 | 3300031239 | Bacteria | 2451 |
| 305 | Ga0265331_10118034 | 3300031250 | Bacteria | 1214 |
| 306 | Ga0315911_1000019 | 3300033442 | Bacteria | 146597 |
| 307 | Ga0373958_0046881 | 3300034819 | Bacteria | 902 |
| 308 | Ga0373928_0017056 | 3300035084 | Bacteria | 1492 |
| 309 | Ga0373940_0074034 | 3300035088 | Bacteria | 996 |
| 310 | Ga0373941_0038668 | 3300035115 | Bacteria | 1462 |
| 311 | Ga0373960_0040807 | 3300035121 | Bacteria | 1341 |
| 312 | Ga0373955_0516419 | 3300035172 | Bacteria | 730 |
| 313 | Ga0373942_0041238 | 3300035207 | Bacteria | 1261 |
| 314 | Ga0373931_0007699 | 3300035691 | Bacteria | 5084 |
| 315 | Ga0373927_0111194 | 3300035695 | Bacteria | 1785 |
| 316 | Ga0373933_0616568 | 3300035724 | Bacteria | 713 |
| 317 | Ga0373947_0363270 | 3300035725 | Bacteria | 973 |
| 318 | Ga0373937_0095666 | 3300036401 | Bacteria | 2754 |
| 319 | Ga0373937_0472755 | 3300036401 | Bacteria | 1191 |
| 320 | Ga0373925_1130120 | 3300037068 | Bacteria | 644 |
| 321 | Ga0395899_0073736 | 3300037312 | Bacteria | 2495 |
| 322 | Ga0395899_0226227 | 3300037312 | Bacteria | 1294 |
| 323 | Ga0395900_0000696 | 3300037418 | Bacteria | 44867 |
| 324 | Ga0395900_0580630 | 3300037418 | Bacteria | 1063 |
| 325 | Ga0395898_0016802 | 3300037466 | Bacteria | 7477 |
| 326 | Ga0395898_0689833 | 3300037466 | Bacteria | 963 |
| 327 | Ga0395905_0281150 | 3300037471 | Bacteria | 1550 |
| 328 | Ga0395905_1806822 | 3300037471 | Bacteria | 517 |
| 329 | Ga0436364_0377201 | 3300037853 | Bacteria | 2232 |
| 330 | Ga0395901_0014471 | 3300038443 | Bacteria | 8026 |
| 331 | Ga0395901_0077395 | 3300038443 | Bacteria | 3471 |
| 332 | Ga0395901_0518625 | 3300038443 | Bacteria | 1211 |
| 333 | Ga0436365_0136133 | 3300039437 | Bacteria | 3027 |
| 334 | Ga0436365_1288596 | 3300039437 | Bacteria | 766 |
| 335 | Ga0451789_0697845 | 3300041443 | Bacteria | 665 |
| 336 | Ga0451833_0312650 | 3300041491 | Bacteria | 826 |
| 337 | Ga0451853_3498500 | 3300041512 | Bacteria | 1000 |
| 338 | Ga0466961_0887382 | 3300044693 | Bacteria | 531 |
| 339 | Ga0466963_0109721 | 3300044694 | Bacteria | 1893 |
| 340 | Ga0466964_0125423 | 3300044706 | Bacteria | 1163 |
| 341 | Ga0466968_0282512 | 3300044735 | Bacteria | 795 |
| 342 | Ga0466957_0115407 | 3300044842 | Bacteria | 1707 |
| 343 | Ga0466957_0176265 | 3300044842 | Bacteria | 1394 |
| 344 | Ga0466957_0413652 | 3300044842 | Bacteria | 924 |
| 345 | Ga0466959_0213911 | 3300045049 | Bacteria | 1339 |
| 346 | Ga0466967_0255739 | 3300045976 | Bacteria | 1674 |
| 347 | Ga0466967_0570664 | 3300045976 | Bacteria | 1115 |
| 348 | Ga0495592_0129660 | 3300046454 | Bacteria | 1765 |
| 349 | Ga0495629_0289111 | 3300046459 | Bacteria | 1124 |
| 350 | Ga0495651_0120070 | 3300046462 | Bacteria | 1932 |
| 351 | Ga0495651_0463045 | 3300046462 | Bacteria | 817 |
| 352 | Ga0495662_0244024 | 3300046476 | Bacteria | 885 |
| 353 | Ga0495664_0046484 | 3300046477 | Bacteria | 2575 |
| 354 | Ga0495664_0319308 | 3300046477 | Bacteria | 937 |
| 355 | Ga0495607_0100722 | 3300046501 | Bacteria | 1548 |
| 356 | Ga0495606_0031454 | 3300046507 | Bacteria | 3690 |
| 357 | Ga0495608_0032064 | 3300046511 | Bacteria | 3552 |
| 358 | Ga0495620_0058090 | 3300046515 | Bacteria | 1621 |
| 359 | Ga0495628_0022190 | 3300046516 | Bacteria | 5217 |
| 360 | Ga0495628_0089190 | 3300046516 | Bacteria | 2389 |
| 361 | Ga0495630_0261524 | 3300046517 | Bacteria | 1322 |
| 362 | Ga0495648_0052628 | 3300046524 | Bacteria | 2472 |
| 363 | Ga0495652_0123930 | 3300046529 | Bacteria | 2056 |
| 364 | Ga0495652_0203365 | 3300046529 | Bacteria | 1501 |
| 365 | Ga0495652_0458828 | 3300046529 | Bacteria | 891 |
| 366 | Ga0495640_0038299 | 3300046533 | Bacteria | 3373 |
| 367 | Ga0495586_0251788 | 3300046535 | Bacteria | 1008 |
| 368 | Ga0495587_0026203 | 3300046536 | Bacteria | 3557 |
| 369 | Ga0495597_0124966 | 3300046542 | Bacteria | 1070 |
| 370 | Ga0495645_0026529 | 3300046543 | Bacteria | 4206 |
| 371 | Ga0495622_0006816 | 3300046557 | Bacteria | 5302 |
| 372 | Ga0495667_0078724 | 3300046559 | Bacteria | 2143 |
| 373 | Ga0495667_0087436 | 3300046559 | Bacteria | 2021 |
| 374 | Ga0495668_0134556 | 3300046616 | Bacteria | 1353 |
| 375 | Ga0495634_0203795 | 3300046642 | Bacteria | 1228 |
| 376 | Ga0495625_0669550 | 3300046660 | Bacteria | 616 |
| 377 | Ga0495661_0310283 | 3300046665 | Bacteria | 787 |
| 378 | Ga0495588_0005975 | 3300046674 | Bacteria | 5458 |
| 379 | Ga0495657_0030658 | 3300046675 | Bacteria | 3764 |
| 380 | Ga0495599_0165805 | 3300046678 | Bacteria | 1364 |
| 381 | Ga0495623_0006002 | 3300046679 | Bacteria | 7902 |
| 382 | Ga0495623_0252227 | 3300046679 | Bacteria | 992 |
| 383 | Ga0495646_0096828 | 3300046680 | Bacteria | 1696 |
| 384 | Ga0495613_0041099 | 3300046689 | Bacteria | 3425 |
| 385 | Ga0495613_0937418 | 3300046689 | Bacteria | 559 |
| 386 | Ga0495624_0103721 | 3300046690 | Bacteria | 1750 |
| 387 | Ga0495624_0111161 | 3300046690 | Bacteria | 1685 |
| 388 | Ga0495624_0139212 | 3300046690 | Bacteria | 1487 |
| 389 | Ga0495671_0478180 | 3300046692 | Bacteria | 595 |
| 390 | Ga0495600_0021601 | 3300046809 | Bacteria | 4124 |
| 391 | Ga0495600_0305428 | 3300046809 | Bacteria | 1003 |
| 392 | Ga0495600_0681432 | 3300046809 | Bacteria | 619 |
| 393 | Ga0495581_0438448 | 3300047315 | Bacteria | 761 |
| 394 | Ga0495604_0001041 | 3300047317 | Bacteria | 23066 |
| 395 | Ga0495604_0246443 | 3300047317 | Bacteria | 1220 |
| 396 | Ga0495604_0312322 | 3300047317 | Bacteria | 1053 |
| 397 | Ga0495674_0099449 | 3300047319 | Bacteria | 2476 |
| 398 | Ga0495676_0425032 | 3300047321 | Bacteria | 879 |
| 399 | Ga0495680_0007821 | 3300047322 | Bacteria | 9763 |
| 400 | Ga0495680_0089468 | 3300047322 | Bacteria | 2311 |
| 401 | Ga0495683_0069612 | 3300047323 | Bacteria | 1729 |
| 402 | Ga0495675_0010362 | 3300047444 | Bacteria | 5826 |
| 403 | Ga0495673_0116687 | 3300047469 | Bacteria | 1061 |
| 404 | Ga0495684_0361823 | 3300047471 | Bacteria | 1027 |
| 405 | Ga0495686_0097863 | 3300047472 | Bacteria | 1773 |
| 406 | Ga0495686_0488498 | 3300047472 | Bacteria | 650 |
| 407 | Ga0495602_0004605 | 3300048088 | Bacteria | 14387 |
| 408 | Ga0495602_0180667 | 3300048088 | Bacteria | 1628 |
| 409 | Ga0495602_0320032 | 3300048088 | Bacteria | 1129 |
| 410 | Ga0496100_0718102 | 3300048903 | Bacteria | 780 |
| 411 | Ga0496101_0019887 | 3300048904 | Bacteria | 4591 |
| 412 | Ga0496101_0773193 | 3300048904 | Bacteria | 758 |
| 413 | Ga0496103_0017706 | 3300048906 | Bacteria | 4266 |
| 414 | Ga0496103_0487739 | 3300048906 | Bacteria | 789 |
| 415 | Ga0496104_0029834 | 3300048907 | Bacteria | 5062 |
| 416 | Ga0496104_0085298 | 3300048907 | Bacteria | 3014 |
| 417 | Ga0496104_0187543 | 3300048907 | Bacteria | 1979 |
| 418 | Ga0496104_0433058 | 3300048907 | Bacteria | 1227 |
| 419 | Ga0496104_1179006 | 3300048907 | Bacteria | 669 |
| 420 | Ga0496105_0015797 | 3300048908 | Bacteria | 6023 |
| 421 | Ga0496105_0051245 | 3300048908 | Bacteria | 3410 |
| 422 | Ga0496105_0326930 | 3300048908 | Bacteria | 1228 |
| 423 | Ga0496106_0013613 | 3300048909 | Bacteria | 6005 |
| 424 | Ga0496106_0034705 | 3300048909 | Bacteria | 3769 |
| 425 | Ga0496106_0115194 | 3300048909 | Bacteria | 2096 |
| 426 | Ga0496106_0737333 | 3300048909 | Bacteria | 784 |
| 427 | Ga0496106_1089059 | 3300048909 | Bacteria | 626 |
| 428 | Ga0496107_0002239 | 3300048910 | Bacteria | 12464 |
| 429 | Ga0496107_0750740 | 3300048910 | Bacteria | 716 |
| 430 | Ga0496107_0794907 | 3300048910 | Bacteria | 693 |
| 431 | Ga0496107_0828641 | 3300048910 | Bacteria | 676 |
| 432 | Ga0496108_0007089 | 3300048911 | Bacteria | 9077 |
| 433 | Ga0496108_0042575 | 3300048911 | Bacteria | 3791 |
| 434 | Ga0496108_0907341 | 3300048911 | Unclassified | 756 |
| 435 | Ga0496109_0171217 | 3300048912 | Bacteria | 2037 |
| 436 | Ga0496109_0691728 | 3300048912 | Bacteria | 957 |
| 437 | Ga0496110_0019982 | 3300048913 | Bacteria | 5646 |
| 438 | Ga0496110_0222460 | 3300048913 | Bacteria | 1717 |
| 439 | Ga0496110_0259579 | 3300048913 | Bacteria | 1581 |
| 440 | Ga0496111_0033999 | 3300048914 | Bacteria | 3638 |
| 441 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 442 | Ga0496112_0016426 | 3300048915 | Bacteria | 6934 |
| 443 | Ga0496112_0041775 | 3300048915 | Bacteria | 4487 |
| 444 | Ga0496113_0087349 | 3300048916 | Bacteria | 2397 |
| 445 | Ga0496113_0478955 | 3300048916 | Bacteria | 1000 |
| 446 | Ga0496113_0860176 | 3300048916 | Bacteria | 718 |
| 447 | Ga0496113_1470146 | 3300048916 | Bacteria | 526 |
| 448 | Ga0496114_0004928 | 3300048917 | Bacteria | 10402 |
| 449 | Ga0496114_0044223 | 3300048917 | Bacteria | 3694 |
| 450 | Ga0496114_0401489 | 3300048917 | Bacteria | 1214 |
