F476353
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 376 | 704 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10185834|Ga0157380_101858342 |
| Length | 345 |
| Sequence | VSGLIVIGQSFGNDFNISGARMAADALQFWASSKEAPMANARGLIAVDKMGTKVLFLNPVTYETEVVLDGFDKTVHELLVMPEISRAYVPIFGDGIHGRNPNPQHWLCVFDLEKRALLTTIDLRPYIAPHTLKLAPDGLIYITCENSAKVVAIDPKTNTVVGAIDSGSTNGHRLIISPDGKRLYTENEEDGTVSVIDLPMRKLLGKIKTPRPLAGIAISADGRTVVAVDDAEPTLFLLDAEAGQVRQEVRLKDVPKAAQIARYAPDNSLIGVTSLNSDTVSLIDPSFREKTAIKVGNQPMDMAFHGDELFVPCQGDGSVHVIDIPNKRHKTSFSAGKGCESLAFY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 19 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 20 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 93 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 96 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 142 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 227 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 228 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 230 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 231 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 233 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 236 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 237 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 251 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 252 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 257 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 259 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 260 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 267 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 268 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 269 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 272 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 273 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 328 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 332 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 333 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 339 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 340 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0.14 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 7.1 |
| Rhizosphere | 91.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214745219 | 2209111006 | Bacteria | 14065 |
| 2 | ARSoilYngRDRAFT_c00268 | 3300000042 | Bacteria | 7919 |
| 3 | ARcpr5yngRDRAFT_c000083 | 3300000043 | Bacteria | 15543 |
| 4 | ARcpr5yngRDRAFT_c000130 | 3300000043 | Bacteria | 11824 |
| 5 | ARSoilOldRDRAFT_c000077 | 3300000044 | Bacteria | 18706 |
| 6 | ARCol0yngRDRAFT_1000003 | 3300000652 | Bacteria | 53041 |
| 7 | JGI24741J21665_1010919 | 3300001915 | Bacteria | 1606 |
| 8 | JGI24746J21847_1000172 | 3300001977 | Bacteria | 8495 |
| 9 | JGI24739J22299_10002161 | 3300001989 | Bacteria | 7538 |
| 10 | JGI24737J22298_10002605 | 3300001990 | Bacteria | 6382 |
| 11 | JGI24737J22298_10004159 | 3300001990 | Bacteria | 5058 |
| 12 | JGI24750J21931_1000256 | 3300002070 | Bacteria | 9041 |
| 13 | JGI24745J21846_1008664 | 3300002073 | Bacteria | 1148 |
| 14 | JGI24748J21848_1000381 | 3300002074 | Bacteria | 5024 |
| 15 | JGI24738J21930_10000425 | 3300002075 | Bacteria | 11873 |
| 16 | JGI24749J21850_1001974 | 3300002076 | Bacteria | 2897 |
| 17 | JGI24035J26624_1000008 | 3300002126 | Bacteria | 13965 |
| 18 | JGI24035J26624_1000030 | 3300002126 | Bacteria | 10265 |
| 19 | JGI24751J29686_10005576 | 3300002459 | Bacteria | 2563 |
| 20 | JGI25406J46586_10024660 | 3300003203 | Bacteria | 2352 |
| 21 | JGI26145J50221_1002475 | 3300003371 | Bacteria | 1454 |
| 22 | JGI25405J52794_10033288 | 3300003911 | Bacteria | 1075 |
| 23 | Ga0065716_1001562 | 3300005277 | Bacteria | 6533 |
| 24 | Ga0065704_10079631 | 3300005289 | Bacteria | 4090 |
| 25 | Ga0065712_10000247 | 3300005290 | Bacteria | 16703 |
| 26 | Ga0065712_10069581 | 3300005290 | Bacteria | 7025 |
| 27 | Ga0065715_10090800 | 3300005293 | Bacteria | 6445 |
| 28 | Ga0070658_10132885 | 3300005327 | Bacteria | 2075 |
| 29 | Ga0070676_10000036 | 3300005328 | Bacteria | 40368 |
| 30 | Ga0070676_10020980 | 3300005328 | Bacteria | 3655 |
| 31 | Ga0070683_100002049 | 3300005329 | Bacteria | 15883 |
| 32 | Ga0070683_100285309 | 3300005329 | Bacteria | 1571 |
| 33 | Ga0070690_100001849 | 3300005330 | Bacteria | 11234 |
| 34 | Ga0070670_100003778 | 3300005331 | Bacteria | 12606 |
| 35 | Ga0070677_10000104 | 3300005333 | Bacteria | 27953 |
| 36 | Ga0068869_100000087 | 3300005334 | Bacteria | 42211 |
| 37 | Ga0068869_100235469 | 3300005334 | Bacteria | 1457 |
| 38 | Ga0070680_100003276 | 3300005336 | Bacteria | 12068 |
| 39 | Ga0070680_100105591 | 3300005336 | Bacteria | 2341 |
| 40 | Ga0070682_100000341 | 3300005337 | Bacteria | 32124 |
| 41 | Ga0068868_100025389 | 3300005338 | Bacteria | 4508 |
| 42 | Ga0070660_100006206 | 3300005339 | Bacteria | 8272 |
| 43 | Ga0070660_100084732 | 3300005339 | Bacteria | 2491 |
| 44 | Ga0070660_100198860 | 3300005339 | Bacteria | 1625 |
| 45 | Ga0070689_100000963 | 3300005340 | Bacteria | 17950 |
| 46 | Ga0070689_100002790 | 3300005340 | Bacteria | 11470 |
| 47 | Ga0070691_10000518 | 3300005341 | Bacteria | 14537 |
| 48 | Ga0070691_10060275 | 3300005341 | Bacteria | 1824 |
| 49 | Ga0070687_100000245 | 3300005343 | Bacteria | 18566 |
| 50 | Ga0070687_100017541 | 3300005343 | Bacteria | 3294 |
| 51 | Ga0070687_100078543 | 3300005343 | Bacteria | 1794 |
| 52 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 53 | Ga0070661_100230987 | 3300005344 | Bacteria | 1422 |
| 54 | Ga0070692_10003367 | 3300005345 | Bacteria | 6470 |
| 55 | Ga0070692_10003914 | 3300005345 | Bacteria | 6140 |
| 56 | Ga0070668_100001356 | 3300005347 | Bacteria | 17522 |
| 57 | Ga0070668_100096942 | 3300005347 | Bacteria | 2331 |
| 58 | Ga0070669_100000217 | 3300005353 | Bacteria | 47833 |
| 59 | Ga0070669_100038543 | 3300005353 | Bacteria | 3470 |
| 60 | Ga0070675_100000088 | 3300005354 | Bacteria | 53698 |
| 61 | Ga0070675_100495057 | 3300005354 | Bacteria | 1101 |
| 62 | Ga0070671_100000768 | 3300005355 | Bacteria | 23064 |
| 63 | Ga0070671_100100518 | 3300005355 | Bacteria | 2427 |
| 64 | Ga0070674_100000623 | 3300005356 | Bacteria | 17847 |
| 65 | Ga0070673_100000239 | 3300005364 | Bacteria | 27611 |
| 66 | Ga0070688_100000084 | 3300005365 | Bacteria | 47194 |
| 67 | Ga0070688_100193923 | 3300005365 | Bacteria | 1417 |
| 68 | Ga0070688_100255013 | 3300005365 | Bacteria | 1250 |
| 69 | Ga0070659_100000252 | 3300005366 | Bacteria | 42278 |
| 70 | Ga0070659_100122428 | 3300005366 | Bacteria | 2108 |
| 71 | Ga0070667_100003023 | 3300005367 | Bacteria | 14455 |
| 72 | Ga0070709_10010014 | 3300005434 | Bacteria | 5239 |
| 73 | Ga0070709_10047656 | 3300005434 | Bacteria | 2670 |
| 74 | Ga0070714_100114788 | 3300005435 | Bacteria | 2389 |
| 75 | Ga0070713_100002359 | 3300005436 | Bacteria | 12318 |
| 76 | Ga0070713_100087274 | 3300005436 | Bacteria | 2676 |
| 77 | Ga0070713_100088931 | 3300005436 | Bacteria | 2652 |
| 78 | Ga0070713_100111681 | 3300005436 | Bacteria | 2384 |
| 79 | Ga0070710_10208523 | 3300005437 | Bacteria | 1238 |
| 80 | Ga0070701_10010531 | 3300005438 | Bacteria | 4091 |
| 81 | Ga0070701_10026873 | 3300005438 | Bacteria | 2812 |
| 82 | Ga0070711_100048327 | 3300005439 | Bacteria | 2908 |
| 83 | Ga0070711_100091039 | 3300005439 | Bacteria | 2198 |
| 84 | Ga0070711_100093628 | 3300005439 | Unclassified | 2170 |
| 85 | Ga0070711_100289900 | 3300005439 | Unclassified | 1298 |
| 86 | Ga0070705_100000425 | 3300005440 | Bacteria | 24231 |
| 87 | Ga0070705_100036888 | 3300005440 | Bacteria | 2752 |
| 88 | Ga0070700_100000370 | 3300005441 | Bacteria | 23064 |
| 89 | Ga0070700_100260020 | 3300005441 | Bacteria | 1250 |
| 90 | Ga0070694_100000401 | 3300005444 | Bacteria | 23534 |
| 91 | Ga0070694_100097071 | 3300005444 | Bacteria | 2078 |
| 92 | Ga0070708_100004439 | 3300005445 | Bacteria | 11027 |
| 93 | Ga0070708_100098455 | 3300005445 | Bacteria | 2674 |
| 94 | Ga0070663_100000415 | 3300005455 | Bacteria | 22408 |
| 95 | Ga0070678_100000053 | 3300005456 | Bacteria | 40418 |
| 96 | Ga0070662_100003931 | 3300005457 | Bacteria | 9321 |
| 97 | Ga0070662_100146016 | 3300005457 | Bacteria | 1838 |
| 98 | Ga0070681_10000493 | 3300005458 | Bacteria | 32198 |
| 99 | Ga0070681_10004194 | 3300005458 | Bacteria | 13656 |
| 100 | Ga0070681_10326374 | 3300005458 | Bacteria | 1444 |
| 101 | Ga0070681_10436233 | 3300005458 | Unclassified | 1222 |
| 102 | Ga0068867_100001581 | 3300005459 | Bacteria | 15837 |
| 103 | Ga0070685_10012006 | 3300005466 | Bacteria | 4541 |
| 104 | Ga0070679_100000679 | 3300005530 | Bacteria | 29087 |
| 105 | Ga0070679_100009527 | 3300005530 | Bacteria | 9187 |
| 106 | Ga0070679_100112073 | 3300005530 | Bacteria | 2714 |
| 107 | Ga0070679_100144710 | 3300005530 | Bacteria | 2355 |
| 108 | Ga0070684_100000144 | 3300005535 | Bacteria | 47665 |
| 109 | Ga0068853_100005864 | 3300005539 | Bacteria | 9680 |
| 110 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 111 | Ga0070672_100121769 | 3300005543 | Bacteria | 2136 |
| 112 | Ga0070686_100000754 | 3300005544 | Bacteria | 18754 |
| 113 | Ga0070686_100022707 | 3300005544 | Bacteria | 3740 |
| 114 | Ga0070695_100000743 | 3300005545 | Bacteria | 17429 |
| 115 | Ga0070696_100000918 | 3300005546 | Bacteria | 19157 |
| 116 | Ga0070696_100073748 | 3300005546 | Bacteria | 2405 |
| 117 | Ga0070693_100000141 | 3300005547 | Bacteria | 32426 |
| 118 | Ga0070665_100294999 | 3300005548 | Bacteria | 1624 |
| 119 | Ga0070704_100064769 | 3300005549 | Bacteria | 2628 |
| 120 | Ga0070704_100096887 | 3300005549 | Bacteria | 2212 |
| 121 | Ga0068855_100009106 | 3300005563 | Bacteria | 11994 |
| 122 | Ga0068855_100108304 | 3300005563 | Bacteria | 3191 |
| 123 | Ga0070664_100000816 | 3300005564 | Bacteria | 23970 |
| 124 | Ga0070664_100053558 | 3300005564 | Bacteria | 3420 |
| 125 | Ga0068857_100000567 | 3300005577 | Bacteria | 26993 |
| 126 | Ga0068854_100000168 | 3300005578 | Bacteria | 44522 |
| 127 | Ga0068856_100143631 | 3300005614 | Bacteria | 2394 |
| 128 | Ga0070702_100000857 | 3300005615 | Bacteria | 11750 |
| 129 | Ga0068852_100002066 | 3300005616 | Bacteria | 13707 |
| 130 | Ga0068852_100052192 | 3300005616 | Bacteria | 3513 |
| 131 | Ga0068859_100012990 | 3300005617 | Bacteria | 8367 |
| 132 | Ga0068859_100162636 | 3300005617 | Bacteria | 2311 |
| 133 | Ga0068859_100247647 | 3300005617 | Bacteria | 1872 |
| 134 | Ga0068864_100000980 | 3300005618 | Bacteria | 23924 |
| 135 | Ga0068866_10000264 | 3300005718 | Bacteria | 24776 |
| 136 | Ga0068861_100000315 | 3300005719 | Bacteria | 27094 |