| 451 | Ga0496114_0452516 | 3300048917 | Unclassified | 1137 |
| 452 | Ga0496114_0645780 | 3300048917 | Bacteria | 931 |
| 453 | Ga0496114_1653304 | 3300048917 | Bacteria | 528 |
| 454 | Ga0496115_0005238 | 3300048918 | Bacteria | 9424 |
| 455 | Ga0496116_0042244 | 3300048919 | Bacteria | 3119 |
| 456 | Ga0496116_0266202 | 3300048919 | Bacteria | 841 |
| 457 | Ga0496117_0086414 | 3300048920 | Bacteria | 2038 |
| 458 | Ga0496117_0169051 | 3300048920 | Bacteria | 1271 |
| 459 | Ga0496118_0020050 | 3300048921 | Bacteria | 5947 |
| 460 | Ga0496120_0211018 | 3300048923 | Bacteria | 934 |
| 461 | Ga0496121_0020703 | 3300048924 | Bacteria | 6490 |
| 462 | Ga0496121_0038297 | 3300048924 | Bacteria | 4249 |
| 463 | Ga0496121_0182096 | 3300048924 | Bacteria | 1515 |
| 464 | Ga0496121_0446577 | 3300048924 | Bacteria | 834 |
| 465 | Ga0496124_0413352 | 3300048927 | Bacteria | 932 |
| 466 | Ga0496125_0313904 | 3300048928 | Bacteria | 954 |
| 467 | Ga0496126_0085030 | 3300048929 | Bacteria | 2789 |
| 468 | Ga0496126_0555728 | 3300048929 | Bacteria | 910 |
| 469 | Ga0501031_0016891 | 3300049568 | Bacteria | 4740 |
| 470 | Ga0501031_0250116 | 3300049568 | Bacteria | 1152 |
| 471 | Ga0501031_0324483 | 3300049568 | Bacteria | 997 |
| 472 | Ga0501032_0004084 | 3300049569 | Bacteria | 11063 |
| 473 | Ga0501032_0034855 | 3300049569 | Bacteria | 3442 |
| 474 | Ga0501032_0050709 | 3300049569 | Bacteria | 2798 |
| 475 | Ga0501032_0084741 | 3300049569 | Bacteria | 2107 |
| 476 | Ga0501032_0549447 | 3300049569 | Bacteria | 736 |
| 477 | Ga0501033_0000060 | 3300049570 | Bacteria | 103159 |
| 478 | Ga0501033_0025632 | 3300049570 | Bacteria | 4442 |
| 479 | Ga0501033_0057020 | 3300049570 | Bacteria | 2887 |
| 480 | Ga0501034_0000117 | 3300049571 | Bacteria | 144865 |
| 481 | Ga0501034_0027174 | 3300049571 | Bacteria | 5821 |
| 482 | Ga0501034_0047099 | 3300049571 | Bacteria | 4355 |
| 483 | Ga0501034_0508735 | 3300049571 | Bacteria | 1117 |
| 484 | Ga0501034_0545178 | 3300049571 | Bacteria | 1070 |
| 485 | Ga0501036_0000188 | 3300049572 | Bacteria | 41101 |
| 486 | Ga0501036_0088879 | 3300049572 | Bacteria | 2610 |
| 487 | Ga0501036_0208515 | 3300049572 | Bacteria | 1642 |
| 488 | Ga0501036_0210467 | 3300049572 | Bacteria | 1634 |
| 489 | Ga0501037_0000402 | 3300049573 | Bacteria | 36091 |
| 490 | Ga0501037_0064879 | 3300049573 | Bacteria | 2660 |
| 491 | Ga0501037_0094044 | 3300049573 | Bacteria | 2167 |
| 492 | Ga0501037_0423010 | 3300049573 | Bacteria | 911 |
| 493 | Ga0501038_0000540 | 3300049574 | Bacteria | 33178 |
| 494 | Ga0501038_0002993 | 3300049574 | Bacteria | 15751 |
| 495 | Ga0501038_0032560 | 3300049574 | Bacteria | 4598 |
| 496 | Ga0501038_0105152 | 3300049574 | Bacteria | 2345 |
| 497 | Ga0501038_0216242 | 3300049574 | Bacteria | 1531 |
| 498 | Ga0501038_0247101 | 3300049574 | Bacteria | 1414 |
| 499 | Ga0501039_0000431 | 3300049575 | Bacteria | 30281 |
| 500 | Ga0501039_0146322 | 3300049575 | Bacteria | 1856 |
| 501 | Ga0501039_0218513 | 3300049575 | Bacteria | 1498 |
| 502 | Ga0501039_0417020 | 3300049575 | Bacteria | 1054 |
| 503 | Ga0501040_0130248 | 3300049576 | Bacteria | 1768 |
| 504 | Ga0501040_0192361 | 3300049576 | Bacteria | 1448 |
| 505 | Ga0501042_0025253 | 3300049578 | Bacteria | 4172 |
| 506 | Ga0501042_0053024 | 3300049578 | Bacteria | 2893 |
| 507 | Ga0501043_0001032 | 3300049579 | Bacteria | 24462 |
| 508 | Ga0501043_0018314 | 3300049579 | Bacteria | 5491 |
| 509 | Ga0501043_0023614 | 3300049579 | Bacteria | 4822 |
| 510 | Ga0501043_0273384 | 3300049579 | Bacteria | 1296 |
| 511 | Ga0501046_0002670 | 3300049580 | Bacteria | 16628 |
| 512 | Ga0501046_0019018 | 3300049580 | Bacteria | 5701 |
| 513 | Ga0501046_0100506 | 3300049580 | Bacteria | 2219 |
| 514 | Ga0501046_0189165 | 3300049580 | Bacteria | 1536 |
| 515 | Ga0501046_0443497 | 3300049580 | Bacteria | 934 |
| 516 | Ga0501047_0000246 | 3300049581 | Bacteria | 64361 |
| 517 | Ga0501047_0022391 | 3300049581 | Bacteria | 6068 |
| 518 | Ga0501047_0089916 | 3300049581 | Bacteria | 2947 |
| 519 | Ga0501047_0112133 | 3300049581 | Bacteria | 2609 |
| 520 | Ga0501047_0337561 | 3300049581 | Bacteria | 1345 |
| 521 | Ga0501048_0000878 | 3300049582 | Bacteria | 22207 |
| 522 | Ga0501048_1016618 | 3300049582 | Bacteria | 596 |
| 523 | Ga0501067_0000320 | 3300049583 | Bacteria | 26233 |
| 524 | Ga0501067_0532386 | 3300049583 | Bacteria | 658 |
| 525 | Ga0501068_0004312 | 3300049584 | Bacteria | 7724 |
| 526 | Ga0501068_0007826 | 3300049584 | Bacteria | 5920 |
| 527 | Ga0501069_0003261 | 3300049585 | Bacteria | 8324 |
| 528 | Ga0501070_0000779 | 3300049586 | Bacteria | 28961 |
| 529 | Ga0501070_0042897 | 3300049586 | Bacteria | 3766 |
| 530 | Ga0501071_0119341 | 3300049587 | Bacteria | 1954 |
| 531 | Ga0501072_0241226 | 3300049588 | Bacteria | 1439 |
| 532 | Ga0501072_0263340 | 3300049588 | Bacteria | 1372 |
| 533 | Ga0501072_0285821 | 3300049588 | Bacteria | 1311 |
| 534 | Ga0501073_0000093 | 3300049589 | Bacteria | 56882 |
| 535 | Ga0501074_0000127 | 3300049590 | Bacteria | 38795 |
| 536 | Ga0501074_0021500 | 3300049590 | Bacteria | 4684 |
| 537 | Ga0501074_0373520 | 3300049590 | Bacteria | 1011 |
| 538 | Ga0501076_0177507 | 3300049592 | Bacteria | 1736 |
| 539 | Ga0501076_1079084 | 3300049592 | Bacteria | 661 |
| 540 | Ga0501077_0202273 | 3300049593 | Bacteria | 1262 |
| 541 | Ga0501079_0013697 | 3300049741 | Bacteria | 6184 |
| 542 | Ga0501079_0046768 | 3300049741 | Bacteria | 3339 |
| 543 | Ga0501080_0001845 | 3300049742 | Bacteria | 18181 |
| 544 | Ga0501080_0012725 | 3300049742 | Bacteria | 7716 |
| 545 | Ga0501080_0055276 | 3300049742 | Bacteria | 3697 |
| 546 | Ga0501080_0179782 | 3300049742 | Bacteria | 1947 |
| 547 | Ga0501083_0004463 | 3300049744 | Bacteria | 9887 |
| 548 | Ga0501083_0018238 | 3300049744 | Bacteria | 4891 |
| 549 | Ga0501083_0171879 | 3300049744 | Bacteria | 1416 |
| 550 | Ga0501035_0000798 | 3300049822 | Bacteria | 33520 |
| 551 | Ga0501035_0009234 | 3300049822 | Bacteria | 9169 |
| 552 | Ga0501035_0165102 | 3300049822 | Bacteria | 1915 |
| 553 | Ga0501035_0245458 | 3300049822 | Bacteria | 1522 |
| 554 | Ga0501035_0292094 | 3300049822 | Bacteria | 1375 |
| 555 | Ga0501044_0001581 | 3300049823 | Bacteria | 26656 |
| 556 | Ga0501044_0018220 | 3300049823 | Bacteria | 7530 |
| 557 | Ga0501044_0039565 | 3300049823 | Bacteria | 4918 |
| 558 | Ga0501044_0621452 | 3300049823 | Bacteria | 972 |
| 559 | Ga0501045_0012744 | 3300049824 | Bacteria | 5923 |
| 560 | Ga0501045_0161957 | 3300049824 | Bacteria | 1665 |
| 561 | Ga0501045_0737620 | 3300049824 | Bacteria | 726 |
| 562 | nmdc:mga03n38_51576_c1 | 3300050490 | Bacteria | 1838 |
| 563 | nmdc:mga00v17_96973_c1 | 3300050491 | Bacteria | 1858 |
| 564 | nmdc:mga0yw44_16739_c1 | 3300050492 | Bacteria | 3970 |
| 565 | nmdc:mga0yw44_55099_c1 | 3300050492 | Bacteria | 2419 |
| 566 | nmdc:mga0k408_385866_c1 | 3300050493 | Bacteria | 834 |
| 567 | nmdc:mga06z11_220546_c1 | 3300050494 | Bacteria | 1108 |
| 568 | nmdc:mga06z11_777982_c1 | 3300050494 | Bacteria | 583 |
| 569 | nmdc:mga04h51_12432_c1 | 3300050495 | Bacteria | 2389 |
| 570 | nmdc:mga04h51_58265_c1 | 3300050495 | Bacteria | 1316 |
| 571 | nmdc:mga07m45_462860_c1 | 3300050496 | Bacteria | 735 |
| 572 | nmdc:mga07m45_50497_c1 | 3300050496 | Bacteria | 2344 |
| 573 | nmdc:mga08y16_830837_c1 | 3300050511 | Bacteria | 914 |
| 574 | nmdc:mga0n895_395533_c1 | 3300050512 | Bacteria | 1398 |
| 575 | nmdc:mga0n895_46805_c1 | 3300050512 | Bacteria | 4227 |
| 576 | nmdc:mga0a205_1186142_c1 | 3300050515 | Bacteria | 611 |
| 577 | nmdc:mga0sz30_118129_c1 | 3300050516 | Bacteria | 1165 |
| 578 | nmdc:mga0sz30_130189_c1 | 3300050516 | Bacteria | 1108 |
| 579 | nmdc:mga0sz30_178087_c1 | 3300050516 | Bacteria | 943 |
| 580 | Ga0495601_0195030 | 3300053077 | Bacteria | 1324 |
| 581 | Ga0495601_0304960 | 3300053077 | Bacteria | 1037 |
| 582 | Ga0495601_0666579 | 3300053077 | Bacteria | 665 |
| 583 | Ga0495595_0036053 | 3300053084 | Bacteria | 2243 |
| 584 | Ga0495619_0034689 | 3300053085 | Bacteria | 3281 |
| 585 | Ga0495619_0045567 | 3300053085 | Bacteria | 2882 |
| 586 | Ga0500553_243484 | 3300053101 | Bacteria | 556 |
| 587 | Ga0500557_000066 | 3300053105 | Bacteria | 41202 |
| 588 | Ga0500595_017221 | 3300053119 | Bacteria | 2672 |
| 589 | Ga0500636_0217595 | 3300053177 | Bacteria | 998 |
| 590 | Ga0500636_0263922 | 3300053177 | Bacteria | 870 |
| 591 | Ga0500625_002177 | 3300053729 | Bacteria | 7216 |
| 592 | Ga0501084_0000963 | 3300054114 | Bacteria | 22308 |
| 593 | Ga0501082_0002692 | 3300060353 | Bacteria | 15526 |
| 594 | Ga0501082_0152367 | 3300060353 | Bacteria | 2008 |