| 137 | Ga0068861_100395829 | 3300005719 | Bacteria | 1224 |
| 138 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 139 | Ga0068863_100001290 | 3300005841 | Bacteria | 25007 |
| 140 | Ga0068858_100000356 | 3300005842 | Bacteria | 48189 |
| 141 | Ga0068858_100150298 | 3300005842 | Bacteria | 2190 |
| 142 | Ga0068860_100000747 | 3300005843 | Bacteria | 36976 |
| 143 | Ga0068860_100138100 | 3300005843 | Bacteria | 2341 |
| 144 | Ga0068860_100379873 | 3300005843 | Bacteria | 1394 |
| 145 | Ga0068862_100002002 | 3300005844 | Bacteria | 18476 |
| 146 | Ga0068862_100346524 | 3300005844 | Unclassified | 1377 |
| 147 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 148 | Ga0081455_10000369 | 3300005937 | Bacteria | 59441 |
| 149 | Ga0081455_10016383 | 3300005937 | Bacteria | 7159 |
| 150 | Ga0081540_1006164 | 3300005983 | Bacteria | 8795 |
| 151 | Ga0081539_10002225 | 3300005985 | Bacteria | 28285 |
| 152 | Ga0070717_10009878 | 3300006028 | Bacteria | 7187 |
| 153 | Ga0070717_10093129 | 3300006028 | Bacteria | 2546 |
| 154 | Ga0070717_10167220 | 3300006028 | Unclassified | 1911 |
| 155 | Ga0075365_10225635 | 3300006038 | Bacteria | 1314 |
| 156 | Ga0070715_10000513 | 3300006163 | Bacteria | 10119 |
| 157 | Ga0070716_100056116 | 3300006173 | Bacteria | 2257 |
| 158 | Ga0070716_100121550 | 3300006173 | Bacteria | 1635 |
| 159 | Ga0070712_100029497 | 3300006175 | Bacteria | 3678 |
| 160 | Ga0070712_100081098 | 3300006175 | Bacteria | 2350 |
| 161 | Ga0070712_100178419 | 3300006175 | Bacteria | 1653 |
| 162 | Ga0075367_10012917 | 3300006178 | Bacteria | 4474 |
| 163 | Ga0097621_100000144 | 3300006237 | Bacteria | 43169 |
| 164 | Ga0068871_100000110 | 3300006358 | Bacteria | 49756 |
| 165 | Ga0075428_100084138 | 3300006844 | Bacteria | 3471 |
| 166 | Ga0075430_100094974 | 3300006846 | Bacteria | 2492 |
| 167 | Ga0075431_100115216 | 3300006847 | Bacteria | 2774 |
| 168 | Ga0075433_10026099 | 3300006852 | Bacteria | 4942 |
| 169 | Ga0075433_10133112 | 3300006852 | Bacteria | 2209 |
| 170 | Ga0075434_100000084 | 3300006871 | Bacteria | 50928 |
| 171 | Ga0075434_100043477 | 3300006871 | Unclassified | 4456 |
| 172 | Ga0075434_100053336 | 3300006871 | Bacteria | 4018 |
| 173 | Ga0075434_100057142 | 3300006871 | Unclassified | 3878 |
| 174 | Ga0075434_100145571 | 3300006871 | Bacteria | 2390 |
| 175 | Ga0075434_100359687 | 3300006871 | Bacteria | 1477 |
| 176 | Ga0068865_100000066 | 3300006881 | Bacteria | 54564 |
| 177 | Ga0068865_100078367 | 3300006881 | Bacteria | 2363 |
| 178 | Ga0075436_100012722 | 3300006914 | Bacteria | 5768 |
| 179 | Ga0097620_100012990 | 3300006931 | Bacteria | 8367 |
| 180 | Ga0097620_100162629 | 3300006931 | Bacteria | 2311 |
| 181 | Ga0097620_100247649 | 3300006931 | Bacteria | 1872 |
| 182 | Ga0075435_100028540 | 3300007076 | Bacteria | 4377 |
| 183 | Ga0075435_100077114 | 3300007076 | Bacteria | 2732 |
| 184 | Ga0075435_100281005 | 3300007076 | Bacteria | 1421 |
| 185 | Ga0099794_10038178 | 3300007265 | Bacteria | 2275 |
| 186 | Ga0105240_10408797 | 3300009093 | Bacteria | 1527 |
| 187 | Ga0111539_10000652 | 3300009094 | Bacteria | 44828 |
| 188 | Ga0111539_10001255 | 3300009094 | Bacteria | 33804 |
| 189 | Ga0111539_10030559 | 3300009094 | Bacteria | 6546 |
| 190 | Ga0111539_10515911 | 3300009094 | Unclassified | 1392 |
| 191 | Ga0105245_10000287 | 3300009098 | Bacteria | 48204 |
| 192 | Ga0105247_10001223 | 3300009101 | Bacteria | 19057 |
| 193 | Ga0105247_10120013 | 3300009101 | Bacteria | 1702 |
| 194 | Ga0114129_10092448 | 3300009147 | Unclassified | 4191 |
| 195 | Ga0105243_10000695 | 3300009148 | Bacteria | 32613 |
| 196 | Ga0105243_10053738 | 3300009148 | Bacteria | 3196 |
| 197 | Ga0105241_10002331 | 3300009174 | Bacteria | 14262 |
| 198 | Ga0105241_10106605 | 3300009174 | Bacteria | 2237 |
| 199 | Ga0105242_10000792 | 3300009176 | Bacteria | 24525 |
| 200 | Ga0105248_10000535 | 3300009177 | Bacteria | 43210 |
| 201 | Ga0105237_10002795 | 3300009545 | Bacteria | 21203 |
| 202 | Ga0105238_10181825 | 3300009551 | Bacteria | 2079 |
| 203 | Ga0105249_10000279 | 3300009553 | Bacteria | 53594 |
| 204 | Ga0105249_10003839 | 3300009553 | Bacteria | 12962 |
| 205 | Ga0105249_10018980 | 3300009553 | Bacteria | 6131 |
| 206 | Ga0105249_10441238 | 3300009553 | Bacteria | 1339 |
| 207 | Ga0099796_10004966 | 3300010159 | Bacteria | 3276 |
| 208 | Ga0105239_10001686 | 3300010375 | Bacteria | 29130 |
| 209 | Ga0105246_10000095 | 3300011119 | Bacteria | 38417 |
| 210 | Ga0105246_10302262 | 3300011119 | Bacteria | 1292 |
| 211 | Ga0157373_10050116 | 3300013100 | Bacteria | 2974 |
| 212 | Ga0157373_10062875 | 3300013100 | Bacteria | 2629 |
| 213 | Ga0157371_10148569 | 3300013102 | Bacteria | 1671 |
| 214 | Ga0157374_10001348 | 3300013296 | Bacteria | 20895 |
| 215 | Ga0157378_10000956 | 3300013297 | Bacteria | 26502 |
| 216 | Ga0163162_10003795 | 3300013306 | Bacteria | 14493 |
| 217 | Ga0163162_10042395 | 3300013306 | Bacteria | 4555 |
| 218 | Ga0163162_10147815 | 3300013306 | Bacteria | 2467 |
| 219 | Ga0163162_10354099 | 3300013306 | Bacteria | 1601 |
| 220 | Ga0157372_10445281 | 3300013307 | Bacteria | 1510 |
| 221 | Ga0157372_10639429 | 3300013307 | Bacteria | 1239 |
| 222 | Ga0157375_10001973 | 3300013308 | Bacteria | 17692 |
| 223 | Ga0163163_10055839 | 3300014325 | Bacteria | 3903 |
| 224 | Ga0163163_10187980 | 3300014325 | Bacteria | 2114 |
| 225 | Ga0157380_10000052 | 3300014326 | Bacteria | 67030 |
| 226 | Ga0157380_10185834 | 3300014326 | Bacteria | 1830 |
| 227 | Ga0157380_10189714 | 3300014326 | Bacteria | 1813 |
| 228 | Ga0157380_10252784 | 3300014326 | Bacteria | 1596 |
| 229 | Ga0157380_10537572 | 3300014326 | Bacteria | 1144 |
| 230 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 231 | Ga0157379_10000060 | 3300014968 | Bacteria | 69312 |
| 232 | Ga0157379_10364183 | 3300014968 | Bacteria | 1325 |
| 233 | Ga0157379_10432425 | 3300014968 | Bacteria | 1213 |
| 234 | Ga0157376_10000141 | 3300014969 | Bacteria | 49288 |
| 235 | Ga0163161_10000739 | 3300017792 | Bacteria | 25660 |
| 236 | Ga0163161_10067121 | 3300017792 | Bacteria | 2620 |
| 237 | Ga0163161_10206041 | 3300017792 | Bacteria | 1517 |
| 238 | Ga0213876_10044059 | 3300021384 | Bacteria | 2358 |
| 239 | Ga0213876_10062025 | 3300021384 | Bacteria | 1973 |
| 240 | Ga0213871_10003427 | 3300021441 | Bacteria | 3054 |
| 241 | Ga0207666_1000005 | 3300025271 | Bacteria | 54011 |
| 242 | Ga0207673_1007698 | 3300025290 | Bacteria | 1354 |
| 243 | Ga0209758_1000569 | 3300025297 | Bacteria | 57936 |
| 244 | Ga0209758_1040673 | 3300025297 | Bacteria | 1750 |
| 245 | Ga0207697_10000011 | 3300025315 | Bacteria | 65035 |
| 246 | Ga0207682_10000051 | 3300025893 | Bacteria | 49249 |
| 247 | Ga0207692_10235758 | 3300025898 | Bacteria | 1091 |
| 248 | Ga0207642_10000176 | 3300025899 | Bacteria | 18394 |
| 249 | Ga0207710_10001284 | 3300025900 | Bacteria | 12696 |
| 250 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 251 | Ga0207680_10002846 | 3300025903 | Bacteria | 8110 |
| 252 | Ga0207647_10001714 | 3300025904 | Bacteria | 16833 |
| 253 | Ga0207647_10037247 | 3300025904 | Bacteria | 3085 |
| 254 | Ga0207699_10008926 | 3300025906 | Bacteria | 4970 |
| 255 | Ga0207699_10088943 | 3300025906 | Unclassified | 1934 |
| 256 | Ga0207699_10269612 | 3300025906 | Bacteria | 1179 |
| 257 | Ga0207699_10345010 | 3300025906 | Unclassified | 1050 |
| 258 | Ga0207645_10000121 | 3300025907 | Bacteria | 58999 |
| 259 | Ga0207645_10023007 | 3300025907 | Bacteria | 4050 |
| 260 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 261 | Ga0207654_10001894 | 3300025911 | Bacteria | 10849 |
| 262 | Ga0207707_10000840 | 3300025912 | Bacteria | 30189 |
| 263 | Ga0207707_10145090 | 3300025912 | Bacteria | 2075 |
| 264 | Ga0207695_10168202 | 3300025913 | Bacteria | 2119 |
| 265 | Ga0207671_10007485 | 3300025914 | Bacteria | 9471 |
| 266 | Ga0207693_10009486 | 3300025915 | Bacteria | 7926 |
| 267 | Ga0207693_10016164 | 3300025915 | Bacteria | 5968 |
| 268 | Ga0207693_10086779 | 3300025915 | Bacteria | 2452 |
| 269 | Ga0207693_10187356 | 3300025915 | Bacteria | 1628 |
| 270 | Ga0207693_10314300 | 3300025915 | Bacteria | 1226 |
| 271 | Ga0207660_10000775 | 3300025917 | Bacteria | 21240 |
| 272 | Ga0207660_10018073 | 3300025917 | Bacteria | 4696 |
| 273 | Ga0207660_10028511 | 3300025917 | Bacteria | 3819 |
| 274 | Ga0207660_10115673 | 3300025917 | Bacteria | 2025 |
| 275 | Ga0207662_10004796 | 3300025918 | Bacteria | 7148 |
| 276 | Ga0207662_10036635 | 3300025918 | Bacteria | 2868 |
| 277 | Ga0207662_10085916 | 3300025918 | Bacteria | 1927 |
| 278 | Ga0207657_10002826 | 3300025919 | Bacteria | 18663 |
| 279 | Ga0207657_10058352 | 3300025919 | Bacteria | 3321 |
| 280 | Ga0207657_10194924 | 3300025919 | Bacteria | 1632 |
| 281 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 282 | Ga0207652_10000508 | 3300025921 | Bacteria | 39568 |
| 283 | Ga0207652_10077681 | 3300025921 | Bacteria | 2897 |
| 284 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 285 | Ga0207681_10091313 | 3300025923 | Bacteria | 2175 |
| 286 | Ga0207694_10304962 | 3300025924 | Bacteria | 1312 |
| 287 | Ga0207650_10000843 | 3300025925 | Bacteria | 23231 |
| 288 | Ga0207650_10299777 | 3300025925 | Bacteria | 1312 |
| 289 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 290 | Ga0207659_10080425 | 3300025926 | Bacteria | 2407 |
| 291 | Ga0207687_10000231 | 3300025927 | Bacteria | 38087 |
| 292 | Ga0207700_10056459 | 3300025928 | Bacteria | 2956 |
| 293 | Ga0207700_10103773 | 3300025928 | Bacteria | 2273 |
| 294 | Ga0207700_10113292 | 3300025928 | Bacteria | 2187 |
| 295 | Ga0207664_10135847 | 3300025929 | Bacteria | 2075 |
| 296 | Ga0207664_10447261 | 3300025929 | Bacteria | 1153 |
| 297 | Ga0207644_10000676 | 3300025931 | Bacteria | 21510 |
| 298 | Ga0207644_10138860 | 3300025931 | Bacteria | 1869 |
| 299 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 300 | Ga0207690_10039516 | 3300025932 | Bacteria | 3079 |
| 301 | Ga0207706_10000261 | 3300025933 | Bacteria | 57530 |
| 302 | Ga0207706_10004416 | 3300025933 | Bacteria | 13214 |
| 303 | Ga0207686_10000171 | 3300025934 | Bacteria | 49624 |
| 304 | Ga0207686_10154470 | 3300025934 | Bacteria | 1601 |
| 305 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 306 | Ga0207670_10000169 | 3300025936 | Bacteria | 43470 |
| 307 | Ga0207669_10000351 | 3300025937 | Bacteria | 20924 |
| 308 | Ga0207704_10108023 | 3300025938 | Bacteria | 1873 |
| 309 | Ga0207665_10047303 | 3300025939 | Bacteria | 2884 |
| 310 | Ga0207665_10118141 | 3300025939 | Bacteria | 1871 |
| 311 | Ga0207665_10152955 | 3300025939 | Bacteria | 1654 |