| 595 | Ga0466962_0023059 | 3300061719 | Bacteria | 2993 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2744054633 | 2745077845 | 133 |
| 2 | iso_pu_bacteria | 2507262055 | 2507505590 | 135 |
| 3 | iso_pu_bacteria | 2508501042 | 2508695851 | 135 |
| 4 | iso_pu_bacteria | 2515154112 | 2515623988 | 135 |
| 5 | iso_pu_bacteria | 2874590934 | 2874591612 | 135 |
| 6 | iso_pu_bacteria | 2874645413 | 2874645966 | 135 |
| 7 | iso_pu_bacteria | 2876771140 | 2876772061 | 135 |
| 8 | iso_pu_bacteria | 2876818435 | 2876819282 | 135 |
| 9 | iso_pu_bacteria | 2879074833 | 2879075519 | 135 |
| 10 | iso_pu_bacteria | 2879127579 | 2879127994 | 135 |
| 11 | iso_pu_bacteria | 2879142872 | 2879143293 | 135 |
| 12 | iso_pu_bacteria | 2935648319 | 2935649034 | 135 |
| 13 | iso_pu_bacteria | 2935656913 | 2935658194 | 135 |
| 14 | iso_pu_bacteria | 2935769743 | 2935774143 | 135 |
| 15 | iso_pu_bacteria | 2935777560 | 2935783723 | 135 |
| 16 | iso_pu_bacteria | 2935785616 | 2935789140 | 135 |
| 17 | iso_pu_bacteria | 2935975950 | 2935982180 | 135 |
| 18 | iso_pu_bacteria | 2935984226 | 2935985319 | 135 |
| 19 | iso_pu_bacteria | 2936011229 | 2936012413 | 135 |
| 20 | iso_pu_bacteria | 2936019824 | 2936020506 | 135 |
| 21 | iso_pu_bacteria | 2936028420 | 2936029706 | 135 |
| 22 | iso_pu_bacteria | 2936046547 | 2936051829 | 135 |
| 23 | iso_pu_bacteria | 2936055302 | 2936056917 | 135 |
| 24 | iso_pu_bacteria | 8016522445 | 8016525851 | 135 |
| 25 | iso_pu_bacteria | 8016530956 | 8016539451 | 135 |
| 26 | iso_pu_bacteria | 8016539877 | 8016543740 | 135 |
| 27 | iso_pu_bacteria | 8016557553 | 8016557975 | 135 |
| 28 | iso_pu_bacteria | 8016566248 | 8016569141 | 135 |
| 29 | iso_pu_bacteria | 8016575299 | 8016581779 | 135 |
| 30 | iso_pu_bacteria | 8016595262 | 8016595991 | 135 |
| 31 | iso_pu_bacteria | 8016603502 | 8016606863 | 135 |
| 32 | iso_pu_bacteria | 8016613128 | 8016618770 | 135 |
| 33 | iso_pu_bacteria | 8016622563 | 8016622763 | 135 |
| 34 | iso_pu_bacteria | 8016630954 | 8016635254 | 135 |
| 35 | iso_pu_bacteria | 8019530166 | 8019530731 | 135 |
| 36 | iso_pu_bacteria | 8019538911 | 8019540854 | 135 |
| 37 | iso_pu_bacteria | 8019547302 | 8019549762 | 135 |
| 38 | iso_pu_bacteria | 8019619141 | 8019623327 | 135 |
| 39 | iso_pu_bacteria | 8019629233 | 8019629768 | 135 |
| 40 | iso_pu_bacteria | 8019638758 | 8019640848 | 135 |
| 41 | iso_pu_bacteria | 8019659431 | 8019666614 | 135 |
| 42 | iso_pu_bacteria | 8019668869 | 8019676349 | 135 |
| 43 | iso_pu_bacteria | 2513237094 | 2513642296 | 137 |
| 44 | iso_pu_bacteria | 2513237096 | 2513660735 | 137 |
| 45 | iso_pu_bacteria | 2513237137 | 2513863030 | 137 |
| 46 | iso_pu_bacteria | 2513237145 | 2513922531 | 137 |
| 47 | iso_pu_bacteria | 2528768022 | 2528852110 | 137 |
| 48 | iso_pu_bacteria | 2824600985 | 2824609114 | 137 |
| 49 | iso_pu_bacteria | 2824609381 | 2824615644 | 137 |
| 50 | iso_pu_bacteria | 2824661429 | 2824670904 | 137 |
| 51 | iso_pu_bacteria | 2824704595 | 2824713009 | 137 |
| 52 | iso_pu_bacteria | 2824753945 | 2824763358 | 137 |
| 53 | iso_pu_bacteria | 2824763712 | 2824773217 | 137 |
| 54 | iso_pu_bacteria | 2844315083 | 2844315825 | 137 |
| 55 | iso_pu_bacteria | 2879099564 | 2879106736 | 137 |
| 56 | iso_pu_bacteria | 2885409591 | 2885414298 | 137 |
| 57 | iso_pu_bacteria | 2903727486 | 2903730875 | 137 |
| 58 | iso_pu_bacteria | 2904711408 | 2904714145 | 137 |
| 59 | iso_pu_bacteria | 2906602504 | 2906603698 | 137 |
| 60 | iso_pu_bacteria | 2906610324 | 2906614166 | 137 |
| 61 | iso_pu_bacteria | 2922368715 | 2922369112 | 137 |
| 62 | iso_pu_bacteria | 2929615660 | 2929618973 | 137 |
| 63 | iso_pu_bacteria | 2929624759 | 2929631050 | 137 |
| 64 | iso_pu_bacteria | 2932784394 | 2932789014 | 137 |
| 65 | iso_pu_bacteria | 2932794094 | 2932799943 | 137 |
| 66 | iso_pu_bacteria | 2932801729 | 2932808867 | 137 |
| 67 | iso_pu_bacteria | 2932809354 | 2932814348 | 137 |
| 68 | iso_pu_bacteria | 2932818245 | 2932820474 | 137 |
| 69 | iso_pu_bacteria | 2932828146 | 2932834507 | 137 |
| 70 | iso_pu_bacteria | 2933577622 | 2933580317 | 137 |
| 71 | iso_pu_bacteria | 2935616580 | 2935624489 | 137 |
| 72 | iso_pu_bacteria | 2935638405 | 2935645879 | 137 |
| 73 | iso_pu_bacteria | 2935665750 | 2935673446 | 137 |
| 74 | iso_pu_bacteria | 2935675223 | 2935682623 | 137 |
| 75 | iso_pu_bacteria | 2935684952 | 2935686763 | 137 |
| 76 | iso_pu_bacteria | 2935694250 | 2935701558 | 137 |
| 77 | iso_pu_bacteria | 2935703347 | 2935710468 | 137 |
| 78 | iso_pu_bacteria | 2935713505 | 2935716451 | 137 |
| 79 | iso_pu_bacteria | 2935722832 | 2935723424 | 137 |
| 80 | iso_pu_bacteria | 2935732158 | 2935734980 | 137 |
| 81 | iso_pu_bacteria | 2935741537 | 2935744229 | 137 |
| 82 | iso_pu_bacteria | 2935750917 | 2935752729 | 137 |
| 83 | iso_pu_bacteria | 2935760218 | 2935764724 | 137 |
| 84 | iso_pu_bacteria | 2935801545 | 2935806165 | 137 |
| 85 | iso_pu_bacteria | 2935810662 | 2935816931 | 137 |
| 86 | iso_pu_bacteria | 2935827899 | 2935835220 | 137 |
| 87 | iso_pu_bacteria | 2935837841 | 2935841398 | 137 |
| 88 | iso_pu_bacteria | 2935855204 | 2935863034 | 137 |
| 89 | iso_pu_bacteria | 2935864058 | 2935871844 | 137 |
| 90 | iso_pu_bacteria | 2935873716 | 2935882265 | 137 |
| 91 | iso_pu_bacteria | 2935883170 | 2935883262 | 137 |
| 92 | iso_pu_bacteria | 2935959822 | 2935966446 | 137 |
| 93 | iso_pu_bacteria | 2935992306 | 2936000164 | 137 |
| 94 | iso_pu_bacteria | 2936002035 | 2936010078 | 137 |
| 95 | iso_pu_bacteria | 2936037263 | 2936043922 | 137 |
| 96 | iso_pu_bacteria | 2940556831 | 2940558642 | 137 |
| 97 | iso_pu_bacteria | 2941531003 | 2941535676 | 137 |
| 98 | iso_pu_bacteria | 2941538514 | 2941543624 | 137 |
| 99 | iso_pu_bacteria | 3005718088 | 3005718643 | 137 |
| 100 | iso_pu_bacteria | 8016511872 | 8016517786 | 137 |
| 101 | iso_pu_bacteria | 8017057580 | 8017058842 | 137 |
| 102 | iso_pu_bacteria | 8019576017 | 8019576811 | 137 |
| 103 | iso_pu_bacteria | 8019586578 | 8019594864 | 137 |
| 104 | iso_pu_bacteria | 8019597564 | 8019606875 | 137 |
| 105 | iso_pu_bacteria | 8019608314 | 8019611633 | 137 |
| 106 | iso_pu_bacteria | 8019648815 | 8019652945 | 137 |
| 107 | iso_pu_bacteria | 8055742211 | 8055742822 | 137 |
| 108 | iso_pu_bacteria | 8056967851 | 8056975644 | 137 |
| 109 | 3300005344 | Ga0070661_100445373 | Ga0070661_1004453732 | 139 |
| 110 | 3300005543 | Ga0070672_102086874 | Ga0070672_1020868741 | 139 |
| 111 | 3300006186 | Ga0075369_10424529 | Ga0075369_104245292 | 139 |
| 112 | 3300006353 | Ga0075370_10278837 | Ga0075370_102788372 | 139 |
| 113 | 3300009177 | Ga0105248_10881095 | Ga0105248_108810952 | 139 |
| 114 | 3300025941 | Ga0207711_10760273 | Ga0207711_107602731 | 139 |
| 115 | 3300025981 | Ga0207640_10216224 | Ga0207640_102162242 | 139 |
| 116 | 3300026078 | Ga0207702_10700567 | Ga0207702_107005672 | 139 |
| 117 | 3300041491 | Ga0451833_0312650 | Ga0451833_0312650_184_603 | 139 |
| 118 | 3300041512 | Ga0451853_3498500 | Ga0451853_3498500_533_952 | 139 |
| 119 | 3300048907 | Ga0496104_1179006 | Ga0496104_1179006_153_572 | 139 |
| 120 | 3300048917 | Ga0496114_0645780 | Ga0496114_0645780_380_799 | 139 |
| 121 | 3300053105 | Ga0500557_000066 | Ga0500557_000066_5659_6078 | 139 |
| 122 | 3300053177 | Ga0500636_0263922 | Ga0500636_0263922_66_485 | 139 |
| 123 | 3300053729 | Ga0500625_002177 | Ga0500625_002177_1370_1789 | 139 |
| 124 | 3300005338 | Ga0068868_100107022 | Ga0068868_1001070222 | 140 |
| 125 | 3300009098 | Ga0105245_12925197 | Ga0105245_129251971 | 140 |
| 126 | 3300009177 | Ga0105248_10564970 | Ga0105248_105649702 | 140 |
| 127 | 3300025915 | Ga0207693_10542838 | Ga0207693_105428382 | 140 |
| 128 | 3300025927 | Ga0207687_10307215 | Ga0207687_103072152 | 140 |
| 129 | 3300046454 | Ga0495592_0129660 | Ga0495592_0129660_1212_1634 | 140 |
| 130 | 3300046462 | Ga0495651_0120070 | Ga0495651_0120070_1232_1654 | 140 |
| 131 | 3300046476 | Ga0495662_0244024 | Ga0495662_0244024_433_855 | 140 |
| 132 | 3300046477 | Ga0495664_0046484 | Ga0495664_0046484_479_901 | 140 |
| 133 | 3300046511 | Ga0495608_0032064 | Ga0495608_0032064_1161_1583 | 140 |
| 134 | 3300046516 | Ga0495628_0022190 | Ga0495628_0022190_2312_2734 | 140 |
| 135 | 3300046517 | Ga0495630_0261524 | Ga0495630_0261524_447_869 | 140 |
| 136 | 3300046529 | Ga0495652_0203365 | Ga0495652_0203365_88_510 | 140 |
| 137 | 3300046533 | Ga0495640_0038299 | Ga0495640_0038299_2151_2573 | 140 |
| 138 | 3300046536 | Ga0495587_0026203 | Ga0495587_0026203_1109_1531 | 140 |
| 139 | 3300046543 | Ga0495645_0026529 | Ga0495645_0026529_2146_2568 | 140 |
| 140 | 3300046559 | Ga0495667_0078724 | Ga0495667_0078724_1418_1840 | 140 |
| 141 | 3300046675 | Ga0495657_0030658 | Ga0495657_0030658_163_585 | 140 |
| 142 | 3300046678 | Ga0495599_0165805 | Ga0495599_0165805_327_749 | 140 |
| 143 | 3300046679 | Ga0495623_0006002 | Ga0495623_0006002_3705_4127 | 140 |
| 144 | 3300046680 | Ga0495646_0096828 | Ga0495646_0096828_231_653 | 140 |
| 145 | 3300046689 | Ga0495613_0041099 | Ga0495613_0041099_1101_1523 | 140 |
| 146 | 3300046690 | Ga0495624_0139212 | Ga0495624_0139212_416_838 | 140 |
| 147 | 3300046809 | Ga0495600_0021601 | Ga0495600_0021601_856_1278 | 140 |
| 148 | 3300047317 | Ga0495604_0001041 | Ga0495604_0001041_15322_15744 | 140 |
| 149 | 3300047319 | Ga0495674_0099449 | Ga0495674_0099449_729_1151 | 140 |
| 150 | 3300047322 | Ga0495680_0007821 | Ga0495680_0007821_8464_8886 | 140 |
| 151 | 3300047444 | Ga0495675_0010362 | Ga0495675_0010362_175_597 | 140 |
| 152 | 3300047471 | Ga0495684_0361823 | Ga0495684_0361823_304_726 | 140 |
| 153 | 3300048088 | Ga0495602_0004605 | Ga0495602_0004605_13834_14256 | 140 |
| 154 | 3300048924 | Ga0496121_0446577 | Ga0496121_0446577_55_477 | 140 |
| 155 | 3300049580 | Ga0501046_0189165 | Ga0501046_0189165_191_613 | 140 |
| 156 | 3300049581 | Ga0501047_0089916 | Ga0501047_0089916_2151_2573 | 140 |
| 157 | 3300049582 | Ga0501048_1016618 | Ga0501048_1016618_160_582 | 140 |
| 158 | 3300049583 | Ga0501067_0532386 | Ga0501067_0532386_125_547 | 140 |
| 159 | 3300049586 | Ga0501070_0042897 | Ga0501070_0042897_227_649 | 140 |
| 160 | 3300049590 | Ga0501074_0021500 | Ga0501074_0021500_722_1144 | 140 |
| 161 | 3300049742 | Ga0501080_0012725 | Ga0501080_0012725_1061_1483 | 140 |
| 162 | 3300053084 | Ga0495595_0036053 | Ga0495595_0036053_859_1281 | 140 |
| 163 | 3300053085 | Ga0495619_0034689 | Ga0495619_0034689_131_553 | 140 |
| 164 | 3300001989 | JGI24739J22299_10134666 | JGI24739J22299_101346661 | 141 |
| 165 | 3300001990 | JGI24737J22298_10193408 | JGI24737J22298_101934081 | 141 |
| 166 | 3300003215 | JGI25153J46596_10002528 | JGI25153J46596_100025285 | 141 |
| 167 | 3300003752 | Ga0055539_1014096 | Ga0055539_10140962 | 141 |
| 168 | 3300005327 | Ga0070658_10755586 | Ga0070658_107555861 | 141 |
| 169 | 3300005327 | Ga0070658_11431232 | Ga0070658_114312321 | 141 |
| 170 | 3300005328 | Ga0070676_10235753 | Ga0070676_102357532 | 141 |
| 171 | 3300005331 | Ga0070670_100051947 | Ga0070670_1000519473 | 141 |
| 172 | 3300005334 | Ga0068869_100012989 | Ga0068869_1000129892 | 141 |
| 173 | 3300005335 | Ga0070666_10066516 | Ga0070666_100665165 | 141 |
| 174 | 3300005335 | Ga0070666_10379765 | Ga0070666_103797652 | 141 |
| 175 | 3300005335 | Ga0070666_11103636 | Ga0070666_111036361 | 141 |
| 176 | 3300005336 | Ga0070680_100094004 | Ga0070680_1000940044 | 141 |
| 177 | 3300005338 | Ga0068868_100011843 | Ga0068868_1000118433 | 141 |
| 178 | 3300005339 | Ga0070660_100039424 | Ga0070660_1000394243 | 141 |
| 179 | 3300005341 | Ga0070691_10050896 | Ga0070691_100508963 | 141 |
| 180 | 3300005341 | Ga0070691_10197565 | Ga0070691_101975651 | 141 |
| 181 | 3300005344 | Ga0070661_100017917 | Ga0070661_1000179173 | 141 |
| 182 | 3300005344 | Ga0070661_100053218 | Ga0070661_1000532183 | 141 |
| 183 | 3300005344 | Ga0070661_100576466 | Ga0070661_1005764662 | 141 |
| 184 | 3300005347 | Ga0070668_100122790 | Ga0070668_1001227902 | 141 |
| 185 | 3300005356 | Ga0070674_100032766 | Ga0070674_1000327663 | 141 |
| 186 | 3300005364 | Ga0070673_100054921 | Ga0070673_1000549212 | 141 |
| 187 | 3300005365 | Ga0070688_100243222 | Ga0070688_1002432222 | 141 |
| 188 | 3300005366 | Ga0070659_100056429 | Ga0070659_1000564293 | 141 |
| 189 | 3300005366 | Ga0070659_100376200 | Ga0070659_1003762002 | 141 |
| 190 | 3300005366 | Ga0070659_100580088 | Ga0070659_1005800882 | 141 |
| 191 | 3300005435 | Ga0070714_100118538 | Ga0070714_1001185383 | 141 |
| 192 | 3300005436 | Ga0070713_101048932 | Ga0070713_1010489322 | 141 |
| 193 | 3300005437 | Ga0070710_10697333 | Ga0070710_106973332 | 141 |
| 194 | 3300005455 | Ga0070663_100140964 | Ga0070663_1001409642 | 141 |
| 195 | 3300005455 | Ga0070663_100952155 | Ga0070663_1009521552 | 141 |
| 196 | 3300005457 | Ga0070662_100014862 | Ga0070662_1000148625 | 141 |
| 197 | 3300005457 | Ga0070662_100282855 | Ga0070662_1002828552 | 141 |
| 198 | 3300005457 | Ga0070662_100411803 | Ga0070662_1004118032 | 141 |
| 199 | 3300005458 | Ga0070681_10126848 | Ga0070681_101268484 | 141 |
| 200 | 3300005458 | Ga0070681_10330323 | Ga0070681_103303232 | 141 |
| 201 | 3300005458 | Ga0070681_11023433 | Ga0070681_110234331 | 141 |
| 202 | 3300005530 | Ga0070679_100024411 | Ga0070679_1000244117 | 141 |
| 203 | 3300005530 | Ga0070679_100251290 | Ga0070679_1002512902 | 141 |
| 204 | 3300005530 | Ga0070679_100699814 | Ga0070679_1006998141 | 141 |
| 205 | 3300005535 | Ga0070684_100013505 | Ga0070684_1000135053 | 141 |
| 206 | 3300005539 | Ga0068853_100002730 | Ga0068853_1000027306 | 141 |
| 207 | 3300005539 | Ga0068853_100043184 | Ga0068853_1000431844 | 141 |
| 208 | 3300005539 | Ga0068853_100059692 | Ga0068853_1000596922 | 141 |
| 209 | 3300005539 | Ga0068853_100647345 | Ga0068853_1006473452 | 141 |
| 210 | 3300005539 | Ga0068853_100674358 | Ga0068853_1006743582 | 141 |
| 211 | 3300005545 | Ga0070695_100271705 | Ga0070695_1002717052 | 141 |
| 212 | 3300005547 | Ga0070693_100164175 | Ga0070693_1001641753 | 141 |
| 213 | 3300005548 | Ga0070665_100027665 | Ga0070665_1000276655 | 141 |
| 214 | 3300005548 | Ga0070665_100135000 | Ga0070665_1001350003 | 141 |
| 215 | 3300005563 | Ga0068855_100021753 | Ga0068855_1000217533 | 141 |
| 216 | 3300005563 | Ga0068855_100037914 | Ga0068855_1000379145 | 141 |
| 217 | 3300005563 | Ga0068855_100041282 | Ga0068855_1000412824 | 141 |
| 218 | 3300005563 | Ga0068855_100182282 | Ga0068855_1001822822 | 141 |
| 219 | 3300005563 | Ga0068855_100201724 | Ga0068855_1002017244 | 141 |
| 220 | 3300005564 | Ga0070664_100145387 | Ga0070664_1001453871 | 141 |
| 221 | 3300005577 | Ga0068857_100112090 | Ga0068857_1001120903 | 141 |
| 222 | 3300005578 | Ga0068854_100159466 | Ga0068854_1001594662 | 141 |
| 223 | 3300005578 | Ga0068854_100177197 | Ga0068854_1001771973 | 141 |
| 224 | 3300005578 | Ga0068854_100264692 | Ga0068854_1002646922 | 141 |
| 225 | 3300005614 | Ga0068856_100052225 | Ga0068856_1000522253 | 141 |
| 226 | 3300005614 | Ga0068856_100217457 | Ga0068856_1002174571 | 141 |
| 227 | 3300005616 | Ga0068852_100033963 | Ga0068852_1000339633 | 141 |
| 228 | 3300005616 | Ga0068852_100483729 | Ga0068852_1004837292 | 141 |
| 229 | 3300005617 | Ga0068859_100469133 | Ga0068859_1004691332 | 141 |
| 230 | 3300005617 | Ga0068859_100690542 | Ga0068859_1006905422 | 141 |
| 231 | 3300005618 | Ga0068864_100026873 | Ga0068864_1000268734 | 141 |
| 232 | 3300005618 | Ga0068864_101084112 | Ga0068864_1010841122 | 141 |
| 233 | 3300005719 | Ga0068861_100187617 | Ga0068861_1001876172 | 141 |
| 234 | 3300005834 | Ga0068851_10001428 | Ga0068851_1000142810 | 141 |
| 235 | 3300005834 | Ga0068851_10497480 | Ga0068851_104974802 | 141 |
| 236 | 3300005840 | Ga0068870_10912882 | Ga0068870_109128821 | 141 |
| 237 | 3300005841 | Ga0068863_100149767 | Ga0068863_1001497672 | 141 |
| 238 | 3300005841 | Ga0068863_100199453 | Ga0068863_1001994533 | 141 |
| 239 | 3300005842 | Ga0068858_100030769 | Ga0068858_1000307695 | 141 |
| 240 | 3300005844 | Ga0068862_100021523 | Ga0068862_1000215232 | 141 |
| 241 | 3300006038 | Ga0075365_10009930 | Ga0075365_100099304 | 141 |
| 242 | 3300006038 | Ga0075365_10013973 | Ga0075365_100139732 | 141 |
| 243 | 3300006038 | Ga0075365_10038705 | Ga0075365_100387052 | 141 |
| 244 | 3300006038 | Ga0075365_10824199 | Ga0075365_108241992 | 141 |
| 245 | 3300006042 | Ga0075368_10006293 | Ga0075368_100062932 | 141 |
| 246 | 3300006042 | Ga0075368_10026442 | Ga0075368_100264422 | 141 |
| 247 | 3300006048 | Ga0075363_100012247 | Ga0075363_1000122472 | 141 |
| 248 | 3300006048 | Ga0075363_100037813 | Ga0075363_1000378132 | 141 |
| 249 | 3300006048 | Ga0075363_100154187 | Ga0075363_1001541871 | 141 |
| 250 | 3300006051 | Ga0075364_10037875 | Ga0075364_100378753 | 141 |
| 251 | 3300006051 | Ga0075364_10057502 | Ga0075364_100575022 | 141 |
| 252 | 3300006173 | Ga0070716_100368761 | Ga0070716_1003687612 | 141 |
| 253 | 3300006177 | Ga0075362_10287424 | Ga0075362_102874242 | 141 |
| 254 | 3300006178 | Ga0075367_10166607 | Ga0075367_101666072 | 141 |
| 255 | 3300006178 | Ga0075367_10869061 | Ga0075367_108690611 | 141 |
| 256 | 3300006186 | Ga0075369_10031777 | Ga0075369_100317773 | 141 |
| 257 | 3300006186 | Ga0075369_10283598 | Ga0075369_102835982 | 141 |
| 258 | 3300006195 | Ga0075366_10099054 | Ga0075366_100990543 | 141 |