| 312 | Ga0207691_10000106 | 3300025940 | Bacteria | 74290 |
| 313 | Ga0207691_10087419 | 3300025940 | Bacteria | 2796 |
| 314 | Ga0207711_10002556 | 3300025941 | Bacteria | 16214 |
| 315 | Ga0207711_10004928 | 3300025941 | Bacteria | 11337 |
| 316 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 317 | Ga0207661_10000219 | 3300025944 | Bacteria | 37298 |
| 318 | Ga0207661_10119454 | 3300025944 | Bacteria | 2242 |
| 319 | Ga0207661_10409559 | 3300025944 | Bacteria | 1230 |
| 320 | Ga0207679_10000493 | 3300025945 | Bacteria | 27242 |
| 321 | Ga0207679_10156400 | 3300025945 | Bacteria | 1862 |
| 322 | Ga0207679_10344975 | 3300025945 | Bacteria | 1296 |
| 323 | Ga0207667_10006216 | 3300025949 | Bacteria | 14494 |
| 324 | Ga0207667_10369955 | 3300025949 | Bacteria | 1461 |
| 325 | Ga0207651_10001402 | 3300025960 | Bacteria | 10939 |
| 326 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 327 | Ga0207712_10096789 | 3300025961 | Bacteria | 2185 |
| 328 | Ga0207668_10000191 | 3300025972 | Bacteria | 41901 |
| 329 | Ga0207668_10024956 | 3300025972 | Bacteria | 3864 |
| 330 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 331 | Ga0207658_10007487 | 3300025986 | Bacteria | 7438 |
| 332 | Ga0207677_10148612 | 3300026023 | Bacteria | 1804 |
| 333 | Ga0207703_10006871 | 3300026035 | Bacteria | 9061 |
| 334 | Ga0207703_10165806 | 3300026035 | Bacteria | 1938 |
| 335 | Ga0207639_10000515 | 3300026041 | Bacteria | 26655 |
| 336 | Ga0207639_10105661 | 3300026041 | Bacteria | 2285 |
| 337 | Ga0207678_10000137 | 3300026067 | Bacteria | 60700 |
| 338 | Ga0207708_10000250 | 3300026075 | Bacteria | 42228 |
| 339 | Ga0207708_10030828 | 3300026075 | Bacteria | 4067 |
| 340 | Ga0207708_10056648 | 3300026075 | Bacteria | 2990 |
| 341 | Ga0207708_10381057 | 3300026075 | Bacteria | 1163 |
| 342 | Ga0207702_10001067 | 3300026078 | Bacteria | 28056 |
| 343 | Ga0207641_10000937 | 3300026088 | Bacteria | 30095 |
| 344 | Ga0207648_10000125 | 3300026089 | Bacteria | 75547 |
| 345 | Ga0207676_10001547 | 3300026095 | Bacteria | 16966 |
| 346 | Ga0207676_10283061 | 3300026095 | Bacteria | 1506 |
| 347 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 348 | Ga0207675_100000140 | 3300026118 | Bacteria | 62058 |
| 349 | Ga0207675_100092410 | 3300026118 | Bacteria | 2846 |
| 350 | Ga0207683_10000178 | 3300026121 | Bacteria | 54648 |
| 351 | Ga0207698_10001736 | 3300026142 | Bacteria | 12713 |
| 352 | Ga0210002_1000669 | 3300027617 | Bacteria | 4628 |
| 353 | Ga0209971_1004192 | 3300027682 | Bacteria | 3420 |
| 354 | Ga0209998_10004186 | 3300027717 | Bacteria | 3075 |
| 355 | Ga0209974_10001253 | 3300027876 | Bacteria | 9106 |
| 356 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 357 | Ga0207428_10001468 | 3300027907 | Bacteria | 24676 |
| 358 | Ga0207428_10160821 | 3300027907 | Bacteria | 1705 |
| 359 | Ga0207428_10290318 | 3300027907 | Bacteria | 1212 |
| 360 | Ga0265357_1000316 | 3300028023 | Bacteria | 2583 |
| 361 | Ga0268266_10165528 | 3300028379 | Bacteria | 2003 |
| 362 | Ga0268266_10284625 | 3300028379 | Bacteria | 1538 |
| 363 | Ga0268265_10000774 | 3300028380 | Bacteria | 30835 |
| 364 | Ga0268265_10124096 | 3300028380 | Bacteria | 2133 |
| 365 | Ga0268265_10215496 | 3300028380 | Bacteria | 1676 |
| 366 | Ga0268264_10000467 | 3300028381 | Bacteria | 54925 |
| 367 | Ga0268264_10321074 | 3300028381 | Bacteria | 1464 |
| 368 | Ga0265318_10010190 | 3300028577 | Bacteria | 4104 |
| 369 | Ga0265338_10074675 | 3300028800 | Bacteria | 2881 |
| 370 | Ga0265760_10016365 | 3300031090 | Bacteria | 2128 |
| 371 | Ga0265330_10020216 | 3300031235 | Bacteria | 3042 |
| 372 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 373 | Ga0265325_10042630 | 3300031241 | Bacteria | 2371 |
| 374 | Ga0265329_10023207 | 3300031242 | Bacteria | 2068 |
| 375 | Ga0265340_10002924 | 3300031247 | Bacteria | 9729 |
| 376 | Ga0265339_10000269 | 3300031249 | Bacteria | 41988 |
| 377 | Ga0265339_10009320 | 3300031249 | Bacteria | 6177 |
| 378 | Ga0265331_10038705 | 3300031250 | Bacteria | 2329 |
| 379 | Ga0265316_10026116 | 3300031344 | Bacteria | 4866 |
| 380 | Ga0265316_10129965 | 3300031344 | Bacteria | 1898 |
| 381 | Ga0265313_10021626 | 3300031595 | Bacteria | 3513 |
| 382 | Ga0265313_10038029 | 3300031595 | Bacteria | 2400 |
| 383 | Ga0265313_10107202 | 3300031595 | Bacteria | 1232 |
| 384 | Ga0265314_10064629 | 3300031711 | Bacteria | 2476 |
| 385 | Ga0265342_10037995 | 3300031712 | Bacteria | 2934 |
| 386 | Ga0373930_0000027 | 3300034816 | Bacteria | 13519 |
| 387 | Ga0373948_0000257 | 3300034817 | Bacteria | 6391 |
| 388 | Ga0373948_0018042 | 3300034817 | Bacteria | 1322 |
| 389 | Ga0373950_0004090 | 3300034818 | Bacteria | 2123 |
| 390 | Ga0373958_0000466 | 3300034819 | Bacteria | 4954 |
| 391 | Ga0373958_0000674 | 3300034819 | Bacteria | 4314 |
| 392 | Ga0373959_0000673 | 3300034820 | Bacteria | 5847 |
| 393 | Ga0373959_0004580 | 3300034820 | Bacteria | 2234 |
| 394 | Ga0373938_0000020 | 3300034957 | Bacteria | 20855 |
| 395 | Ga0373938_0000687 | 3300034957 | Bacteria | 5457 |
| 396 | Ga0373938_0003245 | 3300034957 | Bacteria | 2650 |
| 397 | Ga0373928_0000298 | 3300035084 | Bacteria | 9863 |
| 398 | Ga0373928_0012217 | 3300035084 | Bacteria | 1710 |
| 399 | Ga0373929_0001530 | 3300035085 | Bacteria | 4394 |
| 400 | Ga0373929_0004695 | 3300035085 | Bacteria | 2449 |
| 401 | Ga0373934_0137276 | 3300035086 | Unclassified | 999 |
| 402 | Ga0373940_0000080 | 3300035088 | Bacteria | 11517 |
| 403 | Ga0373944_0007656 | 3300035089 | Bacteria | 2900 |
| 404 | Ga0373949_0000753 | 3300035090 | Bacteria | 10447 |
| 405 | Ga0373951_0001678 | 3300035091 | Bacteria | 5789 |
| 406 | Ga0373951_0006554 | 3300035091 | Bacteria | 2661 |
| 407 | Ga0373952_0000333 | 3300035092 | Bacteria | 7972 |
| 408 | Ga0373952_0001012 | 3300035092 | Bacteria | 5139 |
| 409 | Ga0373923_0000919 | 3300035111 | Bacteria | 7857 |
| 410 | Ga0373923_0016700 | 3300035111 | Bacteria | 2795 |
| 411 | Ga0373923_0019172 | 3300035111 | Bacteria | 2645 |
| 412 | Ga0373932_0000316 | 3300035112 | Bacteria | 14729 |
| 413 | Ga0373932_0034846 | 3300035112 | Bacteria | 1420 |
| 414 | Ga0373936_0002231 | 3300035113 | Bacteria | 7235 |
| 415 | Ga0373936_0005828 | 3300035113 | Bacteria | 4639 |
| 416 | Ga0373936_0064866 | 3300035113 | Bacteria | 1497 |
| 417 | Ga0373941_0000521 | 3300035115 | Bacteria | 7708 |
| 418 | Ga0373941_0026267 | 3300035115 | Bacteria | 1689 |
| 419 | Ga0373945_0002741 | 3300035116 | Bacteria | 5530 |
| 420 | Ga0373945_0011515 | 3300035116 | Bacteria | 2926 |
| 421 | Ga0373945_0038968 | 3300035116 | Bacteria | 1711 |
| 422 | Ga0373953_0001774 | 3300035117 | Bacteria | 6372 |
| 423 | Ga0373956_0079186 | 3300035119 | Unclassified | 1506 |
| 424 | Ga0373960_0008241 | 3300035121 | Bacteria | 2492 |
| 425 | Ga0373943_0000069 | 3300035170 | Bacteria | 36572 |
| 426 | Ga0373943_0015861 | 3300035170 | Bacteria | 3427 |
| 427 | Ga0373943_0017222 | 3300035170 | Bacteria | 3305 |
| 428 | Ga0373943_0018775 | 3300035170 | Bacteria | 3179 |
| 429 | Ga0373946_0000379 | 3300035171 | Bacteria | 14434 |
| 430 | Ga0373946_0002835 | 3300035171 | Bacteria | 6138 |
| 431 | Ga0373946_0017700 | 3300035171 | Bacteria | 2729 |
| 432 | Ga0373955_0000643 | 3300035172 | Bacteria | 14950 |
| 433 | Ga0373955_0023393 | 3300035172 | Bacteria | 3146 |
| 434 | Ga0373942_0000054 | 3300035207 | Bacteria | 23047 |
| 435 | Ga0373942_0001029 | 3300035207 | Bacteria | 7582 |
| 436 | Ga0373961_0000807 | 3300035241 | Bacteria | 10698 |
| 437 | Ga0373961_0019802 | 3300035241 | Bacteria | 1772 |
| 438 | Ga0373924_0000604 | 3300035410 | Bacteria | 11090 |
| 439 | Ga0373931_0000933 | 3300035691 | Bacteria | 12286 |
| 440 | Ga0373931_0021889 | 3300035691 | Bacteria | 3211 |
| 441 | Ga0373931_0175515 | 3300035691 | Bacteria | 1265 |
| 442 | Ga0373935_0000075 | 3300035692 | Bacteria | 42723 |
| 443 | Ga0373935_0013888 | 3300035692 | Bacteria | 4862 |
| 444 | Ga0373935_0046279 | 3300035692 | Bacteria | 2747 |
| 445 | Ga0373935_0127810 | 3300035692 | Bacteria | 1704 |
| 446 | Ga0373935_0141812 | 3300035692 | Bacteria | 1624 |
| 447 | Ga0373935_0185291 | 3300035692 | Bacteria | 1431 |
| 448 | Ga0373927_0003619 | 3300035695 | Bacteria | 11024 |
| 449 | Ga0373927_0004392 | 3300035695 | Bacteria | 9889 |
| 450 | Ga0373927_0007963 | 3300035695 | Bacteria | 7156 |
| 451 | Ga0373927_0024002 | 3300035695 | Bacteria | 3989 |
| 452 | Ga0373927_0136110 | 3300035695 | Bacteria | 1605 |
| 453 | Ga0373947_0000138 | 3300035725 | Bacteria | 37713 |
| 454 | Ga0373947_0007756 | 3300035725 | Bacteria | 6200 |
| 455 | Ga0373947_0012882 | 3300035725 | Bacteria | 4794 |
| 456 | Ga0373947_0072794 | 3300035725 | Bacteria | 2111 |
| 457 | Ga0373947_0075180 | 3300035725 | Bacteria | 2079 |
| 458 | Ga0373937_0000057 | 3300036401 | Bacteria | 99491 |
| 459 | Ga0373937_0072294 | 3300036401 | Bacteria | 3181 |
| 460 | Ga0373937_0193847 | 3300036401 | Bacteria | 1910 |
| 461 | Ga0373937_0466026 | 3300036401 | Bacteria | 1200 |
| 462 | Ga0373925_0000078 | 3300037068 | Bacteria | 105238 |
| 463 | Ga0373925_0000883 | 3300037068 | Bacteria | 27390 |
| 464 | Ga0373925_0031612 | 3300037068 | Bacteria | 3891 |
| 465 | Ga0373925_0174060 | 3300037068 | Unclassified | 1700 |
| 466 | Ga0373925_0368177 | 3300037068 | Bacteria | 1169 |
| 467 | Ga0436365_0686548 | 3300039437 | Bacteria | 4924 |
| 468 | Ga0436365_1504256 | 3300039437 | Bacteria | 1655 |
| 469 | Ga0436360_0801136 | 3300039438 | Bacteria | 2691 |
| 470 | Ga0436361_0180874 | 3300039447 | Bacteria | 4990 |
| 471 | Ga0436363_0337307 | 3300039450 | Bacteria | 2423 |
| 472 | Ga0439455_0033865 | 3300042012 | Bacteria | 1283 |
| 473 | Ga0439435_0005357 | 3300042436 | Unclassified | 2818 |
| 474 | Ga0439460_0008569 | 3300042461 | Bacteria | 2585 |
| 475 | Ga0451577_0055660 | 3300042876 | Bacteria | 3529 |
| 476 | Ga0466963_0100415 | 3300044694 | Bacteria | 1980 |
| 477 | Ga0466957_0080092 | 3300044842 | Bacteria | 2033 |
| 478 | Ga0451576_0086931 | 3300045051 | Bacteria | 3252 |
| 479 | Ga0495592_0000233 | 3300046454 | Bacteria | 48027 |
| 480 | Ga0495592_0007561 | 3300046454 | Bacteria | 8139 |
| 481 | Ga0495592_0120766 | 3300046454 | Bacteria | 1844 |
| 482 | Ga0495603_0014219 | 3300046455 | Bacteria | 4815 |
| 483 | Ga0495629_0003366 | 3300046459 | Bacteria | 12077 |
| 484 | Ga0495629_0013380 | 3300046459 | Bacteria | 5920 |
| 485 | Ga0495629_0015321 | 3300046459 | Bacteria | 5505 |
| 486 | Ga0495629_0047650 | 3300046459 | Bacteria | 3006 |
| 487 | Ga0495638_0004882 | 3300046460 | Bacteria | 10087 |
| 488 | Ga0495641_0052482 | 3300046461 | Bacteria | 1858 |