| 259 | 3300006195 | Ga0075366_10369420 | Ga0075366_103694202 | 141 |
| 260 | 3300006237 | Ga0097621_100110196 | Ga0097621_1001101963 | 141 |
| 261 | 3300006237 | Ga0097621_100965932 | Ga0097621_1009659321 | 141 |
| 262 | 3300006353 | Ga0075370_10026313 | Ga0075370_100263132 | 141 |
| 263 | 3300006353 | Ga0075370_10168027 | Ga0075370_101680272 | 141 |
| 264 | 3300006358 | Ga0068871_100264225 | Ga0068871_1002642252 | 141 |
| 265 | 3300006358 | Ga0068871_100378784 | Ga0068871_1003787841 | 141 |
| 266 | 3300006871 | Ga0075434_100061594 | Ga0075434_1000615943 | 141 |
| 267 | 3300006871 | Ga0075434_101523830 | Ga0075434_1015238301 | 141 |
| 268 | 3300006881 | Ga0068865_100263781 | Ga0068865_1002637812 | 141 |
| 269 | 3300006881 | Ga0068865_101027694 | Ga0068865_1010276942 | 141 |
| 270 | 3300006931 | Ga0097620_100469108 | Ga0097620_1004691082 | 141 |
| 271 | 3300006931 | Ga0097620_100690468 | Ga0097620_1006904682 | 141 |
| 272 | 3300006942 | Ga0099824_1002409 | Ga0099824_100240923 | 141 |
| 273 | 3300006943 | Ga0099822_1000008 | Ga0099822_100000868 | 141 |
| 274 | 3300009011 | Ga0105251_10170876 | Ga0105251_101708762 | 141 |
| 275 | 3300009093 | Ga0105240_10012556 | Ga0105240_1001255612 | 141 |
| 276 | 3300009093 | Ga0105240_10054293 | Ga0105240_100542933 | 141 |
| 277 | 3300009093 | Ga0105240_10056581 | Ga0105240_100565812 | 141 |
| 278 | 3300009093 | Ga0105240_10135680 | Ga0105240_101356802 | 141 |
| 279 | 3300009098 | Ga0105245_10017461 | Ga0105245_100174612 | 141 |
| 280 | 3300009098 | Ga0105245_10463784 | Ga0105245_104637841 | 141 |
| 281 | 3300009098 | Ga0105245_10736449 | Ga0105245_107364492 | 141 |
| 282 | 3300009101 | Ga0105247_10031014 | Ga0105247_100310142 | 141 |
| 283 | 3300009148 | Ga0105243_10102511 | Ga0105243_101025113 | 141 |
| 284 | 3300009148 | Ga0105243_10870550 | Ga0105243_108705502 | 141 |
| 285 | 3300009174 | Ga0105241_10011237 | Ga0105241_100112372 | 141 |
| 286 | 3300009174 | Ga0105241_10144453 | Ga0105241_101444532 | 141 |
| 287 | 3300009174 | Ga0105241_10154460 | Ga0105241_101544603 | 141 |
| 288 | 3300009174 | Ga0105241_11160333 | Ga0105241_111603331 | 141 |
| 289 | 3300009176 | Ga0105242_10145590 | Ga0105242_101455902 | 141 |
| 290 | 3300009177 | Ga0105248_10071498 | Ga0105248_100714981 | 141 |
| 291 | 3300009177 | Ga0105248_10151393 | Ga0105248_101513932 | 141 |
| 292 | 3300009177 | Ga0105248_11334522 | Ga0105248_113345221 | 141 |
| 293 | 3300009545 | Ga0105237_10014080 | Ga0105237_100140808 | 141 |
| 294 | 3300009545 | Ga0105237_10051620 | Ga0105237_100516202 | 141 |
| 295 | 3300009545 | Ga0105237_10103471 | Ga0105237_101034713 | 141 |
| 296 | 3300009545 | Ga0105237_10493780 | Ga0105237_104937801 | 141 |
| 297 | 3300009545 | Ga0105237_10529019 | Ga0105237_105290192 | 141 |
| 298 | 3300009551 | Ga0105238_10002380 | Ga0105238_1000238014 | 141 |
| 299 | 3300009551 | Ga0105238_10532908 | Ga0105238_105329082 | 141 |
| 300 | 3300009551 | Ga0105238_10544596 | Ga0105238_105445962 | 141 |
| 301 | 3300009553 | Ga0105249_10745342 | Ga0105249_107453422 | 141 |
| 302 | 3300009553 | Ga0105249_10901006 | Ga0105249_109010062 | 141 |
| 303 | 3300010375 | Ga0105239_10016742 | Ga0105239_100167422 | 141 |
| 304 | 3300010375 | Ga0105239_10044082 | Ga0105239_100440822 | 141 |
| 305 | 3300010375 | Ga0105239_10066019 | Ga0105239_100660193 | 141 |
| 306 | 3300010375 | Ga0105239_10078176 | Ga0105239_100781762 | 141 |
| 307 | 3300010375 | Ga0105239_10112511 | Ga0105239_101125112 | 141 |
| 308 | 3300010375 | Ga0105239_10203110 | Ga0105239_102031102 | 141 |
| 309 | 3300010375 | Ga0105239_10883434 | Ga0105239_108834342 | 141 |
| 310 | 3300011119 | Ga0105246_10009964 | Ga0105246_100099642 | 141 |
| 311 | 3300011119 | Ga0105246_10966735 | Ga0105246_109667352 | 141 |
| 312 | 3300013100 | Ga0157373_10173499 | Ga0157373_101734992 | 141 |
| 313 | 3300013102 | Ga0157371_10027645 | Ga0157371_100276452 | 141 |
| 314 | 3300013102 | Ga0157371_10686540 | Ga0157371_106865401 | 141 |
| 315 | 3300013104 | Ga0157370_10571461 | Ga0157370_105714612 | 141 |
| 316 | 3300013105 | Ga0157369_10003624 | Ga0157369_100036245 | 141 |
| 317 | 3300013105 | Ga0157369_10665566 | Ga0157369_106655662 | 141 |
| 318 | 3300013105 | Ga0157369_10818131 | Ga0157369_108181312 | 141 |
| 319 | 3300013296 | Ga0157374_10144342 | Ga0157374_101443422 | 141 |
| 320 | 3300013296 | Ga0157374_10296236 | Ga0157374_102962363 | 141 |
| 321 | 3300013297 | Ga0157378_10309939 | Ga0157378_103099392 | 141 |
| 322 | 3300013306 | Ga0163162_10030752 | Ga0163162_100307522 | 141 |
| 323 | 3300013306 | Ga0163162_10244322 | Ga0163162_102443223 | 141 |
| 324 | 3300013307 | Ga0157372_10098144 | Ga0157372_100981442 | 141 |
| 325 | 3300013307 | Ga0157372_10928148 | Ga0157372_109281482 | 141 |
| 326 | 3300013307 | Ga0157372_11116427 | Ga0157372_111164272 | 141 |
| 327 | 3300013308 | Ga0157375_10027157 | Ga0157375_100271572 | 141 |
| 328 | 3300013308 | Ga0157375_10173845 | Ga0157375_101738451 | 141 |
| 329 | 3300014325 | Ga0163163_10064204 | Ga0163163_100642044 | 141 |
| 330 | 3300014325 | Ga0163163_10102082 | Ga0163163_101020822 | 141 |
| 331 | 3300014325 | Ga0163163_10793068 | Ga0163163_107930682 | 141 |
| 332 | 3300014745 | Ga0157377_10070088 | Ga0157377_100700882 | 141 |
| 333 | 3300014968 | Ga0157379_10542401 | Ga0157379_105424012 | 141 |
| 334 | 3300014969 | Ga0157376_10015819 | Ga0157376_100158195 | 141 |
| 335 | 3300014969 | Ga0157376_10124095 | Ga0157376_101240952 | 141 |
| 336 | 3300014969 | Ga0157376_11006524 | Ga0157376_110065241 | 141 |
| 337 | 3300014969 | Ga0157376_12633715 | Ga0157376_126337151 | 141 |
| 338 | 3300015262 | Ga0182007_10175862 | Ga0182007_101758621 | 141 |
| 339 | 3300021384 | Ga0213876_10024534 | Ga0213876_100245342 | 141 |
| 340 | 3300025253 | Ga0209677_100579 | Ga0209677_10057912 | 141 |
| 341 | 3300025254 | Ga0209148_1000192 | Ga0209148_100019211 | 141 |
| 342 | 3300025254 | Ga0209148_1009946 | Ga0209148_10099463 | 141 |
| 343 | 3300025261 | Ga0209233_1006130 | Ga0209233_10061305 | 141 |
| 344 | 3300025272 | Ga0209455_1004451 | Ga0209455_10044512 | 141 |
| 345 | 3300025272 | Ga0209455_1014919 | Ga0209455_10149193 | 141 |
| 346 | 3300025273 | Ga0209673_1053613 | Ga0209673_10536132 | 141 |
| 347 | 3300025295 | Ga0209564_1012844 | Ga0209564_10128444 | 141 |
| 348 | 3300025297 | Ga0209758_1001172 | Ga0209758_100117213 | 141 |
| 349 | 3300025297 | Ga0209758_1032536 | Ga0209758_10325363 | 141 |
| 350 | 3300025302 | Ga0207426_1076733 | Ga0207426_10767332 | 141 |
| 351 | 3300025302 | Ga0207426_1103936 | Ga0207426_11039361 | 141 |
| 352 | 3300025304 | Ga0209257_1013866 | Ga0209257_10138663 | 141 |
| 353 | 3300025321 | Ga0207656_10203527 | Ga0207656_102035272 | 141 |
| 354 | 3300025899 | Ga0207642_10027589 | Ga0207642_100275893 | 141 |
| 355 | 3300025900 | Ga0207710_10041840 | Ga0207710_100418402 | 141 |
| 356 | 3300025900 | Ga0207710_10305251 | Ga0207710_103052512 | 141 |
| 357 | 3300025901 | Ga0207688_10007709 | Ga0207688_100077094 | 141 |
| 358 | 3300025901 | Ga0207688_10431483 | Ga0207688_104314831 | 141 |
| 359 | 3300025904 | Ga0207647_10257600 | Ga0207647_102576002 | 141 |
| 360 | 3300025907 | Ga0207645_10218291 | Ga0207645_102182912 | 141 |
| 361 | 3300025908 | Ga0207643_10073112 | Ga0207643_100731122 | 141 |
| 362 | 3300025908 | Ga0207643_10497794 | Ga0207643_104977942 | 141 |
| 363 | 3300025909 | Ga0207705_10177366 | Ga0207705_101773663 | 141 |
| 364 | 3300025911 | Ga0207654_10025820 | Ga0207654_100258202 | 141 |
| 365 | 3300025911 | Ga0207654_10069305 | Ga0207654_100693051 | 141 |
| 366 | 3300025911 | Ga0207654_10114710 | Ga0207654_101147102 | 141 |
| 367 | 3300025912 | Ga0207707_10008321 | Ga0207707_100083216 | 141 |
| 368 | 3300025913 | Ga0207695_10000059 | Ga0207695_10000059288 | 141 |
| 369 | 3300025913 | Ga0207695_10084064 | Ga0207695_100840643 | 141 |
| 370 | 3300025913 | Ga0207695_10427864 | Ga0207695_104278641 | 141 |
| 371 | 3300025913 | Ga0207695_10551712 | Ga0207695_105517122 | 141 |
| 372 | 3300025914 | Ga0207671_10034984 | Ga0207671_100349842 | 141 |
| 373 | 3300025914 | Ga0207671_10179144 | Ga0207671_101791442 | 141 |
| 374 | 3300025914 | Ga0207671_11522855 | Ga0207671_115228551 | 141 |
| 375 | 3300025917 | Ga0207660_10003996 | Ga0207660_100039966 | 141 |
| 376 | 3300025917 | Ga0207660_10430424 | Ga0207660_104304241 | 141 |
| 377 | 3300025919 | Ga0207657_10012885 | Ga0207657_100128855 | 141 |
| 378 | 3300025920 | Ga0207649_10282619 | Ga0207649_102826192 | 141 |
| 379 | 3300025921 | Ga0207652_10003241 | Ga0207652_1000324111 | 141 |
| 380 | 3300025921 | Ga0207652_10281524 | Ga0207652_102815242 | 141 |
| 381 | 3300025924 | Ga0207694_10035977 | Ga0207694_100359773 | 141 |