| 489 | Ga0495651_0002019 | 3300046462 | Bacteria | 15670 |
| 490 | Ga0495653_0000464 | 3300046463 | Bacteria | 31572 |
| 491 | Ga0495653_0085298 | 3300046463 | Bacteria | 2324 |
| 492 | Ga0495580_0032264 | 3300046472 | Bacteria | 3781 |
| 493 | Ga0495582_0006057 | 3300046473 | Bacteria | 6739 |
| 494 | Ga0495582_0104532 | 3300046473 | Bacteria | 1587 |
| 495 | Ga0495662_0002050 | 3300046476 | Bacteria | 10101 |
| 496 | Ga0495662_0017496 | 3300046476 | Bacteria | 3468 |
| 497 | Ga0495662_0082895 | 3300046476 | Bacteria | 1560 |
| 498 | Ga0495664_0000023 | 3300046477 | Bacteria | 126807 |
| 499 | Ga0495664_0001080 | 3300046477 | Bacteria | 14082 |
| 500 | Ga0495585_0042504 | 3300046492 | Bacteria | 2545 |
| 501 | Ga0495594_0059346 | 3300046499 | Bacteria | 2115 |
| 502 | Ga0495608_0000030 | 3300046511 | Bacteria | 145828 |
| 503 | Ga0495608_0037491 | 3300046511 | Bacteria | 3260 |
| 504 | Ga0495618_0000585 | 3300046514 | Bacteria | 25962 |
| 505 | Ga0495618_0025598 | 3300046514 | Bacteria | 3662 |
| 506 | Ga0495628_0000027 | 3300046516 | Bacteria | 126537 |
| 507 | Ga0495628_0027611 | 3300046516 | Bacteria | 4616 |
| 508 | Ga0495630_0006673 | 3300046517 | Bacteria | 8227 |
| 509 | Ga0495630_0048557 | 3300046517 | Bacteria | 3176 |
| 510 | Ga0495631_0098574 | 3300046518 | Bacteria | 1258 |
| 511 | Ga0495666_0058415 | 3300046526 | Bacteria | 1845 |
| 512 | Ga0495666_0143711 | 3300046526 | Bacteria | 1111 |
| 513 | Ga0495652_0000041 | 3300046529 | Bacteria | 126519 |
| 514 | Ga0495652_0023259 | 3300046529 | Bacteria | 5494 |
| 515 | Ga0495640_0000056 | 3300046533 | Bacteria | 62074 |
| 516 | Ga0495640_0015377 | 3300046533 | Bacteria | 5760 |
| 517 | Ga0495586_0003404 | 3300046535 | Bacteria | 8532 |
| 518 | Ga0495586_0063223 | 3300046535 | Bacteria | 2016 |
| 519 | Ga0495587_0000025 | 3300046536 | Bacteria | 147974 |
| 520 | Ga0495587_0016528 | 3300046536 | Bacteria | 4590 |
| 521 | Ga0495598_0042454 | 3300046537 | Bacteria | 1335 |
| 522 | Ga0495609_0083578 | 3300046538 | Bacteria | 1394 |
| 523 | Ga0495645_0000001 | 3300046543 | Bacteria | 657910 |
| 524 | Ga0495645_0000848 | 3300046543 | Bacteria | 20818 |
| 525 | Ga0495645_0002026 | 3300046543 | Bacteria | 13788 |
| 526 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 527 | Ga0495667_0015999 | 3300046559 | Bacteria | 5069 |
| 528 | Ga0495667_0109000 | 3300046559 | Bacteria | 1789 |
| 529 | Ga0495667_0188570 | 3300046559 | Bacteria | 1322 |
| 530 | Ga0495634_0017149 | 3300046642 | Bacteria | 5171 |
| 531 | Ga0495634_0028035 | 3300046642 | Bacteria | 3912 |
| 532 | Ga0495634_0058248 | 3300046642 | Bacteria | 2575 |
| 533 | Ga0495634_0067382 | 3300046642 | Bacteria | 2368 |
| 534 | Ga0495611_0014721 | 3300046648 | Bacteria | 3345 |
| 535 | Ga0495635_0000077 | 3300046663 | Bacteria | 60215 |
| 536 | Ga0495635_0002760 | 3300046663 | Bacteria | 12036 |
| 537 | Ga0495635_0010039 | 3300046663 | Bacteria | 6620 |
| 538 | Ga0495659_0012483 | 3300046664 | Bacteria | 2752 |
| 539 | Ga0495661_0109661 | 3300046665 | Bacteria | 1540 |
| 540 | Ga0495657_0000390 | 3300046675 | Bacteria | 40745 |
| 541 | Ga0495657_0097408 | 3300046675 | Bacteria | 1878 |
| 542 | Ga0495657_0256459 | 3300046675 | Bacteria | 1052 |
| 543 | Ga0495657_0266054 | 3300046675 | Bacteria | 1029 |
| 544 | Ga0495599_0000021 | 3300046678 | Bacteria | 127591 |
| 545 | Ga0495599_0007257 | 3300046678 | Bacteria | 6715 |
| 546 | Ga0495599_0126512 | 3300046678 | Bacteria | 1588 |
| 547 | Ga0495623_0000141 | 3300046679 | Bacteria | 44491 |
| 548 | Ga0495623_0058657 | 3300046679 | Bacteria | 2420 |
| 549 | Ga0495646_0000051 | 3300046680 | Bacteria | 60085 |
| 550 | Ga0495646_0028864 | 3300046680 | Bacteria | 3471 |
| 551 | Ga0495647_0019612 | 3300046681 | Bacteria | 2419 |
| 552 | Ga0495658_0030875 | 3300046683 | Plasmid | 2913 |
| 553 | Ga0495658_0061145 | 3300046683 | Bacteria | 2162 |
| 554 | Ga0495658_0131855 | 3300046683 | Bacteria | 1522 |
| 555 | Ga0495613_0008553 | 3300046689 | Bacteria | 7597 |
| 556 | Ga0495613_0029492 | 3300046689 | Bacteria | 4079 |
| 557 | Ga0495613_0045741 | 3300046689 | Bacteria | 3236 |
| 558 | Ga0495613_0132733 | 3300046689 | Bacteria | 1782 |
| 559 | Ga0495624_0001090 | 3300046690 | Bacteria | 21458 |
| 560 | Ga0495624_0030238 | 3300046690 | Bacteria | 3529 |
| 561 | Ga0495624_0163665 | 3300046690 | Bacteria | 1358 |
| 562 | Ga0495600_0000114 | 3300046809 | Bacteria | 44972 |
| 563 | Ga0495600_0089510 | 3300046809 | Bacteria | 2008 |
| 564 | Ga0495581_0037777 | 3300047315 | Bacteria | 2794 |
| 565 | Ga0495581_0214116 | 3300047315 | Bacteria | 1126 |
| 566 | Ga0495604_0000036 | 3300047317 | Bacteria | 126707 |
| 567 | Ga0495604_0193338 | 3300047317 | Bacteria | 1416 |
| 568 | Ga0495674_0000102 | 3300047319 | Bacteria | 62602 |
| 569 | Ga0495674_0006766 | 3300047319 | Bacteria | 10974 |
| 570 | Ga0495674_0021884 | 3300047319 | Bacteria | 5906 |
| 571 | Ga0495674_0155901 | 3300047319 | Bacteria | 1913 |
| 572 | Ga0495676_0045462 | 3300047321 | Bacteria | 3573 |
| 573 | Ga0495676_0058309 | 3300047321 | Bacteria | 3038 |
| 574 | Ga0495676_0098627 | 3300047321 | Bacteria | 2167 |
| 575 | Ga0495680_0001061 | 3300047322 | Bacteria | 30436 |
| 576 | Ga0495680_0036206 | 3300047322 | Bacteria | 3965 |
| 577 | Ga0495680_0065048 | 3300047322 | Bacteria | 2794 |
| 578 | Ga0495680_0212499 | 3300047322 | Bacteria | 1384 |
| 579 | Ga0495675_0000148 | 3300047444 | Bacteria | 49201 |
| 580 | Ga0495679_026891 | 3300047446 | Bacteria | 1905 |
| 581 | Ga0495684_0000025 | 3300047471 | Bacteria | 127037 |
| 582 | Ga0495684_0002541 | 3300047471 | Bacteria | 14533 |
| 583 | Ga0495684_0006682 | 3300047471 | Bacteria | 8948 |
| 584 | Ga0495684_0045604 | 3300047471 | Plasmid | 3355 |
| 585 | Ga0495684_0062291 | 3300047471 | Unclassified | 2837 |
| 586 | Ga0495593_0011539 | 3300047673 | Bacteria | 5072 |
| 587 | Ga0495602_0000311 | 3300048088 | Bacteria | 44943 |
| 588 | Ga0495602_0033768 | 3300048088 | Bacteria | 4795 |
| 589 | Ga0495602_0149661 | 3300048088 | Bacteria | 1837 |
| 590 | Ga0495614_0097570 | 3300048089 | Bacteria | 1282 |
| 591 | Ga0496100_0000400 | 3300048903 | Bacteria | 20959 |
| 592 | Ga0496100_0003748 | 3300048903 | Bacteria | 7959 |
| 593 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 594 | Ga0496101_0001763 | 3300048904 | Bacteria | 12984 |
| 595 | Ga0496102_0002633 | 3300048905 | Bacteria | 15255 |
| 596 | Ga0496102_0011817 | 3300048905 | Bacteria | 7536 |
| 597 | Ga0496102_0100556 | 3300048905 | Bacteria | 2686 |
| 598 | Ga0496102_0241220 | 3300048905 | Unclassified | 1704 |
| 599 | Ga0496102_0272908 | 3300048905 | Bacteria | 1594 |
| 600 | Ga0496103_0000589 | 3300048906 | Bacteria | 28631 |
| 601 | Ga0496103_0165242 | 3300048906 | Bacteria | 1420 |
| 602 | Ga0496104_0000215 | 3300048907 | Bacteria | 50960 |
| 603 | Ga0496104_0002323 | 3300048907 | Bacteria | 16428 |
| 604 | Ga0496104_0032419 | 3300048907 | Bacteria | 4862 |
| 605 | Ga0496104_0039113 | 3300048907 | Bacteria | 4440 |
| 606 | Ga0496105_0005561 | 3300048908 | Bacteria | 9570 |
| 607 | Ga0496105_0013570 | 3300048908 | Bacteria | 6470 |
| 608 | Ga0496105_0181999 | 3300048908 | Bacteria | 1720 |
| 609 | Ga0496105_0188686 | 3300048908 | Bacteria | 1686 |
| 610 | Ga0496106_0005428 | 3300048909 | Bacteria | 9431 |
| 611 | Ga0496106_0060648 | 3300048909 | Bacteria | 2867 |
| 612 | Ga0496106_0061643 | 3300048909 | Bacteria | 2846 |
| 613 | Ga0496106_0073336 | 3300048909 | Bacteria | 2619 |
| 614 | Ga0496107_0000959 | 3300048910 | Bacteria | 17091 |
| 615 | Ga0496107_0010740 | 3300048910 | Bacteria | 6369 |
| 616 | Ga0496108_0008895 | 3300048911 | Bacteria | 8140 |
| 617 | Ga0496108_0010986 | 3300048911 | Bacteria | 7354 |
| 618 | Ga0496108_0099240 | 3300048911 | Bacteria | 2482 |
| 619 | Ga0496109_0000186 | 3300048912 | Bacteria | 62084 |
| 620 | Ga0496109_0009764 | 3300048912 | Bacteria | 8191 |
| 621 | Ga0496109_0012979 | 3300048912 | Bacteria | 7201 |
| 622 | Ga0496109_0016348 | 3300048912 | Bacteria | 6484 |
| 623 | Ga0496109_0030370 | 3300048912 | Bacteria | 4844 |
| 624 | Ga0496109_0133580 | 3300048912 | Bacteria | 2317 |
| 625 | Ga0496110_0002430 | 3300048913 | Bacteria | 13955 |
| 626 | Ga0496110_0008784 | 3300048913 | Bacteria | 8141 |
| 627 | Ga0496110_0013927 | 3300048913 | Bacteria | 6663 |
| 628 | Ga0496110_0022421 | 3300048913 | Bacteria | 5361 |
| 629 | Ga0496110_0469606 | 3300048913 | Bacteria | 1146 |
| 630 | Ga0496111_0003314 | 3300048914 | Bacteria | 9963 |
| 631 | Ga0496112_0008924 | 3300048915 | Bacteria | 8999 |
| 632 | Ga0496112_0016056 | 3300048915 | Bacteria | 7001 |
| 633 | Ga0496112_0150966 | 3300048915 | Bacteria | 2291 |
| 634 | Ga0496113_0001663 | 3300048916 | Bacteria | 12569 |
| 635 | Ga0496113_0017290 | 3300048916 | Bacteria | 5002 |
| 636 | Ga0496113_0057454 | 3300048916 | Bacteria | 2924 |
| 637 | Ga0496114_0005496 | 3300048917 | Bacteria | 9922 |
| 638 | Ga0496114_0225814 | 3300048917 | Bacteria | 1644 |
| 639 | Ga0496115_0000855 | 3300048918 | Bacteria | 22097 |
| 640 | Ga0496115_0002326 | 3300048918 | Bacteria | 13618 |
| 641 | Ga0501031_0014196 | 3300049568 | Bacteria | 5183 |
| 642 | Ga0501033_0017988 | 3300049570 | Bacteria | 5336 |
| 643 | Ga0501037_0014525 | 3300049573 | Bacteria | 5792 |
| 644 | Ga0501038_0154771 | 3300049574 | Bacteria | 1867 |
| 645 | Ga0501039_0018275 | 3300049575 | Bacteria | 5380 |
| 646 | Ga0501040_0173808 | 3300049576 | Bacteria | 1526 |
| 647 | Ga0501042_0153894 | 3300049578 | Bacteria | 1658 |
| 648 | Ga0501046_0014888 | 3300049580 | Bacteria | 6545 |
| 649 | Ga0501048_0006384 | 3300049582 | Bacteria | 8963 |
| 650 | Ga0501067_0051208 | 3300049583 | Bacteria | 2289 |
| 651 | Ga0501068_0002435 | 3300049584 | Bacteria | 9877 |
| 652 | Ga0501069_0001787 | 3300049585 | Bacteria | 10754 |
| 653 | Ga0501070_0097961 | 3300049586 | Bacteria | 2425 |
| 654 | Ga0501071_0015093 | 3300049587 | Bacteria | 5297 |
| 655 | Ga0501073_0251236 | 3300049589 | Bacteria | 1220 |
| 656 | Ga0501074_0012445 | 3300049590 | Bacteria | 6184 |
| 657 | Ga0501076_0021925 | 3300049592 | Bacteria | 4905 |
| 658 | Ga0501077_0054567 | 3300049593 | Bacteria | 2538 |
| 659 | Ga0501077_0119622 | 3300049593 | Bacteria | 1669 |
| 660 | Ga0501079_0077326 | 3300049741 | Bacteria | 2574 |
| 661 | Ga0501083_0076376 | 3300049744 | Bacteria | 2223 |
| 662 | Ga0501035_0043099 | 3300049822 | Bacteria | 4067 |
| 663 | Ga0501044_0097834 | 3300049823 | Bacteria | 2955 |
| 664 | Ga0501044_0226538 | 3300049823 | Bacteria | 1818 |
| 665 | Ga0501045_0023317 | 3300049824 | Bacteria | 4436 |
| 666 | nmdc:mga0yw44_141469_c1 | 3300050492 | Bacteria | 1564 |
| 667 | nmdc:mga06z11_16197_c1 | 3300050494 | Bacteria | 3351 |
| 668 | nmdc:mga08y16_1219_c1 | 3300050511 | Bacteria | 25435 |
| 669 | nmdc:mga08y16_238840_c1 | 3300050511 | Bacteria | 1878 |
| 670 | nmdc:mga08y16_311_c1 | 3300050511 | Bacteria | 43954 |
| 671 | nmdc:mga08y16_395158_c1 | 3300050511 | Bacteria | 1416 |
| 672 | nmdc:mga08y16_63655_c1 | 3300050511 | Unclassified | 3852 |
| 673 | nmdc:mga0n895_127108_c1 | 3300050512 | Bacteria | 2573 |
| 674 | nmdc:mga0n895_150301_c1 | 3300050512 | Bacteria | 2359 |
| 675 | nmdc:mga0n895_2692_c1 | 3300050512 | Bacteria | 14019 |
| 676 | nmdc:mga0n895_30476_c1 | 3300050512 | Bacteria | 5156 |
| 677 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 678 | nmdc:mga0n895_85451_c1 | 3300050512 | Bacteria | 3150 |
| 679 | nmdc:mga0n895_90699_c1 | 3300050512 | Bacteria | 3058 |
| 680 | nmdc:mga0rr50_14446_c1 | 3300050513 | Bacteria | 5180 |
| 681 | nmdc:mga0rr50_62367_c1 | 3300050513 | Bacteria | 2812 |
| 682 | nmdc:mga08x19_4336_c1 | 3300050514 | Bacteria | 8405 |
| 683 | nmdc:mga0a205_153067_c1 | 3300050515 | Bacteria | 2205 |
| 684 | nmdc:mga0a205_2030_c1 | 3300050515 | Bacteria | 17685 |
| 685 | nmdc:mga0a205_317741_c1 | 3300050515 | Bacteria | 1428 |
| 686 | Ga0495601_0000025 | 3300053077 | Bacteria | 127736 |
| 687 | Ga0495601_0000799 | 3300053077 | Bacteria | 17005 |
| 688 | Ga0495601_0010538 | 3300053077 | Bacteria | 5504 |
| 689 | Ga0495601_0039266 | 3300053077 | Bacteria | 2964 |
| 690 | Ga0495601_0041999 | 3300053077 | Bacteria | 2868 |
| 691 | Ga0495601_0101875 | 3300053077 | Bacteria | 1855 |
| 692 | Ga0495612_0000046 | 3300053078 | Bacteria | 59912 |
| 693 | Ga0495612_0000111 | 3300053078 | Bacteria | 34638 |
| 694 | Ga0495612_0006780 | 3300053078 | Bacteria | 4691 |
| 695 | Ga0495655_0006491 | 3300053083 | Bacteria | 2128 |
| 696 | Ga0495595_0000054 | 3300053084 | Bacteria | 59828 |
| 697 | Ga0495595_0045303 | 3300053084 | Bacteria | 2023 |
| 698 | Ga0495595_0049973 | 3300053084 | Bacteria | 1935 |
| 699 | Ga0495595_0133903 | 3300053084 | Bacteria | 1213 |
| 700 | Ga0495619_0000035 | 3300053085 | Bacteria | 126262 |
| 701 | Ga0495619_0027682 | 3300053085 | Bacteria | 3653 |
| 702 | Ga0495619_0042133 | 3300053085 | Bacteria | 2988 |
| 703 | Ga0501082_0209851 | 3300060353 | Bacteria | 1694 |
| 704 | Ga0501082_0244594 | 3300060353 | Bacteria | 1561 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005327 | Ga0070658_10132885 | Ga0070658_101328852 | 273 |
| 2 | 3300005458 | Ga0070681_10004194 | Ga0070681_1000419411 | 273 |
| 3 | 3300005530 | Ga0070679_100009527 | Ga0070679_1000095277 | 273 |
| 4 | 3300025917 | Ga0207660_10018073 | Ga0207660_100180734 | 273 |
| 5 | 3300025919 | Ga0207657_10194924 | Ga0207657_101949242 | 273 |
| 6 | 3300025921 | Ga0207652_10077681 | Ga0207652_100776812 | 273 |
| 7 | 3300006871 | Ga0075434_100057142 | Ga0075434_1000571423 | 277 |
| 8 | 3300021384 | Ga0213876_10044059 | Ga0213876_100440592 | 277 |
| 9 | 3300021441 | Ga0213871_10003427 | Ga0213871_100034271 | 277 |
| 10 | 3300039437 | Ga0436365_0686548 | Ga0436365_0686548_2113_3048 | 277 |
| 11 | 3300039438 | Ga0436360_0801136 | Ga0436360_0801136_1189_2124 | 277 |
| 12 | 3300039450 | Ga0436363_0337307 | Ga0436363_0337307_905_1840 | 277 |
| 13 | 3300046559 | Ga0495667_0188570 | Ga0495667_0188570_38_973 | 277 |
| 14 | 3300046642 | Ga0495634_0067382 | Ga0495634_0067382_457_1392 | 277 |
| 15 | 3300046809 | Ga0495600_0089510 | Ga0495600_0089510_284_1192 | 277 |
| 16 | 3300047322 | Ga0495680_0212499 | Ga0495680_0212499_23_958 | 277 |
| 17 | 3300048905 | Ga0496102_0100556 | Ga0496102_0100556_780_1715 | 277 |
| 18 | 3300048908 | Ga0496105_0181999 | Ga0496105_0181999_397_1407 | 277 |
| 19 | 3300048911 | Ga0496108_0099240 | Ga0496108_0099240_835_1770 | 277 |
| 20 | 3300050512 | nmdc:mga0n895_30476_c1 | nmdc:mga0n895_30476_c1_1488_2423 | 277 |
| 21 | 3300053077 | Ga0495601_0039266 | Ga0495601_0039266_1475_2410 | 277 |
| 22 | 3300053077 | Ga0495601_0101875 | Ga0495601_0101875_259_1194 | 277 |
| 23 | 3300053084 | Ga0495595_0045303 | Ga0495595_0045303_540_1475 | 277 |
| 24 | 3300053085 | Ga0495619_0042133 | Ga0495619_0042133_1773_2681 | 277 |
| 25 | 3300021384 | Ga0213876_10062025 | Ga0213876_100620252 | 278 |
| 26 | 3300035170 | Ga0373943_0000069 | Ga0373943_0000069_33583_34491 | 278 |
| 27 | 3300035171 | Ga0373946_0000379 | Ga0373946_0000379_9401_10309 | 278 |
| 28 | 3300035692 | Ga0373935_0046279 | Ga0373935_0046279_817_1725 | 278 |
| 29 | 3300035695 | Ga0373927_0007963 | Ga0373927_0007963_4547_5455 | 278 |
| 30 | 3300035725 | Ga0373947_0007756 | Ga0373947_0007756_2858_3766 | 278 |
| 31 | 3300037068 | Ga0373925_0000883 | Ga0373925_0000883_343_1251 | 278 |
| 32 | 3300039437 | Ga0436365_1504256 | Ga0436365_1504256_139_1074 | 278 |
| 33 | 3300046459 | Ga0495629_0047650 | Ga0495629_0047650_1827_2735 | 278 |
| 34 | 3300046472 | Ga0495580_0032264 | Ga0495580_0032264_2414_3322 | 278 |
| 35 | 3300046476 | Ga0495662_0082895 | Ga0495662_0082895_617_1525 | 278 |
| 36 | 3300046642 | Ga0495634_0017149 | Ga0495634_0017149_4206_5114 | 278 |
| 37 | 3300046681 | Ga0495647_0019612 | Ga0495647_0019612_613_1521 | 278 |
| 38 | 3300046683 | Ga0495658_0061145 | Ga0495658_0061145_414_1322 | 278 |
| 39 | 3300046689 | Ga0495613_0029492 | Ga0495613_0029492_1760_2668 | 278 |
| 40 | 3300046690 | Ga0495624_0001090 | Ga0495624_0001090_12732_13640 | 278 |
| 41 | 3300047315 | Ga0495581_0037777 | Ga0495581_0037777_1366_2274 | 278 |
| 42 | 3300047315 | Ga0495581_0214116 | Ga0495581_0214116_164_1072 | 278 |
| 43 | 3300047321 | Ga0495676_0098627 | Ga0495676_0098627_343_1251 | 278 |
| 44 | 3300047471 | Ga0495684_0002541 | Ga0495684_0002541_11900_12808 | 278 |
| 45 | 3300047471 | Ga0495684_0062291 | Ga0495684_0062291_1441_2349 | 278 |
| 46 | 3300050515 | nmdc:mga0a205_317741_c1 | nmdc:mga0a205_317741_c1_305_1231 | 280 |
| 47 | 3300003911 | JGI25405J52794_10033288 | JGI25405J52794_100332881 | 282 |
| 48 | 3300005937 | Ga0081455_10000369 | Ga0081455_1000036915 | 282 |
| 49 | 3300005339 | Ga0070660_100198860 | Ga0070660_1001988602 | 283 |
| 50 | 3300005563 | Ga0068855_100108304 | Ga0068855_1001083043 | 283 |
| 51 | 3300005616 | Ga0068852_100052192 | Ga0068852_1000521923 | 283 |
| 52 | 3300010159 | Ga0099796_10004966 | Ga0099796_100049662 | 283 |
| 53 | 3300013307 | Ga0157372_10639429 | Ga0157372_106394291 | 283 |
| 54 | 3300025915 | Ga0207693_10314300 | Ga0207693_103143001 | 283 |
| 55 | 3300046675 | Ga0495657_0256459 | Ga0495657_0256459_77_1003 | 283 |
| 56 | 3300003203 | JGI25406J46586_10024660 | JGI25406J46586_100246603 | 285 |
| 57 | 3300005985 | Ga0081539_10002225 | Ga0081539_100022256 | 285 |
| 58 | 3300046460 | Ga0495638_0004882 | Ga0495638_0004882_4526_5452 | 285 |
| 59 | 3300009094 | Ga0111539_10030559 | Ga0111539_100305592 | 286 |
| 60 | 3300027907 | Ga0207428_10290318 | Ga0207428_102903181 | 286 |
| 61 | 3300035695 | Ga0373927_0004392 | Ga0373927_0004392_6558_7505 | 286 |
| 62 | 3300046454 | Ga0495592_0120766 | Ga0495592_0120766_24_971 | 286 |
| 63 | 3300046459 | Ga0495629_0013380 | Ga0495629_0013380_3302_4249 | 286 |
| 64 | 3300046463 | Ga0495653_0085298 | Ga0495653_0085298_29_976 | 286 |
| 65 | 3300046476 | Ga0495662_0002050 | Ga0495662_0002050_396_1343 | 286 |
| 66 | 3300046477 | Ga0495664_0001080 | Ga0495664_0001080_8824_9771 | 286 |
| 67 | 3300046517 | Ga0495630_0048557 | Ga0495630_0048557_1774_2721 | 286 |
| 68 | 3300046533 | Ga0495640_0015377 | Ga0495640_0015377_3384_4331 | 286 |
| 69 | 3300046535 | Ga0495586_0003404 | Ga0495586_0003404_6548_7495 | 286 |
| 70 | 3300046543 | Ga0495645_0002026 | Ga0495645_0002026_3089_4036 | 286 |
| 71 | 3300046642 | Ga0495634_0058248 | Ga0495634_0058248_71_1018 | 286 |
| 72 | 3300046663 | Ga0495635_0002760 | Ga0495635_0002760_318_1265 | 286 |
| 73 | 3300046680 | Ga0495646_0028864 | Ga0495646_0028864_193_1140 | 286 |
| 74 | 3300046690 | Ga0495624_0163665 | Ga0495624_0163665_316_1263 | 286 |
| 75 | 3300047319 | Ga0495674_0006766 | Ga0495674_0006766_8961_9908 | 286 |
| 76 | 3300047471 | Ga0495684_0006682 | Ga0495684_0006682_1676_2623 | 286 |
| 77 | 3300049570 | Ga0501033_0017988 | Ga0501033_0017988_3889_4824 | 286 |
| 78 | 3300049573 | Ga0501037_0014525 | Ga0501037_0014525_3730_4665 | 286 |
| 79 | 3300049574 | Ga0501038_0154771 | Ga0501038_0154771_772_1707 | 286 |
| 80 | 3300049580 | Ga0501046_0014888 | Ga0501046_0014888_2294_3229 | 286 |
| 81 | 3300049584 | Ga0501068_0002435 | Ga0501068_0002435_1972_2907 | 286 |
| 82 | 3300049585 | Ga0501069_0001787 | Ga0501069_0001787_2729_3664 | 286 |
| 83 | 3300049586 | Ga0501070_0097961 | Ga0501070_0097961_1129_2064 | 286 |
| 84 | 3300049589 | Ga0501073_0251236 | Ga0501073_0251236_46_981 | 286 |
| 85 | 3300049590 | Ga0501074_0012445 | Ga0501074_0012445_3771_4706 | 286 |
| 86 | 3300049741 | Ga0501079_0077326 | Ga0501079_0077326_812_1747 | 286 |
| 87 | 3300049744 | Ga0501083_0076376 | Ga0501083_0076376_788_1723 | 286 |
| 88 | 3300049822 | Ga0501035_0043099 | Ga0501035_0043099_1816_2751 | 286 |
| 89 | 3300049823 | Ga0501044_0226538 | Ga0501044_0226538_772_1707 | 286 |
| 90 | 3300049824 | Ga0501045_0023317 | Ga0501045_0023317_2828_3763 | 286 |
| 91 | 3300050511 | nmdc:mga08y16_395158_c1 | nmdc:mga08y16_395158_c1_223_1158 | 286 |
| 92 | 3300050512 | nmdc:mga0n895_150301_c1 | nmdc:mga0n895_150301_c1_486_1424 | 286 |
| 93 | 3300053077 | Ga0495601_0000799 | Ga0495601_0000799_6040_6987 | 286 |
| 94 | 3300053078 | Ga0495612_0000111 | Ga0495612_0000111_8951_9898 | 286 |
| 95 | 3300060353 | Ga0501082_0209851 | Ga0501082_0209851_595_1530 | 286 |
| 96 | 3300025929 | Ga0207664_10447261 | Ga0207664_104472611 | 287 |
| 97 | 3300035111 | Ga0373923_0016700 | Ga0373923_0016700_814_1761 | 287 |
| 98 | 3300035725 | Ga0373947_0075180 | Ga0373947_0075180_623_1570 | 287 |
| 99 | 3300046526 | Ga0495666_0058415 | Ga0495666_0058415_772_1719 | 287 |
| 100 | 3300006028 | Ga0070717_10167220 | Ga0070717_101672202 | 292 |
| 101 | 3300025924 | Ga0207694_10304962 | Ga0207694_103049621 | 292 |
| 102 | 3300034817 | Ga0373948_0018042 | Ga0373948_0018042_17_979 | 294 |
| 103 | 3300005937 | Ga0081455_10016383 | Ga0081455_100163832 | 295 |
| 104 | 3300005983 | Ga0081540_1006164 | Ga0081540_10061645 | 296 |
| 105 | 3300035116 | Ga0373945_0011515 | Ga0373945_0011515_11_901 | 296 |
| 106 | 3300049823 | Ga0501044_0097834 | Ga0501044_0097834_1997_2932 | 297 |
| 107 | 3300006871 | Ga0075434_100053336 | Ga0075434_1000533365 | 301 |
| 108 | 3300050512 | nmdc:mga0n895_85451_c1 | nmdc:mga0n895_85451_c1_20_973 | 301 |
| 109 | 3300001989 | JGI24739J22299_10002161 | JGI24739J22299_100021618 | 302 |
| 110 | 3300001990 | JGI24737J22298_10002605 | JGI24737J22298_100026056 | 302 |