| 382 | 3300025924 | Ga0207694_10163417 | Ga0207694_101634172 | 141 |
| 383 | 3300025924 | Ga0207694_10384305 | Ga0207694_103843052 | 141 |
| 384 | 3300025926 | Ga0207659_10342455 | Ga0207659_103424552 | 141 |
| 385 | 3300025927 | Ga0207687_10035730 | Ga0207687_100357303 | 141 |
| 386 | 3300025929 | Ga0207664_10053927 | Ga0207664_100539276 | 141 |
| 387 | 3300025932 | Ga0207690_10036782 | Ga0207690_100367822 | 141 |
| 388 | 3300025933 | Ga0207706_10042645 | Ga0207706_100426452 | 141 |
| 389 | 3300025933 | Ga0207706_10112999 | Ga0207706_101129992 | 141 |
| 390 | 3300025933 | Ga0207706_10603871 | Ga0207706_106038712 | 141 |
| 391 | 3300025934 | Ga0207686_10045398 | Ga0207686_100453982 | 141 |
| 392 | 3300025934 | Ga0207686_10370462 | Ga0207686_103704622 | 141 |
| 393 | 3300025937 | Ga0207669_10171092 | Ga0207669_101710923 | 141 |
| 394 | 3300025937 | Ga0207669_11233494 | Ga0207669_112334941 | 141 |
| 395 | 3300025938 | Ga0207704_10198041 | Ga0207704_101980412 | 141 |
| 396 | 3300025938 | Ga0207704_10685755 | Ga0207704_106857552 | 141 |
| 397 | 3300025939 | Ga0207665_10308765 | Ga0207665_103087652 | 141 |
| 398 | 3300025941 | Ga0207711_10091655 | Ga0207711_100916553 | 141 |
| 399 | 3300025941 | Ga0207711_10142090 | Ga0207711_101420903 | 141 |
| 400 | 3300025942 | Ga0207689_10009165 | Ga0207689_100091658 | 141 |
| 401 | 3300025942 | Ga0207689_10313046 | Ga0207689_103130462 | 141 |
| 402 | 3300025944 | Ga0207661_10175019 | Ga0207661_101750191 | 141 |
| 403 | 3300025945 | Ga0207679_10408188 | Ga0207679_104081882 | 141 |
| 404 | 3300025949 | Ga0207667_10011866 | Ga0207667_100118667 | 141 |
| 405 | 3300025949 | Ga0207667_10144601 | Ga0207667_101446013 | 141 |
| 406 | 3300025949 | Ga0207667_10171674 | Ga0207667_101716741 | 141 |
| 407 | 3300025949 | Ga0207667_10792027 | Ga0207667_107920271 | 141 |
| 408 | 3300025960 | Ga0207651_10508027 | Ga0207651_105080272 | 141 |
| 409 | 3300025961 | Ga0207712_10939591 | Ga0207712_109395911 | 141 |
| 410 | 3300025972 | Ga0207668_10036850 | Ga0207668_100368503 | 141 |
| 411 | 3300025986 | Ga0207658_10292695 | Ga0207658_102926952 | 141 |
| 412 | 3300026023 | Ga0207677_10109801 | Ga0207677_101098012 | 141 |
| 413 | 3300026035 | Ga0207703_10168390 | Ga0207703_101683902 | 141 |
| 414 | 3300026035 | Ga0207703_10316877 | Ga0207703_103168772 | 141 |
| 415 | 3300026041 | Ga0207639_10083712 | Ga0207639_100837124 | 141 |
| 416 | 3300026041 | Ga0207639_10143478 | Ga0207639_101434782 | 141 |
| 417 | 3300026041 | Ga0207639_10550556 | Ga0207639_105505562 | 141 |
| 418 | 3300026041 | Ga0207639_10571866 | Ga0207639_105718662 | 141 |
| 419 | 3300026067 | Ga0207678_10011885 | Ga0207678_100118854 | 141 |
| 420 | 3300026067 | Ga0207678_10039272 | Ga0207678_100392722 | 141 |
| 421 | 3300026067 | Ga0207678_10044237 | Ga0207678_100442372 | 141 |
| 422 | 3300026067 | Ga0207678_10068989 | Ga0207678_100689893 | 141 |
| 423 | 3300026067 | Ga0207678_10138362 | Ga0207678_101383622 | 141 |
| 424 | 3300026067 | Ga0207678_10258805 | Ga0207678_102588052 | 141 |
| 425 | 3300026067 | Ga0207678_11079981 | Ga0207678_110799812 | 141 |
| 426 | 3300026067 | Ga0207678_11511901 | Ga0207678_115119011 | 141 |
| 427 | 3300026078 | Ga0207702_10000365 | Ga0207702_1000036556 | 141 |
| 428 | 3300026078 | Ga0207702_10033574 | Ga0207702_100335743 | 141 |
| 429 | 3300026078 | Ga0207702_11658530 | Ga0207702_116585302 | 141 |
| 430 | 3300026088 | Ga0207641_10226886 | Ga0207641_102268862 | 141 |
| 431 | 3300026095 | Ga0207676_10150700 | Ga0207676_101507001 | 141 |
| 432 | 3300026095 | Ga0207676_10371576 | Ga0207676_103715762 | 141 |
| 433 | 3300026095 | Ga0207676_11353793 | Ga0207676_113537931 | 141 |
| 434 | 3300026116 | Ga0207674_10070435 | Ga0207674_100704353 | 141 |
| 435 | 3300026118 | Ga0207675_100040838 | Ga0207675_1000408382 | 141 |
| 436 | 3300026121 | Ga0207683_10255906 | Ga0207683_102559061 | 141 |
| 437 | 3300026121 | Ga0207683_10274146 | Ga0207683_102741462 | 141 |
| 438 | 3300026121 | Ga0207683_10378320 | Ga0207683_103783202 | 141 |
| 439 | 3300026142 | Ga0207698_10169467 | Ga0207698_101694673 | 141 |
| 440 | 3300026142 | Ga0207698_10244293 | Ga0207698_102442933 | 141 |
| 441 | 3300026142 | Ga0207698_10329124 | Ga0207698_103291242 | 141 |
| 442 | 3300026142 | Ga0207698_10341562 | Ga0207698_103415623 | 141 |
| 443 | 3300027357 | Ga0209589_1000026 | Ga0209589_100002688 | 141 |
| 444 | 3300027361 | Ga0209489_100046 | Ga0209489_10004688 | 141 |
| 445 | 3300027363 | Ga0209700_100047 | Ga0209700_10004788 | 141 |
| 446 | 3300027866 | Ga0209813_10065678 | Ga0209813_100656781 | 141 |
| 447 | 3300028379 | Ga0268266_10001416 | Ga0268266_1000141622 | 141 |
| 448 | 3300028379 | Ga0268266_10283187 | Ga0268266_102831873 | 141 |
| 449 | 3300028379 | Ga0268266_10616803 | Ga0268266_106168032 | 141 |
| 450 | 3300028380 | Ga0268265_10026336 | Ga0268265_100263362 | 141 |
| 451 | 3300028381 | Ga0268264_11461186 | Ga0268264_114611861 | 141 |
| 452 | 3300028573 | Ga0265334_10009855 | Ga0265334_100098553 | 141 |
| 453 | 3300031238 | Ga0265332_10007132 | Ga0265332_100071321 | 141 |
| 454 | 3300031239 | Ga0265328_10021657 | Ga0265328_100216573 | 141 |
| 455 | 3300031250 | Ga0265331_10118034 | Ga0265331_101180342 | 141 |
| 456 | 3300033442 | Ga0315911_1000019 | Ga0315911_100001913 | 141 |
| 457 | 3300034819 | Ga0373958_0046881 | Ga0373958_0046881_59_484 | 141 |
| 458 | 3300035084 | Ga0373928_0017056 | Ga0373928_0017056_905_1330 | 141 |
| 459 | 3300035088 | Ga0373940_0074034 | Ga0373940_0074034_546_971 | 141 |
| 460 | 3300035115 | Ga0373941_0038668 | Ga0373941_0038668_195_620 | 141 |
| 461 | 3300035121 | Ga0373960_0040807 | Ga0373960_0040807_365_790 | 141 |
| 462 | 3300035172 | Ga0373955_0516419 | Ga0373955_0516419_165_590 | 141 |
| 463 | 3300035207 | Ga0373942_0041238 | Ga0373942_0041238_773_1198 | 141 |
| 464 | 3300035691 | Ga0373931_0007699 | Ga0373931_0007699_1764_2189 | 141 |
| 465 | 3300035695 | Ga0373927_0111194 | Ga0373927_0111194_1339_1764 | 141 |
| 466 | 3300035724 | Ga0373933_0616568 | Ga0373933_0616568_260_685 | 141 |
| 467 | 3300035725 | Ga0373947_0363270 | Ga0373947_0363270_190_615 | 141 |
| 468 | 3300036401 | Ga0373937_0095666 | Ga0373937_0095666_1315_1740 | 141 |
| 469 | 3300036401 | Ga0373937_0472755 | Ga0373937_0472755_691_1116 | 141 |
| 470 | 3300037068 | Ga0373925_1130120 | Ga0373925_1130120_140_565 | 141 |
| 471 | 3300037312 | Ga0395899_0073736 | Ga0395899_0073736_1320_1745 | 141 |
| 472 | 3300037312 | Ga0395899_0226227 | Ga0395899_0226227_382_807 | 141 |
| 473 | 3300037418 | Ga0395900_0000696 | Ga0395900_0000696_26112_26558 | 141 |
| 474 | 3300037418 | Ga0395900_0580630 | Ga0395900_0580630_599_1024 | 141 |
| 475 | 3300037466 | Ga0395898_0016802 | Ga0395898_0016802_6967_7413 | 141 |
| 476 | 3300037466 | Ga0395898_0689833 | Ga0395898_0689833_60_485 | 141 |
| 477 | 3300037471 | Ga0395905_0281150 | Ga0395905_0281150_172_597 | 141 |
| 478 | 3300037471 | Ga0395905_1806822 | Ga0395905_1806822_35_481 | 141 |
| 479 | 3300037853 | Ga0436364_0377201 | Ga0436364_0377201_493_921 | 141 |
| 480 | 3300038443 | Ga0395901_0014471 | Ga0395901_0014471_6560_7006 | 141 |
| 481 | 3300038443 | Ga0395901_0077395 | Ga0395901_0077395_1956_2381 | 141 |
| 482 | 3300038443 | Ga0395901_0518625 | Ga0395901_0518625_347_781 | 141 |
| 483 | 3300039437 | Ga0436365_0136133 | Ga0436365_0136133_1392_1820 | 141 |
| 484 | 3300039437 | Ga0436365_1288596 | Ga0436365_1288596_247_675 | 141 |
| 485 | 3300041443 | Ga0451789_0697845 | Ga0451789_0697845_61_621 | 141 |
| 486 | 3300044693 | Ga0466961_0887382 | Ga0466961_0887382_43_471 | 141 |
| 487 | 3300044694 | Ga0466963_0109721 | Ga0466963_0109721_1420_1845 | 141 |
| 488 | 3300044706 | Ga0466964_0125423 | Ga0466964_0125423_399_824 | 141 |
| 489 | 3300044735 | Ga0466968_0282512 | Ga0466968_0282512_261_686 | 141 |
| 490 | 3300044842 | Ga0466957_0115407 | Ga0466957_0115407_1131_1592 | 141 |
| 491 | 3300044842 | Ga0466957_0176265 | Ga0466957_0176265_136_594 | 141 |
| 492 | 3300044842 | Ga0466957_0413652 | Ga0466957_0413652_167_610 | 141 |
| 493 | 3300045049 | Ga0466959_0213911 | Ga0466959_0213911_467_895 | 141 |
| 494 | 3300045976 | Ga0466967_0255739 | Ga0466967_0255739_454_879 | 141 |
| 495 | 3300045976 | Ga0466967_0570664 | Ga0466967_0570664_676_1104 | 141 |
| 496 | 3300046459 | Ga0495629_0289111 | Ga0495629_0289111_156_581 | 141 |
| 497 | 3300046462 | Ga0495651_0463045 | Ga0495651_0463045_222_653 | 141 |
| 498 | 3300046477 | Ga0495664_0319308 | Ga0495664_0319308_57_488 | 141 |
| 499 | 3300046501 | Ga0495607_0100722 | Ga0495607_0100722_644_1069 | 141 |
| 500 | 3300046507 | Ga0495606_0031454 | Ga0495606_0031454_1886_2311 | 141 |
| 501 | 3300046515 | Ga0495620_0058090 | Ga0495620_0058090_174_599 | 141 |