| 111 | 3300002070 | JGI24750J21931_1000256 | JGI24750J21931_10002564 | 302 |
| 112 | 3300002074 | JGI24748J21848_1000381 | JGI24748J21848_10003818 | 302 |
| 113 | 3300002075 | JGI24738J21930_10000425 | JGI24738J21930_1000042511 | 302 |
| 114 | 3300002076 | JGI24749J21850_1001974 | JGI24749J21850_10019742 | 302 |
| 115 | 3300005329 | Ga0070683_100002049 | Ga0070683_10000204910 | 302 |
| 116 | 3300005331 | Ga0070670_100003778 | Ga0070670_10000377812 | 302 |
| 117 | 3300005336 | Ga0070680_100003276 | Ga0070680_1000032769 | 302 |
| 118 | 3300005337 | Ga0070682_100000341 | Ga0070682_10000034127 | 302 |
| 119 | 3300005341 | Ga0070691_10000518 | Ga0070691_1000051813 | 302 |
| 120 | 3300005341 | Ga0070691_10060275 | Ga0070691_100602751 | 302 |
| 121 | 3300005345 | Ga0070692_10003367 | Ga0070692_100033672 | 302 |
| 122 | 3300005347 | Ga0070668_100001356 | Ga0070668_10000135620 | 302 |
| 123 | 3300005356 | Ga0070674_100000623 | Ga0070674_10000062313 | 302 |
| 124 | 3300005364 | Ga0070673_100000239 | Ga0070673_10000023926 | 302 |
| 125 | 3300005367 | Ga0070667_100003023 | Ga0070667_1000030238 | 302 |
| 126 | 3300005440 | Ga0070705_100000425 | Ga0070705_1000004258 | 302 |
| 127 | 3300005444 | Ga0070694_100000401 | Ga0070694_1000004019 | 302 |
| 128 | 3300005445 | Ga0070708_100004439 | Ga0070708_1000044399 | 302 |
| 129 | 3300005457 | Ga0070662_100003931 | Ga0070662_1000039317 | 302 |
| 130 | 3300005458 | Ga0070681_10000493 | Ga0070681_100004938 | 302 |
| 131 | 3300005459 | Ga0068867_100001581 | Ga0068867_1000015817 | 302 |
| 132 | 3300005466 | Ga0070685_10012006 | Ga0070685_100120066 | 302 |
| 133 | 3300005539 | Ga0068853_100005864 | Ga0068853_1000058647 | 302 |
| 134 | 3300005545 | Ga0070695_100000743 | Ga0070695_10000074317 | 302 |
| 135 | 3300005546 | Ga0070696_100000918 | Ga0070696_10000091817 | 302 |
| 136 | 3300005615 | Ga0070702_100000857 | Ga0070702_1000008578 | 302 |
| 137 | 3300005617 | Ga0068859_100012990 | Ga0068859_1000129905 | 302 |
| 138 | 3300006931 | Ga0097620_100012990 | Ga0097620_1000129905 | 302 |
| 139 | 3300007265 | Ga0099794_10038178 | Ga0099794_100381782 | 302 |
| 140 | 3300009147 | Ga0114129_10092448 | Ga0114129_100924482 | 302 |
| 141 | 3300011119 | Ga0105246_10302262 | Ga0105246_103022621 | 302 |
| 142 | 3300025939 | Ga0207665_10047303 | Ga0207665_100473032 | 302 |
| 143 | 3300035086 | Ga0373934_0137276 | Ga0373934_0137276_36_944 | 302 |
| 144 | 3300035111 | Ga0373923_0019172 | Ga0373923_0019172_160_1068 | 302 |
| 145 | 3300035113 | Ga0373936_0064866 | Ga0373936_0064866_524_1432 | 302 |
| 146 | 3300035115 | Ga0373941_0026267 | Ga0373941_0026267_84_992 | 302 |
| 147 | 3300035116 | Ga0373945_0038968 | Ga0373945_0038968_787_1695 | 302 |
| 148 | 3300035119 | Ga0373956_0079186 | Ga0373956_0079186_320_1228 | 302 |
| 149 | 3300035170 | Ga0373943_0015861 | Ga0373943_0015861_725_1633 | 302 |
| 150 | 3300035692 | Ga0373935_0127810 | Ga0373935_0127810_528_1436 | 302 |
| 151 | 3300035695 | Ga0373927_0136110 | Ga0373927_0136110_71_979 | 302 |
| 152 | 3300036401 | Ga0373937_0072294 | Ga0373937_0072294_1860_2768 | 302 |
| 153 | 3300036401 | Ga0373937_0193847 | Ga0373937_0193847_224_1132 | 302 |
| 154 | 3300037068 | Ga0373925_0174060 | Ga0373925_0174060_489_1397 | 302 |
| 155 | 3300039447 | Ga0436361_0180874 | Ga0436361_0180874_46_954 | 302 |
| 156 | 3300046454 | Ga0495592_0007561 | Ga0495592_0007561_1996_2904 | 302 |
| 157 | 3300046461 | Ga0495641_0052482 | Ga0495641_0052482_384_1292 | 302 |
| 158 | 3300046476 | Ga0495662_0017496 | Ga0495662_0017496_820_1728 | 302 |
| 159 | 3300046492 | Ga0495585_0042504 | Ga0495585_0042504_1061_1969 | 302 |
| 160 | 3300046499 | Ga0495594_0059346 | Ga0495594_0059346_871_1779 | 302 |
| 161 | 3300046511 | Ga0495608_0037491 | Ga0495608_0037491_374_1282 | 302 |
| 162 | 3300046514 | Ga0495618_0025598 | Ga0495618_0025598_810_1718 | 302 |
| 163 | 3300046518 | Ga0495631_0098574 | Ga0495631_0098574_23_931 | 302 |
| 164 | 3300046529 | Ga0495652_0023259 | Ga0495652_0023259_2023_2931 | 302 |
| 165 | 3300046535 | Ga0495586_0063223 | Ga0495586_0063223_171_1079 | 302 |
| 166 | 3300046537 | Ga0495598_0042454 | Ga0495598_0042454_289_1197 | 302 |
| 167 | 3300046538 | Ga0495609_0083578 | Ga0495609_0083578_190_1098 | 302 |
| 168 | 3300046559 | Ga0495667_0015999 | Ga0495667_0015999_2177_3085 | 302 |
| 169 | 3300046648 | Ga0495611_0014721 | Ga0495611_0014721_1111_2019 | 302 |
| 170 | 3300046664 | Ga0495659_0012483 | Ga0495659_0012483_1040_1948 | 302 |
| 171 | 3300046665 | Ga0495661_0109661 | Ga0495661_0109661_62_970 | 302 |
| 172 | 3300046678 | Ga0495599_0126512 | Ga0495599_0126512_418_1326 | 302 |
| 173 | 3300046683 | Ga0495658_0030875 | Ga0495658_0030875_1951_2859 | 302 |
| 174 | 3300046689 | Ga0495613_0132733 | Ga0495613_0132733_649_1557 | 302 |
| 175 | 3300047319 | Ga0495674_0021884 | Ga0495674_0021884_1244_2152 | 302 |
| 176 | 3300047321 | Ga0495676_0045462 | Ga0495676_0045462_2547_3455 | 302 |
| 177 | 3300047446 | Ga0495679_026891 | Ga0495679_026891_634_1542 | 302 |
| 178 | 3300048089 | Ga0495614_0097570 | Ga0495614_0097570_302_1210 | 302 |
| 179 | 3300048905 | Ga0496102_0241220 | Ga0496102_0241220_305_1213 | 302 |
| 180 | 3300048913 | Ga0496110_0469606 | Ga0496110_0469606_212_1120 | 302 |
| 181 | 3300050512 | nmdc:mga0n895_127108_c1 | nmdc:mga0n895_127108_c1_1585_2493 | 302 |
| 182 | 3300005844 | Ga0068862_100346524 | Ga0068862_1003465242 | 304 |
| 183 | 3300009553 | Ga0105249_10018980 | Ga0105249_100189804 | 304 |
| 184 | 3300014326 | Ga0157380_10252784 | Ga0157380_102527842 | 304 |
| 185 | 3300025961 | Ga0207712_10096789 | Ga0207712_100967892 | 304 |
| 186 | 3300028380 | Ga0268265_10215496 | Ga0268265_102154962 | 304 |
| 187 | 3300042436 | Ga0439435_0005357 | Ga0439435_0005357_905_1819 | 304 |
| 188 | 3300005334 | Ga0068869_100235469 | Ga0068869_1002354692 | 306 |
| 189 | 3300014326 | Ga0157380_10537572 | Ga0157380_105375722 | 306 |
| 190 | 3300028577 | Ga0265318_10010190 | Ga0265318_100101904 | 307 |
| 191 | 3300031235 | Ga0265330_10020216 | Ga0265330_100202164 | 307 |
| 192 | 3300031242 | Ga0265329_10023207 | Ga0265329_100232072 | 307 |
| 193 | 3300031247 | Ga0265340_10002924 | Ga0265340_100029249 | 307 |
| 194 | 3300031249 | Ga0265339_10009320 | Ga0265339_100093208 | 307 |
| 195 | 3300031250 | Ga0265331_10038705 | Ga0265331_100387052 | 307 |
| 196 | 3300031344 | Ga0265316_10026116 | Ga0265316_100261164 | 307 |
| 197 | 3300031595 | Ga0265313_10038029 | Ga0265313_100380293 | 307 |
| 198 | 3300031711 | Ga0265314_10064629 | Ga0265314_100646292 | 307 |
| 199 | 3300031712 | Ga0265342_10037995 | Ga0265342_100379951 | 307 |
| 200 | 3300005328 | Ga0070676_10020980 | Ga0070676_100209802 | 308 |
| 201 | 3300005343 | Ga0070687_100078543 | Ga0070687_1000785432 | 308 |
| 202 | 3300005353 | Ga0070669_100038543 | Ga0070669_1000385431 | 308 |
| 203 | 3300005354 | Ga0070675_100495057 | Ga0070675_1004950571 | 308 |
| 204 | 3300005355 | Ga0070671_100100518 | Ga0070671_1001005182 | 308 |
| 205 | 3300005439 | Ga0070711_100091039 | Ga0070711_1000910391 | 308 |
| 206 | 3300005458 | Ga0070681_10436233 | Ga0070681_104362332 | 308 |
| 207 | 3300005543 | Ga0070672_100121769 | Ga0070672_1001217691 | 308 |
| 208 | 3300005617 | Ga0068859_100247647 | Ga0068859_1002476472 | 308 |
| 209 | 3300005842 | Ga0068858_100150298 | Ga0068858_1001502982 | 308 |
| 210 | 3300005843 | Ga0068860_100379873 | Ga0068860_1003798732 | 308 |
| 211 | 3300006038 | Ga0075365_10225635 | Ga0075365_102256351 | 308 |
| 212 | 3300006871 | Ga0075434_100145571 | Ga0075434_1001455712 | 308 |
| 213 | 3300006881 | Ga0068865_100078367 | Ga0068865_1000783672 | 308 |
| 214 | 3300006931 | Ga0097620_100247649 | Ga0097620_1002476492 | 308 |
| 215 | 3300009553 | Ga0105249_10441238 | Ga0105249_104412382 | 308 |
| 216 | 3300013100 | Ga0157373_10062875 | Ga0157373_100628752 | 308 |
| 217 | 3300013306 | Ga0163162_10147815 | Ga0163162_101478152 | 308 |
| 218 | 3300013306 | Ga0163162_10354099 | Ga0163162_103540992 | 308 |
| 219 | 3300014325 | Ga0163163_10187980 | Ga0163163_101879802 | 308 |
| 220 | 3300014326 | Ga0157380_10189714 | Ga0157380_101897142 | 308 |
| 221 | 3300017792 | Ga0163161_10067121 | Ga0163161_100671212 | 308 |
| 222 | 3300017792 | Ga0163161_10206041 | Ga0163161_102060412 | 308 |
| 223 | 3300025297 | Ga0209758_1000569 | Ga0209758_100056923 | 308 |
| 224 | 3300025297 | Ga0209758_1040673 | Ga0209758_10406732 | 308 |
| 225 | 3300025907 | Ga0207645_10023007 | Ga0207645_100230073 | 308 |
| 226 | 3300025918 | Ga0207662_10085916 | Ga0207662_100859162 | 308 |
| 227 | 3300025923 | Ga0207681_10091313 | Ga0207681_100913131 | 308 |
| 228 | 3300025925 | Ga0207650_10299777 | Ga0207650_102997772 | 308 |
| 229 | 3300025926 | Ga0207659_10080425 | Ga0207659_100804253 | 308 |
| 230 | 3300025929 | Ga0207664_10135847 | Ga0207664_101358472 | 308 |
| 231 | 3300025931 | Ga0207644_10138860 | Ga0207644_101388602 | 308 |
| 232 | 3300025934 | Ga0207686_10154470 | Ga0207686_101544701 | 308 |
| 233 | 3300025939 | Ga0207665_10118141 | Ga0207665_101181411 | 308 |
| 234 | 3300025940 | Ga0207691_10087419 | Ga0207691_100874191 | 308 |
| 235 | 3300025941 | Ga0207711_10004928 | Ga0207711_1000492812 | 308 |
| 236 | 3300026075 | Ga0207708_10056648 | Ga0207708_100566482 | 308 |
| 237 | 3300026075 | Ga0207708_10381057 | Ga0207708_103810572 | 308 |
| 238 | 3300031241 | Ga0265325_10042630 | Ga0265325_100426302 | 308 |
| 239 | 3300031344 | Ga0265316_10129965 | Ga0265316_101299651 | 308 |
| 240 | 3300034957 | Ga0373938_0003245 | Ga0373938_0003245_1270_2196 | 308 |
| 241 | 3300035089 | Ga0373944_0007656 | Ga0373944_0007656_1039_1965 | 308 |
| 242 | 3300035111 | Ga0373923_0000919 | Ga0373923_0000919_176_1102 | 308 |
| 243 | 3300035113 | Ga0373936_0002231 | Ga0373936_0002231_5609_6535 | 308 |
| 244 | 3300035116 | Ga0373945_0002741 | Ga0373945_0002741_3219_4145 | 308 |
| 245 | 3300035117 | Ga0373953_0001774 | Ga0373953_0001774_2059_2985 | 308 |
| 246 | 3300035170 | Ga0373943_0017222 | Ga0373943_0017222_1572_2498 | 308 |
| 247 | 3300035171 | Ga0373946_0002835 | Ga0373946_0002835_4878_5804 | 308 |
| 248 | 3300035172 | Ga0373955_0000643 | Ga0373955_0000643_2583_3509 | 308 |
| 249 | 3300035410 | Ga0373924_0000604 | Ga0373924_0000604_6321_7247 | 308 |
| 250 | 3300035691 | Ga0373931_0000933 | Ga0373931_0000933_1173_2099 | 308 |
| 251 | 3300035692 | Ga0373935_0000075 | Ga0373935_0000075_14517_15443 | 308 |
| 252 | 3300035692 | Ga0373935_0141812 | Ga0373935_0141812_279_1205 | 308 |
| 253 | 3300035695 | Ga0373927_0003619 | Ga0373927_0003619_8177_9103 | 308 |
| 254 | 3300035725 | Ga0373947_0000138 | Ga0373947_0000138_25239_26165 | 308 |
| 255 | 3300035725 | Ga0373947_0072794 | Ga0373947_0072794_180_1106 | 308 |
| 256 | 3300036401 | Ga0373937_0000057 | Ga0373937_0000057_91633_92559 | 308 |
| 257 | 3300037068 | Ga0373925_0000078 | Ga0373925_0000078_26793_27719 | 308 |
| 258 | 3300037068 | Ga0373925_0368177 | Ga0373925_0368177_193_1119 | 308 |
| 259 | 3300046454 | Ga0495592_0000233 | Ga0495592_0000233_13743_14669 | 308 |
| 260 | 3300046459 | Ga0495629_0003366 | Ga0495629_0003366_2459_3385 | 308 |
| 261 | 3300046462 | Ga0495651_0002019 | Ga0495651_0002019_2474_3400 | 308 |
| 262 | 3300046463 | Ga0495653_0000464 | Ga0495653_0000464_26433_27359 | 308 |
| 263 | 3300046477 | Ga0495664_0000023 | Ga0495664_0000023_25649_26575 | 308 |
| 264 | 3300046511 | Ga0495608_0000030 | Ga0495608_0000030_25370_26296 | 308 |
| 265 | 3300046514 | Ga0495618_0000585 | Ga0495618_0000585_4107_5033 | 308 |
| 266 | 3300046516 | Ga0495628_0000027 | Ga0495628_0000027_100210_101136 | 308 |
| 267 | 3300046517 | Ga0495630_0006673 | Ga0495630_0006673_4010_4936 | 308 |
| 268 | 3300046529 | Ga0495652_0000041 | Ga0495652_0000041_25361_26287 | 308 |
| 269 | 3300046533 | Ga0495640_0000056 | Ga0495640_0000056_35641_36567 | 308 |
| 270 | 3300046536 | Ga0495587_0000025 | Ga0495587_0000025_119810_120736 | 308 |
| 271 | 3300046543 | Ga0495645_0000001 | Ga0495645_0000001_631649_632575 | 308 |
| 272 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_733149_734075 | 308 |
| 273 | 3300046642 | Ga0495634_0028035 | Ga0495634_0028035_1490_2416 | 308 |
| 274 | 3300046663 | Ga0495635_0000077 | Ga0495635_0000077_33985_34911 | 308 |
| 275 | 3300046675 | Ga0495657_0000390 | Ga0495657_0000390_21356_22282 | 308 |
| 276 | 3300046678 | Ga0495599_0000021 | Ga0495599_0000021_100757_101683 | 308 |
| 277 | 3300046679 | Ga0495623_0000141 | Ga0495623_0000141_9124_10050 | 308 |
| 278 | 3300046680 | Ga0495646_0000051 | Ga0495646_0000051_24393_25319 | 308 |
| 279 | 3300046683 | Ga0495658_0131855 | Ga0495658_0131855_437_1363 | 308 |
| 280 | 3300046689 | Ga0495613_0008553 | Ga0495613_0008553_1111_2037 | 308 |
| 281 | 3300046690 | Ga0495624_0030238 | Ga0495624_0030238_2298_3224 | 308 |
| 282 | 3300046809 | Ga0495600_0000114 | Ga0495600_0000114_18443_19369 | 308 |
| 283 | 3300047317 | Ga0495604_0000036 | Ga0495604_0000036_100228_101154 | 308 |
| 284 | 3300047319 | Ga0495674_0000102 | Ga0495674_0000102_35167_36093 | 308 |
| 285 | 3300047322 | Ga0495680_0001061 | Ga0495680_0001061_25446_26372 | 308 |
| 286 | 3300047444 | Ga0495675_0000148 | Ga0495675_0000148_24120_25046 | 308 |
| 287 | 3300047471 | Ga0495684_0000025 | Ga0495684_0000025_25879_26805 | 308 |
| 288 | 3300047673 | Ga0495593_0011539 | Ga0495593_0011539_3253_4179 | 308 |
| 289 | 3300048088 | Ga0495602_0000311 | Ga0495602_0000311_18688_19614 | 308 |
| 290 | 3300048088 | Ga0495602_0149661 | Ga0495602_0149661_34_960 | 308 |
| 291 | 3300048907 | Ga0496104_0032419 | Ga0496104_0032419_3887_4813 | 308 |
| 292 | 3300048908 | Ga0496105_0005561 | Ga0496105_0005561_3955_4881 | 308 |
| 293 | 3300048909 | Ga0496106_0073336 | Ga0496106_0073336_680_1606 | 308 |
| 294 | 3300048912 | Ga0496109_0133580 | Ga0496109_0133580_36_962 | 308 |
| 295 | 3300048913 | Ga0496110_0022421 | Ga0496110_0022421_1836_2762 | 308 |
| 296 | 3300048917 | Ga0496114_0225814 | Ga0496114_0225814_636_1562 | 308 |
| 297 | 3300048918 | Ga0496115_0000855 | Ga0496115_0000855_20143_21069 | 308 |
| 298 | 3300050492 | nmdc:mga0yw44_141469_c1 | nmdc:mga0yw44_141469_c1_319_1245 | 308 |
| 299 | 3300050512 | nmdc:mga0n895_90699_c1 | nmdc:mga0n895_90699_c1_961_1887 | 308 |
| 300 | 3300053077 | Ga0495601_0000025 | Ga0495601_0000025_100211_101137 | 308 |
| 301 | 3300053078 | Ga0495612_0000046 | Ga0495612_0000046_25467_26393 | 308 |
| 302 | 3300053083 | Ga0495655_0006491 | Ga0495655_0006491_508_1434 | 308 |
| 303 | 3300053084 | Ga0495595_0000054 | Ga0495595_0000054_25524_26450 | 308 |
| 304 | 3300053085 | Ga0495619_0000035 | Ga0495619_0000035_100233_101159 | 308 |
| 305 | 3300005437 | Ga0070710_10208523 | Ga0070710_102085232 | 309 |
| 306 | 3300005439 | Ga0070711_100048327 | Ga0070711_1000483272 | 309 |
| 307 | 3300007076 | Ga0075435_100028540 | Ga0075435_1000285403 | 309 |
| 308 | 3300009093 | Ga0105240_10408797 | Ga0105240_104087972 | 309 |
| 309 | 3300025898 | Ga0207692_10235758 | Ga0207692_102357581 | 309 |
| 310 | 3300025915 | Ga0207693_10016164 | Ga0207693_100161646 | 309 |
| 311 | 3300028023 | Ga0265357_1000316 | Ga0265357_10003163 | 309 |
| 312 | 3300028379 | Ga0268266_10284625 | Ga0268266_102846251 | 309 |
| 313 | 3300031090 | Ga0265760_10016365 | Ga0265760_100163652 | 309 |
| 314 | 3300036401 | Ga0373937_0466026 | Ga0373937_0466026_93_1022 | 309 |
| 315 | 3300037068 | Ga0373925_0031612 | Ga0373925_0031612_2932_3861 | 309 |
| 316 | 3300046559 | Ga0495667_0109000 | Ga0495667_0109000_52_981 | 309 |
| 317 | 3300046675 | Ga0495657_0266054 | Ga0495657_0266054_68_997 | 309 |
| 318 | 3300050511 | nmdc:mga08y16_238840_c1 | nmdc:mga08y16_238840_c1_35_964 | 309 |
| 319 | 3300050513 | nmdc:mga0rr50_14446_c1 | nmdc:mga0rr50_14446_c1_1760_2689 | 309 |
| 320 | 3300005329 | Ga0070683_100285309 | Ga0070683_1002853092 | 310 |
| 321 | 3300006844 | Ga0075428_100084138 | Ga0075428_1000841382 | 310 |
| 322 | 3300006846 | Ga0075430_100094974 | Ga0075430_1000949742 | 310 |
| 323 | 3300006847 | Ga0075431_100115216 | Ga0075431_1001152162 | 310 |
| 324 | 3300006914 | Ga0075436_100012722 | Ga0075436_1000127224 | 310 |
| 325 | 3300007076 | Ga0075435_100281005 | Ga0075435_1002810051 | 310 |
| 326 | 3300025906 | Ga0207699_10269612 | Ga0207699_102696121 | 310 |
| 327 | 3300025944 | Ga0207661_10119454 | Ga0207661_101194542 | 310 |
| 328 | 3300050514 | nmdc:mga08x19_4336_c1 | nmdc:mga08x19_4336_c1_4066_4998 | 310 |
| 329 | 3300001915 | JGI24741J21665_1010919 | JGI24741J21665_10109192 | 311 |
| 330 | 3300001977 | JGI24746J21847_1000172 | JGI24746J21847_100017210 | 311 |
| 331 | 3300002126 | JGI24035J26624_1000008 | JGI24035J26624_10000082 | 311 |
| 332 | 3300002126 | JGI24035J26624_1000030 | JGI24035J26624_10000304 | 311 |
| 333 | 3300002459 | JGI24751J29686_10005576 | JGI24751J29686_100055762 | 311 |
| 334 | 3300003371 | JGI26145J50221_1002475 | JGI26145J50221_10024752 | 311 |
| 335 | 3300005290 | Ga0065712_10069581 | Ga0065712_100695812 | 311 |
| 336 | 3300005293 | Ga0065715_10090800 | Ga0065715_100908009 | 311 |
| 337 | 3300005328 | Ga0070676_10000036 | Ga0070676_1000003638 | 311 |
| 338 | 3300005330 | Ga0070690_100001849 | Ga0070690_1000018492 | 311 |
| 339 | 3300005333 | Ga0070677_10000104 | Ga0070677_100001046 | 311 |
| 340 | 3300005334 | Ga0068869_100000087 | Ga0068869_10000008719 | 311 |
| 341 | 3300005338 | Ga0068868_100025389 | Ga0068868_1000253895 | 311 |
| 342 | 3300005339 | Ga0070660_100006206 | Ga0070660_1000062069 | 311 |
| 343 | 3300005340 | Ga0070689_100000963 | Ga0070689_1000009632 | 311 |
| 344 | 3300005343 | Ga0070687_100000245 | Ga0070687_10000024520 | 311 |
| 345 | 3300005344 | Ga0070661_100000017 | Ga0070661_100000017106 | 311 |
| 346 | 3300005353 | Ga0070669_100000217 | Ga0070669_10000021716 | 311 |
| 347 | 3300005354 | Ga0070675_100000088 | Ga0070675_10000008819 | 311 |
| 348 | 3300005355 | Ga0070671_100000768 | Ga0070671_10000076818 | 311 |
| 349 | 3300005365 | Ga0070688_100000084 | Ga0070688_10000008413 | 311 |
| 350 | 3300005365 | Ga0070688_100193923 | Ga0070688_1001939232 | 311 |
| 351 | 3300005366 | Ga0070659_100000252 | Ga0070659_10000025212 | 311 |
| 352 | 3300005434 | Ga0070709_10047656 | Ga0070709_100476562 | 311 |
| 353 | 3300005435 | Ga0070714_100114788 | Ga0070714_1001147882 | 311 |
| 354 | 3300005436 | Ga0070713_100002359 | Ga0070713_1000023594 | 311 |
| 355 | 3300005436 | Ga0070713_100087274 | Ga0070713_1000872742 | 311 |
| 356 | 3300005436 | Ga0070713_100088931 | Ga0070713_1000889312 | 311 |
| 357 | 3300005436 | Ga0070713_100111681 | Ga0070713_1001116812 | 311 |
| 358 | 3300005438 | Ga0070701_10026873 | Ga0070701_100268734 | 311 |
| 359 | 3300005439 | Ga0070711_100289900 | Ga0070711_1002899002 | 311 |
| 360 | 3300005441 | Ga0070700_100000370 | Ga0070700_10000037018 | 311 |
| 361 | 3300005445 | Ga0070708_100098455 | Ga0070708_1000984552 | 311 |
| 362 | 3300005455 | Ga0070663_100000415 | Ga0070663_1000004157 | 311 |
| 363 | 3300005456 | Ga0070678_100000053 | Ga0070678_10000005342 | 311 |
| 364 | 3300005458 | Ga0070681_10326374 | Ga0070681_103263742 | 311 |
| 365 | 3300005530 | Ga0070679_100000679 | Ga0070679_10000067930 | 311 |
| 366 | 3300005530 | Ga0070679_100112073 | Ga0070679_1001120732 | 311 |
| 367 | 3300005535 | Ga0070684_100000144 | Ga0070684_10000014460 | 311 |
| 368 | 3300005543 | Ga0070672_100000014 | Ga0070672_10000001438 | 311 |
| 369 | 3300005544 | Ga0070686_100000754 | Ga0070686_10000075421 | 311 |
| 370 | 3300005547 | Ga0070693_100000141 | Ga0070693_10000014117 | 311 |
| 371 | 3300005548 | Ga0070665_100294999 | Ga0070665_1002949992 | 311 |
| 372 | 3300005549 | Ga0070704_100096887 | Ga0070704_1000968872 | 311 |
| 373 | 3300005563 | Ga0068855_100009106 | Ga0068855_1000091069 | 311 |
| 374 | 3300005564 | Ga0070664_100000816 | Ga0070664_10000081619 | 311 |
| 375 | 3300005564 | Ga0070664_100053558 | Ga0070664_1000535584 | 311 |
| 376 | 3300005577 | Ga0068857_100000567 | Ga0068857_10000056726 | 311 |
| 377 | 3300005578 | Ga0068854_100000168 | Ga0068854_1000001688 | 311 |
| 378 | 3300005614 | Ga0068856_100143631 | Ga0068856_1001436312 | 311 |
| 379 | 3300005616 | Ga0068852_100002066 | Ga0068852_10000206612 | 311 |
| 380 | 3300005618 | Ga0068864_100000980 | Ga0068864_10000098021 | 311 |
| 381 | 3300005718 | Ga0068866_10000264 | Ga0068866_1000026419 | 311 |
| 382 | 3300005719 | Ga0068861_100000315 | Ga0068861_10000031527 | 311 |
| 383 | 3300005840 | Ga0068870_10000002 | Ga0068870_1000000266 | 311 |
| 384 | 3300005841 | Ga0068863_100001290 | Ga0068863_10000129021 | 311 |
| 385 | 3300005842 | Ga0068858_100000356 | Ga0068858_10000035636 | 311 |
| 386 | 3300005843 | Ga0068860_100000747 | Ga0068860_1000007478 | 311 |
| 387 | 3300005844 | Ga0068862_100002002 | Ga0068862_1000020022 | 311 |
| 388 | 3300005937 | Ga0081455_10000048 | Ga0081455_10000048122 | 311 |
| 389 | 3300006028 | Ga0070717_10009878 | Ga0070717_100098788 | 311 |
| 390 | 3300006173 | Ga0070716_100121550 | Ga0070716_1001215502 | 311 |
| 391 | 3300006175 | Ga0070712_100029497 | Ga0070712_1000294974 | 311 |
| 392 | 3300006175 | Ga0070712_100081098 | Ga0070712_1000810982 | 311 |
| 393 | 3300006175 | Ga0070712_100178419 | Ga0070712_1001784191 | 311 |
| 394 | 3300006178 | Ga0075367_10012917 | Ga0075367_100129176 | 311 |
| 395 | 3300006237 | Ga0097621_100000144 | Ga0097621_10000014427 | 311 |
| 396 | 3300006358 | Ga0068871_100000110 | Ga0068871_10000011019 | 311 |