| 502 | 3300046516 | Ga0495628_0089190 | Ga0495628_0089190_1545_1970 | 141 |
| 503 | 3300046524 | Ga0495648_0052628 | Ga0495648_0052628_575_1000 | 141 |
| 504 | 3300046529 | Ga0495652_0123930 | Ga0495652_0123930_836_1261 | 141 |
| 505 | 3300046529 | Ga0495652_0458828 | Ga0495652_0458828_254_679 | 141 |
| 506 | 3300046535 | Ga0495586_0251788 | Ga0495586_0251788_227_652 | 141 |
| 507 | 3300046542 | Ga0495597_0124966 | Ga0495597_0124966_322_747 | 141 |
| 508 | 3300046557 | Ga0495622_0006816 | Ga0495622_0006816_2773_3198 | 141 |
| 509 | 3300046559 | Ga0495667_0087436 | Ga0495667_0087436_1198_1629 | 141 |
| 510 | 3300046616 | Ga0495668_0134556 | Ga0495668_0134556_521_946 | 141 |
| 511 | 3300046642 | Ga0495634_0203795 | Ga0495634_0203795_149_580 | 141 |
| 512 | 3300046660 | Ga0495625_0669550 | Ga0495625_0669550_160_585 | 141 |
| 513 | 3300046665 | Ga0495661_0310283 | Ga0495661_0310283_317_742 | 141 |
| 514 | 3300046674 | Ga0495588_0005975 | Ga0495588_0005975_4623_5048 | 141 |
| 515 | 3300046679 | Ga0495623_0252227 | Ga0495623_0252227_191_616 | 141 |
| 516 | 3300046689 | Ga0495613_0937418 | Ga0495613_0937418_116_547 | 141 |
| 517 | 3300046690 | Ga0495624_0103721 | Ga0495624_0103721_963_1388 | 141 |
| 518 | 3300046690 | Ga0495624_0111161 | Ga0495624_0111161_411_836 | 141 |
| 519 | 3300046692 | Ga0495671_0478180 | Ga0495671_0478180_97_522 | 141 |
| 520 | 3300046809 | Ga0495600_0305428 | Ga0495600_0305428_213_638 | 141 |
| 521 | 3300046809 | Ga0495600_0681432 | Ga0495600_0681432_125_556 | 141 |
| 522 | 3300047315 | Ga0495581_0438448 | Ga0495581_0438448_44_469 | 141 |
| 523 | 3300047317 | Ga0495604_0246443 | Ga0495604_0246443_737_1162 | 141 |
| 524 | 3300047317 | Ga0495604_0312322 | Ga0495604_0312322_318_749 | 141 |
| 525 | 3300047321 | Ga0495676_0425032 | Ga0495676_0425032_229_654 | 141 |
| 526 | 3300047322 | Ga0495680_0089468 | Ga0495680_0089468_168_599 | 141 |
| 527 | 3300047323 | Ga0495683_0069612 | Ga0495683_0069612_553_978 | 141 |
| 528 | 3300047469 | Ga0495673_0116687 | Ga0495673_0116687_74_499 | 141 |
| 529 | 3300047472 | Ga0495686_0097863 | Ga0495686_0097863_1335_1760 | 141 |
| 530 | 3300047472 | Ga0495686_0488498 | Ga0495686_0488498_194_619 | 141 |
| 531 | 3300048088 | Ga0495602_0180667 | Ga0495602_0180667_368_793 | 141 |
| 532 | 3300048088 | Ga0495602_0320032 | Ga0495602_0320032_107_532 | 141 |
| 533 | 3300048903 | Ga0496100_0718102 | Ga0496100_0718102_69_494 | 141 |
| 534 | 3300048904 | Ga0496101_0019887 | Ga0496101_0019887_567_992 | 141 |
| 535 | 3300048904 | Ga0496101_0773193 | Ga0496101_0773193_167_592 | 141 |
| 536 | 3300048906 | Ga0496103_0017706 | Ga0496103_0017706_675_1100 | 141 |
| 537 | 3300048906 | Ga0496103_0487739 | Ga0496103_0487739_188_613 | 141 |
| 538 | 3300048907 | Ga0496104_0029834 | Ga0496104_0029834_1815_2240 | 141 |
| 539 | 3300048907 | Ga0496104_0085298 | Ga0496104_0085298_1413_1838 | 141 |
| 540 | 3300048907 | Ga0496104_0187543 | Ga0496104_0187543_226_651 | 141 |
| 541 | 3300048907 | Ga0496104_0433058 | Ga0496104_0433058_481_906 | 141 |
| 542 | 3300048908 | Ga0496105_0015797 | Ga0496105_0015797_3567_3992 | 141 |
| 543 | 3300048908 | Ga0496105_0051245 | Ga0496105_0051245_2583_3008 | 141 |
| 544 | 3300048908 | Ga0496105_0326930 | Ga0496105_0326930_11_436 | 141 |
| 545 | 3300048909 | Ga0496106_0013613 | Ga0496106_0013613_2593_3018 | 141 |
| 546 | 3300048909 | Ga0496106_0034705 | Ga0496106_0034705_1539_1964 | 141 |
| 547 | 3300048909 | Ga0496106_0115194 | Ga0496106_0115194_1503_1928 | 141 |
| 548 | 3300048909 | Ga0496106_0737333 | Ga0496106_0737333_31_456 | 141 |
| 549 | 3300048909 | Ga0496106_1089059 | Ga0496106_1089059_72_497 | 141 |
| 550 | 3300048910 | Ga0496107_0002239 | Ga0496107_0002239_3516_3941 | 141 |
| 551 | 3300048910 | Ga0496107_0750740 | Ga0496107_0750740_62_487 | 141 |
| 552 | 3300048910 | Ga0496107_0794907 | Ga0496107_0794907_188_613 | 141 |
| 553 | 3300048910 | Ga0496107_0828641 | Ga0496107_0828641_40_465 | 141 |
| 554 | 3300048911 | Ga0496108_0007089 | Ga0496108_0007089_2220_2645 | 141 |
| 555 | 3300048911 | Ga0496108_0042575 | Ga0496108_0042575_2131_2556 | 141 |
| 556 | 3300048911 | Ga0496108_0907341 | Ga0496108_0907341_163_588 | 141 |
| 557 | 3300048912 | Ga0496109_0171217 | Ga0496109_0171217_80_505 | 141 |
| 558 | 3300048912 | Ga0496109_0691728 | Ga0496109_0691728_76_501 | 141 |
| 559 | 3300048913 | Ga0496110_0019982 | Ga0496110_0019982_3280_3705 | 141 |
| 560 | 3300048913 | Ga0496110_0222460 | Ga0496110_0222460_1077_1502 | 141 |
| 561 | 3300048913 | Ga0496110_0259579 | Ga0496110_0259579_385_810 | 141 |
| 562 | 3300048914 | Ga0496111_0033999 | Ga0496111_0033999_2902_3327 | 141 |
| 563 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_479452_479877 | 141 |
| 564 | 3300048915 | Ga0496112_0016426 | Ga0496112_0016426_2857_3282 | 141 |
| 565 | 3300048915 | Ga0496112_0041775 | Ga0496112_0041775_3931_4356 | 141 |
| 566 | 3300048916 | Ga0496113_0087349 | Ga0496113_0087349_1789_2214 | 141 |
| 567 | 3300048916 | Ga0496113_0478955 | Ga0496113_0478955_209_634 | 141 |
| 568 | 3300048916 | Ga0496113_0860176 | Ga0496113_0860176_243_668 | 141 |
| 569 | 3300048916 | Ga0496113_1470146 | Ga0496113_1470146_23_448 | 141 |
| 570 | 3300048917 | Ga0496114_0004928 | Ga0496114_0004928_4502_4927 | 141 |
| 571 | 3300048917 | Ga0496114_0044223 | Ga0496114_0044223_1709_2134 | 141 |
| 572 | 3300048917 | Ga0496114_0401489 | Ga0496114_0401489_376_801 | 141 |
| 573 | 3300048917 | Ga0496114_0452516 | Ga0496114_0452516_197_622 | 141 |
| 574 | 3300048917 | Ga0496114_1653304 | Ga0496114_1653304_14_439 | 141 |
| 575 | 3300048918 | Ga0496115_0005238 | Ga0496115_0005238_3274_3699 | 141 |
| 576 | 3300048919 | Ga0496116_0042244 | Ga0496116_0042244_484_909 | 141 |
| 577 | 3300048919 | Ga0496116_0266202 | Ga0496116_0266202_389_817 | 141 |
| 578 | 3300048920 | Ga0496117_0086414 | Ga0496117_0086414_1462_1887 | 141 |
| 579 | 3300048920 | Ga0496117_0169051 | Ga0496117_0169051_498_926 | 141 |
| 580 | 3300048921 | Ga0496118_0020050 | Ga0496118_0020050_197_625 | 141 |
| 581 | 3300048923 | Ga0496120_0211018 | Ga0496120_0211018_221_646 | 141 |
| 582 | 3300048924 | Ga0496121_0020703 | Ga0496121_0020703_4880_5305 | 141 |
| 583 | 3300048924 | Ga0496121_0038297 | Ga0496121_0038297_1175_1600 | 141 |
| 584 | 3300048924 | Ga0496121_0182096 | Ga0496121_0182096_943_1368 | 141 |
| 585 | 3300048927 | Ga0496124_0413352 | Ga0496124_0413352_442_867 | 141 |
| 586 | 3300048928 | Ga0496125_0313904 | Ga0496125_0313904_160_585 | 141 |
| 587 | 3300048929 | Ga0496126_0085030 | Ga0496126_0085030_245_673 | 141 |
| 588 | 3300048929 | Ga0496126_0555728 | Ga0496126_0555728_202_627 | 141 |
| 589 | 3300049568 | Ga0501031_0016891 | Ga0501031_0016891_1247_1675 | 141 |
| 590 | 3300049568 | Ga0501031_0250116 | Ga0501031_0250116_279_704 | 141 |
| 591 | 3300049568 | Ga0501031_0324483 | Ga0501031_0324483_277_711 | 141 |
| 592 | 3300049569 | Ga0501032_0004084 | Ga0501032_0004084_7944_8372 | 141 |
| 593 | 3300049569 | Ga0501032_0034855 | Ga0501032_0034855_1058_1492 | 141 |
| 594 | 3300049569 | Ga0501032_0050709 | Ga0501032_0050709_1132_1569 | 141 |
| 595 | 3300049569 | Ga0501032_0084741 | Ga0501032_0084741_1181_1606 | 141 |
| 596 | 3300049569 | Ga0501032_0549447 | Ga0501032_0549447_13_447 | 141 |
| 597 | 3300049570 | Ga0501033_0000060 | Ga0501033_0000060_95084_95512 | 141 |
| 598 | 3300049570 | Ga0501033_0025632 | Ga0501033_0025632_2733_3158 | 141 |
| 599 | 3300049570 | Ga0501033_0057020 | Ga0501033_0057020_638_1072 | 141 |
| 600 | 3300049571 | Ga0501034_0000117 | Ga0501034_0000117_129749_130177 | 141 |
| 601 | 3300049571 | Ga0501034_0027174 | Ga0501034_0027174_1607_2032 | 141 |
| 602 | 3300049571 | Ga0501034_0047099 | Ga0501034_0047099_2730_3164 | 141 |
| 603 | 3300049571 | Ga0501034_0508735 | Ga0501034_0508735_399_833 | 141 |
| 604 | 3300049571 | Ga0501034_0545178 | Ga0501034_0545178_374_808 | 141 |
| 605 | 3300049572 | Ga0501036_0000188 | Ga0501036_0000188_17330_17758 | 141 |
| 606 | 3300049572 | Ga0501036_0088879 | Ga0501036_0088879_862_1299 | 141 |
| 607 | 3300049572 | Ga0501036_0208515 | Ga0501036_0208515_361_786 | 141 |
| 608 | 3300049572 | Ga0501036_0210467 | Ga0501036_0210467_542_970 | 141 |
| 609 | 3300049573 | Ga0501037_0000402 | Ga0501037_0000402_12690_13118 | 141 |
| 610 | 3300049573 | Ga0501037_0064879 | Ga0501037_0064879_987_1412 | 141 |
| 611 | 3300049573 | Ga0501037_0094044 | Ga0501037_0094044_1102_1539 | 141 |
| 612 | 3300049573 | Ga0501037_0423010 | Ga0501037_0423010_22_459 | 141 |
| 613 | 3300049574 | Ga0501038_0000540 | Ga0501038_0000540_9517_9945 | 141 |
| 614 | 3300049574 | Ga0501038_0002993 | Ga0501038_0002993_12712_13146 | 141 |