| 397 | 3300006852 | Ga0075433_10026099 | Ga0075433_100260991 | 311 |
| 398 | 3300006871 | Ga0075434_100000084 | Ga0075434_10000008412 | 311 |
| 399 | 3300006871 | Ga0075434_100043477 | Ga0075434_1000434772 | 311 |
| 400 | 3300006881 | Ga0068865_100000066 | Ga0068865_10000006620 | 311 |
| 401 | 3300007076 | Ga0075435_100077114 | Ga0075435_1000771144 | 311 |
| 402 | 3300009094 | Ga0111539_10000652 | Ga0111539_1000065229 | 311 |
| 403 | 3300009174 | Ga0105241_10106605 | Ga0105241_101066053 | 311 |
| 404 | 3300014968 | Ga0157379_10364183 | Ga0157379_103641831 | 311 |
| 405 | 3300017792 | Ga0163161_10000739 | Ga0163161_1000073922 | 311 |
| 406 | 3300025271 | Ga0207666_1000005 | Ga0207666_100000521 | 311 |
| 407 | 3300025290 | Ga0207673_1007698 | Ga0207673_10076982 | 311 |
| 408 | 3300025315 | Ga0207697_10000011 | Ga0207697_100000119 | 311 |
| 409 | 3300025893 | Ga0207682_10000051 | Ga0207682_1000005149 | 311 |
| 410 | 3300025899 | Ga0207642_10000176 | Ga0207642_1000017610 | 311 |
| 411 | 3300025900 | Ga0207710_10001284 | Ga0207710_100012846 | 311 |
| 412 | 3300025901 | Ga0207688_10000001 | Ga0207688_1000000149 | 311 |
| 413 | 3300025903 | Ga0207680_10002846 | Ga0207680_1000284610 | 311 |
| 414 | 3300025904 | Ga0207647_10001714 | Ga0207647_100017149 | 311 |
| 415 | 3300025906 | Ga0207699_10008926 | Ga0207699_100089264 | 311 |
| 416 | 3300025906 | Ga0207699_10345010 | Ga0207699_103450101 | 311 |
| 417 | 3300025907 | Ga0207645_10000121 | Ga0207645_100001213 | 311 |
| 418 | 3300025908 | Ga0207643_10000009 | Ga0207643_1000000988 | 311 |
| 419 | 3300025911 | Ga0207654_10001894 | Ga0207654_100018948 | 311 |
| 420 | 3300025912 | Ga0207707_10000840 | Ga0207707_100008408 | 311 |
| 421 | 3300025913 | Ga0207695_10168202 | Ga0207695_101682022 | 311 |
| 422 | 3300025914 | Ga0207671_10007485 | Ga0207671_1000748512 | 311 |
| 423 | 3300025915 | Ga0207693_10009486 | Ga0207693_100094864 | 311 |
| 424 | 3300025915 | Ga0207693_10086779 | Ga0207693_100867791 | 311 |
| 425 | 3300025915 | Ga0207693_10187356 | Ga0207693_101873562 | 311 |
| 426 | 3300025917 | Ga0207660_10000775 | Ga0207660_1000077512 | 311 |
| 427 | 3300025917 | Ga0207660_10115673 | Ga0207660_101156731 | 311 |
| 428 | 3300025918 | Ga0207662_10004796 | Ga0207662_100047966 | 311 |
| 429 | 3300025919 | Ga0207657_10002826 | Ga0207657_1000282620 | 311 |
| 430 | 3300025920 | Ga0207649_10000052 | Ga0207649_1000005242 | 311 |
| 431 | 3300025921 | Ga0207652_10000508 | Ga0207652_1000050826 | 311 |
| 432 | 3300025923 | Ga0207681_10000035 | Ga0207681_10000035119 | 311 |
| 433 | 3300025925 | Ga0207650_10000843 | Ga0207650_100008434 | 311 |
| 434 | 3300025926 | Ga0207659_10000027 | Ga0207659_1000002719 | 311 |
| 435 | 3300025927 | Ga0207687_10000231 | Ga0207687_1000023125 | 311 |
| 436 | 3300025928 | Ga0207700_10056459 | Ga0207700_100564592 | 311 |
| 437 | 3300025928 | Ga0207700_10103773 | Ga0207700_101037732 | 311 |
| 438 | 3300025928 | Ga0207700_10113292 | Ga0207700_101132922 | 311 |
| 439 | 3300025931 | Ga0207644_10000676 | Ga0207644_1000067612 | 311 |
| 440 | 3300025932 | Ga0207690_10000148 | Ga0207690_100001486 | 311 |
| 441 | 3300025933 | Ga0207706_10000261 | Ga0207706_1000026145 | 311 |
| 442 | 3300025934 | Ga0207686_10000171 | Ga0207686_1000017117 | 311 |
| 443 | 3300025935 | Ga0207709_10000087 | Ga0207709_10000087121 | 311 |
| 444 | 3300025936 | Ga0207670_10000169 | Ga0207670_1000016918 | 311 |
| 445 | 3300025937 | Ga0207669_10000351 | Ga0207669_1000035117 | 311 |
| 446 | 3300025938 | Ga0207704_10108023 | Ga0207704_101080232 | 311 |
| 447 | 3300025940 | Ga0207691_10000106 | Ga0207691_1000010657 | 311 |
| 448 | 3300025941 | Ga0207711_10002556 | Ga0207711_1000255610 | 311 |
| 449 | 3300025942 | Ga0207689_10000031 | Ga0207689_1000003128 | 311 |
| 450 | 3300025944 | Ga0207661_10000219 | Ga0207661_1000021925 | 311 |
| 451 | 3300025944 | Ga0207661_10409559 | Ga0207661_104095592 | 311 |
| 452 | 3300025945 | Ga0207679_10000493 | Ga0207679_1000049312 | 311 |
| 453 | 3300025945 | Ga0207679_10156400 | Ga0207679_101564002 | 311 |
| 454 | 3300025949 | Ga0207667_10006216 | Ga0207667_100062164 | 311 |
| 455 | 3300025949 | Ga0207667_10369955 | Ga0207667_103699551 | 311 |
| 456 | 3300025960 | Ga0207651_10001402 | Ga0207651_1000140210 | 311 |
| 457 | 3300025961 | Ga0207712_10000176 | Ga0207712_1000017640 | 311 |
| 458 | 3300025972 | Ga0207668_10000191 | Ga0207668_1000019139 | 311 |
| 459 | 3300025981 | Ga0207640_10000126 | Ga0207640_1000012630 | 311 |
| 460 | 3300025986 | Ga0207658_10007487 | Ga0207658_100074874 | 311 |
| 461 | 3300026023 | Ga0207677_10148612 | Ga0207677_101486121 | 311 |
| 462 | 3300026035 | Ga0207703_10006871 | Ga0207703_100068716 | 311 |
| 463 | 3300026041 | Ga0207639_10000515 | Ga0207639_1000051517 | 311 |
| 464 | 3300026067 | Ga0207678_10000137 | Ga0207678_1000013757 | 311 |
| 465 | 3300026075 | Ga0207708_10000250 | Ga0207708_100002503 | 311 |
| 466 | 3300026078 | Ga0207702_10001067 | Ga0207702_1000106728 | 311 |
| 467 | 3300026088 | Ga0207641_10000937 | Ga0207641_1000093720 | 311 |
| 468 | 3300026089 | Ga0207648_10000125 | Ga0207648_1000012557 | 311 |
| 469 | 3300026095 | Ga0207676_10001547 | Ga0207676_100015478 | 311 |
| 470 | 3300026095 | Ga0207676_10283061 | Ga0207676_102830612 | 311 |
| 471 | 3300026116 | Ga0207674_10000095 | Ga0207674_1000009558 | 311 |
| 472 | 3300026118 | Ga0207675_100000140 | Ga0207675_10000014057 | 311 |
| 473 | 3300026121 | Ga0207683_10000178 | Ga0207683_1000017845 | 311 |
| 474 | 3300026142 | Ga0207698_10001736 | Ga0207698_100017366 | 311 |
| 475 | 3300027617 | Ga0210002_1000669 | Ga0210002_10006693 | 311 |
| 476 | 3300027682 | Ga0209971_1004192 | Ga0209971_10041922 | 311 |
| 477 | 3300027876 | Ga0209974_10001253 | Ga0209974_100012538 | 311 |
| 478 | 3300027907 | Ga0207428_10000037 | Ga0207428_10000037143 | 311 |
| 479 | 3300027907 | Ga0207428_10160821 | Ga0207428_101608211 | 311 |
| 480 | 3300028379 | Ga0268266_10165528 | Ga0268266_101655282 | 311 |
| 481 | 3300028380 | Ga0268265_10000774 | Ga0268265_100007745 | 311 |
| 482 | 3300028381 | Ga0268264_10000467 | Ga0268264_1000046723 | 311 |
| 483 | 3300031241 | Ga0265325_10000049 | Ga0265325_1000004972 | 311 |
| 484 | 3300031249 | Ga0265339_10000269 | Ga0265339_1000026937 | 311 |
| 485 | 3300031595 | Ga0265313_10107202 | Ga0265313_101072022 | 311 |
| 486 | 3300035112 | Ga0373932_0034846 | Ga0373932_0034846_43_978 | 311 |
| 487 | 3300035113 | Ga0373936_0005828 | Ga0373936_0005828_3403_4338 | 311 |
| 488 | 3300035170 | Ga0373943_0018775 | Ga0373943_0018775_758_1693 | 311 |
| 489 | 3300035171 | Ga0373946_0017700 | Ga0373946_0017700_850_1785 | 311 |
| 490 | 3300035172 | Ga0373955_0023393 | Ga0373955_0023393_954_1889 | 311 |
| 491 | 3300035691 | Ga0373931_0175515 | Ga0373931_0175515_159_1094 | 311 |
| 492 | 3300035692 | Ga0373935_0013888 | Ga0373935_0013888_2463_3398 | 311 |
| 493 | 3300035692 | Ga0373935_0185291 | Ga0373935_0185291_127_1062 | 311 |
| 494 | 3300035695 | Ga0373927_0024002 | Ga0373927_0024002_1988_2923 | 311 |
| 495 | 3300035725 | Ga0373947_0012882 | Ga0373947_0012882_2191_3126 | 311 |
| 496 | 3300044694 | Ga0466963_0100415 | Ga0466963_0100415_447_1382 | 311 |
| 497 | 3300044842 | Ga0466957_0080092 | Ga0466957_0080092_1047_1982 | 311 |
| 498 | 3300046455 | Ga0495603_0014219 | Ga0495603_0014219_2191_3126 | 311 |
| 499 | 3300046473 | Ga0495582_0006057 | Ga0495582_0006057_2484_3419 | 311 |
| 500 | 3300046516 | Ga0495628_0027611 | Ga0495628_0027611_2666_3601 | 311 |
| 501 | 3300046526 | Ga0495666_0143711 | Ga0495666_0143711_101_1036 | 311 |
| 502 | 3300046536 | Ga0495587_0016528 | Ga0495587_0016528_1415_2350 | 311 |
| 503 | 3300046543 | Ga0495645_0000848 | Ga0495645_0000848_2326_3261 | 311 |
| 504 | 3300046675 | Ga0495657_0097408 | Ga0495657_0097408_513_1448 | 311 |
| 505 | 3300046678 | Ga0495599_0007257 | Ga0495599_0007257_1263_2198 | 311 |
| 506 | 3300046679 | Ga0495623_0058657 | Ga0495623_0058657_1283_2218 | 311 |
| 507 | 3300046689 | Ga0495613_0045741 | Ga0495613_0045741_513_1448 | 311 |
| 508 | 3300047319 | Ga0495674_0155901 | Ga0495674_0155901_357_1292 | 311 |
| 509 | 3300047321 | Ga0495676_0058309 | Ga0495676_0058309_823_1758 | 311 |
| 510 | 3300047322 | Ga0495680_0036206 | Ga0495680_0036206_1213_2148 | 311 |
| 511 | 3300048088 | Ga0495602_0033768 | Ga0495602_0033768_3050_3985 | 311 |
| 512 | 3300048907 | Ga0496104_0000215 | Ga0496104_0000215_29312_30247 | 311 |
| 513 | 3300048908 | Ga0496105_0013570 | Ga0496105_0013570_2956_3891 | 311 |
| 514 | 3300049568 | Ga0501031_0014196 | Ga0501031_0014196_3668_4603 | 311 |
| 515 | 3300049575 | Ga0501039_0018275 | Ga0501039_0018275_840_1775 | 311 |
| 516 | 3300049576 | Ga0501040_0173808 | Ga0501040_0173808_184_1119 | 311 |
| 517 | 3300049578 | Ga0501042_0153894 | Ga0501042_0153894_485_1420 | 311 |
| 518 | 3300049582 | Ga0501048_0006384 | Ga0501048_0006384_3723_4658 | 311 |
| 519 | 3300049583 | Ga0501067_0051208 | Ga0501067_0051208_501_1436 | 311 |
| 520 | 3300049587 | Ga0501071_0015093 | Ga0501071_0015093_3672_4607 | 311 |
| 521 | 3300049593 | Ga0501077_0119622 | Ga0501077_0119622_207_1142 | 311 |
| 522 | 3300053077 | Ga0495601_0010538 | Ga0495601_0010538_4074_5009 | 311 |
| 523 | 3300053077 | Ga0495601_0041999 | Ga0495601_0041999_356_1291 | 311 |
| 524 | 3300053078 | Ga0495612_0006780 | Ga0495612_0006780_3415_4350 | 311 |
| 525 | 3300060353 | Ga0501082_0244594 | Ga0501082_0244594_18_953 | 311 |
| 526 | 3300005434 | Ga0070709_10010014 | Ga0070709_100100142 | 312 |
| 527 | 3300005439 | Ga0070711_100093628 | Ga0070711_1000936281 | 312 |
| 528 | 3300006028 | Ga0070717_10093129 | Ga0070717_100931292 | 312 |
| 529 | 3300006163 | Ga0070715_10000513 | Ga0070715_1000051310 | 312 |
| 530 | 3300006173 | Ga0070716_100056116 | Ga0070716_1000561162 | 312 |
| 531 | 3300006871 | Ga0075434_100359687 | Ga0075434_1003596872 | 312 |
| 532 | 3300009094 | Ga0111539_10515911 | Ga0111539_105159112 | 312 |
| 533 | 3300025906 | Ga0207699_10088943 | Ga0207699_100889432 | 312 |
| 534 | 3300025939 | Ga0207665_10152955 | Ga0207665_101529551 | 312 |
| 535 | 3300048903 | Ga0496100_0003748 | Ga0496100_0003748_1335_2276 | 313 |
| 536 | 3300048904 | Ga0496101_0001763 | Ga0496101_0001763_464_1405 | 313 |
| 537 | 3300048905 | Ga0496102_0011817 | Ga0496102_0011817_855_1796 | 313 |
| 538 | 3300048906 | Ga0496103_0165242 | Ga0496103_0165242_322_1263 | 313 |
| 539 | 3300048907 | Ga0496104_0002323 | Ga0496104_0002323_5145_6086 | 313 |
| 540 | 3300048908 | Ga0496105_0188686 | Ga0496105_0188686_447_1388 | 313 |
| 541 | 3300048909 | Ga0496106_0060648 | Ga0496106_0060648_1356_2297 | 313 |
| 542 | 3300048910 | Ga0496107_0010740 | Ga0496107_0010740_4883_5824