| 615 | 3300049574 | Ga0501038_0032560 | Ga0501038_0032560_3107_3541 | 141 |
| 616 | 3300049574 | Ga0501038_0105152 | Ga0501038_0105152_1424_1849 | 141 |
| 617 | 3300049574 | Ga0501038_0216242 | Ga0501038_0216242_189_617 | 141 |
| 618 | 3300049574 | Ga0501038_0247101 | Ga0501038_0247101_510_947 | 141 |
| 619 | 3300049575 | Ga0501039_0000431 | Ga0501039_0000431_18787_19215 | 141 |
| 620 | 3300049575 | Ga0501039_0146322 | Ga0501039_0146322_629_1066 | 141 |
| 621 | 3300049575 | Ga0501039_0218513 | Ga0501039_0218513_102_536 | 141 |
| 622 | 3300049575 | Ga0501039_0417020 | Ga0501039_0417020_130_564 | 141 |
| 623 | 3300049576 | Ga0501040_0130248 | Ga0501040_0130248_1292_1729 | 141 |
| 624 | 3300049576 | Ga0501040_0192361 | Ga0501040_0192361_465_893 | 141 |
| 625 | 3300049578 | Ga0501042_0025253 | Ga0501042_0025253_1008_1436 | 141 |
| 626 | 3300049578 | Ga0501042_0053024 | Ga0501042_0053024_1852_2289 | 141 |
| 627 | 3300049579 | Ga0501043_0001032 | Ga0501043_0001032_8681_9109 | 141 |
| 628 | 3300049579 | Ga0501043_0018314 | Ga0501043_0018314_206_631 | 141 |
| 629 | 3300049579 | Ga0501043_0023614 | Ga0501043_0023614_616_1053 | 141 |
| 630 | 3300049579 | Ga0501043_0273384 | Ga0501043_0273384_599_1033 | 141 |
| 631 | 3300049580 | Ga0501046_0002670 | Ga0501046_0002670_16117_16545 | 141 |
| 632 | 3300049580 | Ga0501046_0019018 | Ga0501046_0019018_524_961 | 141 |
| 633 | 3300049580 | Ga0501046_0100506 | Ga0501046_0100506_502_927 | 141 |
| 634 | 3300049580 | Ga0501046_0443497 | Ga0501046_0443497_444_878 | 141 |
| 635 | 3300049581 | Ga0501047_0000246 | Ga0501047_0000246_14616_15044 | 141 |
| 636 | 3300049581 | Ga0501047_0022391 | Ga0501047_0022391_1175_1600 | 141 |
| 637 | 3300049581 | Ga0501047_0112133 | Ga0501047_0112133_897_1331 | 141 |
| 638 | 3300049581 | Ga0501047_0337561 | Ga0501047_0337561_242_676 | 141 |
| 639 | 3300049582 | Ga0501048_0000878 | Ga0501048_0000878_4039_4467 | 141 |
| 640 | 3300049583 | Ga0501067_0000320 | Ga0501067_0000320_4196_4624 | 141 |
| 641 | 3300049584 | Ga0501068_0004312 | Ga0501068_0004312_4670_5098 | 141 |
| 642 | 3300049584 | Ga0501068_0007826 | Ga0501068_0007826_965_1402 | 141 |
| 643 | 3300049585 | Ga0501069_0003261 | Ga0501069_0003261_2789_3217 | 141 |
| 644 | 3300049586 | Ga0501070_0000779 | Ga0501070_0000779_25478_25906 | 141 |
| 645 | 3300049587 | Ga0501071_0119341 | Ga0501071_0119341_633_1061 | 141 |
| 646 | 3300049588 | Ga0501072_0241226 | Ga0501072_0241226_421_858 | 141 |
| 647 | 3300049588 | Ga0501072_0263340 | Ga0501072_0263340_247_675 | 141 |
| 648 | 3300049588 | Ga0501072_0285821 | Ga0501072_0285821_844_1272 | 141 |
| 649 | 3300049589 | Ga0501073_0000093 | Ga0501073_0000093_42621_43049 | 141 |
| 650 | 3300049590 | Ga0501074_0000127 | Ga0501074_0000127_23108_23536 | 141 |
| 651 | 3300049590 | Ga0501074_0373520 | Ga0501074_0373520_179_616 | 141 |
| 652 | 3300049592 | Ga0501076_0177507 | Ga0501076_0177507_1017_1445 | 141 |
| 653 | 3300049592 | Ga0501076_1079084 | Ga0501076_1079084_103_540 | 141 |
| 654 | 3300049593 | Ga0501077_0202273 | Ga0501077_0202273_648_1085 | 141 |
| 655 | 3300049741 | Ga0501079_0013697 | Ga0501079_0013697_3211_3639 | 141 |
| 656 | 3300049741 | Ga0501079_0046768 | Ga0501079_0046768_451_888 | 141 |
| 657 | 3300049742 | Ga0501080_0001845 | Ga0501080_0001845_13058_13486 | 141 |
| 658 | 3300049742 | Ga0501080_0055276 | Ga0501080_0055276_1175_1612 | 141 |
| 659 | 3300049742 | Ga0501080_0179782 | Ga0501080_0179782_138_572 | 141 |
| 660 | 3300049744 | Ga0501083_0004463 | Ga0501083_0004463_6719_7147 | 141 |
| 661 | 3300049744 | Ga0501083_0018238 | Ga0501083_0018238_536_973 | 141 |
| 662 | 3300049744 | Ga0501083_0171879 | Ga0501083_0171879_601_1026 | 141 |
| 663 | 3300049822 | Ga0501035_0000798 | Ga0501035_0000798_17332_17760 | 141 |
| 664 | 3300049822 | Ga0501035_0009234 | Ga0501035_0009234_4477_4902 | 141 |
| 665 | 3300049822 | Ga0501035_0165102 | Ga0501035_0165102_259_696 | 141 |
| 666 | 3300049822 | Ga0501035_0245458 | Ga0501035_0245458_444_872 | 141 |
| 667 | 3300049822 | Ga0501035_0292094 | Ga0501035_0292094_461_898 | 141 |
| 668 | 3300049823 | Ga0501044_0001581 | Ga0501044_0001581_16640_17068 | 141 |
| 669 | 3300049823 | Ga0501044_0018220 | Ga0501044_0018220_4346_4780 | 141 |
| 670 | 3300049823 | Ga0501044_0039565 | Ga0501044_0039565_3319_3744 | 141 |
| 671 | 3300049823 | Ga0501044_0621452 | Ga0501044_0621452_121_555 | 141 |
| 672 | 3300049824 | Ga0501045_0012744 | Ga0501045_0012744_5182_5610 | 141 |
| 673 | 3300049824 | Ga0501045_0161957 | Ga0501045_0161957_541_978 | 141 |
| 674 | 3300049824 | Ga0501045_0737620 | Ga0501045_0737620_118_555 | 141 |
| 675 | 3300050490 | nmdc:mga03n38_51576_c1 | nmdc:mga03n38_51576_c1_878_1303 | 141 |
| 676 | 3300050491 | nmdc:mga00v17_96973_c1 | nmdc:mga00v17_96973_c1_1099_1524 | 141 |
| 677 | 3300050492 | nmdc:mga0yw44_16739_c1 | nmdc:mga0yw44_16739_c1_3235_3669 | 141 |
| 678 | 3300050492 | nmdc:mga0yw44_55099_c1 | nmdc:mga0yw44_55099_c1_1416_1841 | 141 |
| 679 | 3300050493 | nmdc:mga0k408_385866_c1 | nmdc:mga0k408_385866_c1_302_727 | 141 |
| 680 | 3300050494 | nmdc:mga06z11_220546_c1 | nmdc:mga06z11_220546_c1_370_804 | 141 |
| 681 | 3300050494 | nmdc:mga06z11_777982_c1 | nmdc:mga06z11_777982_c1_46_564 | 141 |
| 682 | 3300050495 | nmdc:mga04h51_12432_c1 | nmdc:mga04h51_12432_c1_1302_1727 | 141 |
| 683 | 3300050495 | nmdc:mga04h51_58265_c1 | nmdc:mga04h51_58265_c1_81_515 | 141 |
| 684 | 3300050496 | nmdc:mga07m45_462860_c1 | nmdc:mga07m45_462860_c1_140_565 | 141 |
| 685 | 3300050496 | nmdc:mga07m45_50497_c1 | nmdc:mga07m45_50497_c1_507_932 | 141 |
| 686 | 3300050511 | nmdc:mga08y16_830837_c1 | nmdc:mga08y16_830837_c1_250_675 | 141 |
| 687 | 3300050512 | nmdc:mga0n895_395533_c1 | nmdc:mga0n895_395533_c1_923_1348 | 141 |
| 688 | 3300050512 | nmdc:mga0n895_46805_c1 | nmdc:mga0n895_46805_c1_1263_1694 | 141 |
| 689 | 3300050515 | nmdc:mga0a205_1186142_c1 | nmdc:mga0a205_1186142_c1_80_505 | 141 |
| 690 | 3300050516 | nmdc:mga0sz30_118129_c1 | nmdc:mga0sz30_118129_c1_57_482 | 141 |
| 691 | 3300050516 | nmdc:mga0sz30_130189_c1 | nmdc:mga0sz30_130189_c1_11_445 | 141 |
| 692 | 3300050516 | nmdc:mga0sz30_178087_c1 | nmdc:mga0sz30_178087_c1_278_703 | 141 |
| 693 | 3300053077 | Ga0495601_0195030 | Ga0495601_0195030_495_923 | 141 |
| 694 | 3300053077 | Ga0495601_0304960 | Ga0495601_0304960_437_862 | 141 |
| 695 | 3300053077 | Ga0495601_0666579 | Ga0495601_0666579_179_610 | 141 |
| 696 | 3300053085 | Ga0495619_0045567 | Ga0495619_0045567_761_1186 | 141 |
| 697 | 3300053101 | Ga0500553_243484 | Ga0500553_243484_98_523 | 141 |
| 698 | 3300053119 | Ga0500595_017221 | Ga0500595_017221_2035_2460 | 141 |
| 699 | 3300053177 | Ga0500636_0217595 | Ga0500636_0217595_193_618 | 141 |
| 700 | 3300054114 | Ga0501084_0000963 | Ga0501084_0000963_12593_13021 | 141 |
| 701 | 3300060353 | Ga0501082_0002692 | Ga0501082_0002692_7164_7592 | 141 |
| 702 | 3300060353 | Ga0501082_0152367 | Ga0501082_0152367_890_1327 | 141 |
| 703 | 3300061719 | Ga0466962_0023059 | Ga0466962_0023059_1351_1776 | 141 |
| 704 | iso_pu_bacteria | 2524023205 | 2524440043 | 141 |
| 705 | iso_pu_bacteria | 2885374607 | 2885379798 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lb5-assembly1.cif.gz_B | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.8762 | 2 | 138 |
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.8654 | 3 | 138 |
| 3lb5-assembly1.cif.gz_B | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.8639 | 2 | 138 |
| 3lb5-assembly2.cif.gz_C | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.8554 | 2 | 138 |
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.853 | 3 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8853 | 22 | 107 | 3.30.428.10 |
| af_P49775_3_108_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.879 | 22 | 106 | 3.30.428.10 |
| 1y23D01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8742 | 7 | 104 | 3.30.428.10 |
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.8654 | 3 | 138 | 3.30.428.10 |
| 3lb5A00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.853 | 3 | 138 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G1HG29-F1-model_v4 | Histidine triad (HIT) protein | 0.9392 | 5 | 89 |
GO:0003824
GO:0009117 |
| AF-A0A7U6KQ42-F1-model_v4 | HIT domain-containing protein | 0.919 | 2 | 86 |
GO:0003824
GO:0009117 |
| AF-A0A7C2WB85-F1-model_v4 | HIT family protein | 0.9044 | 6 | 114 |
GO:0003824
GO:0009117 |
| AF-A5UQ73-F1-model_v4 | Histidine triad (HIT) protein | 0.8959 | 20 | 106 |
GO:0003824
|
| AF-A0A0L0LFD5-F1-model_v4 | Histidine triad (HIT) protein | 0.8922 | 2 | 111 |
GO:0003824
GO:0009117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar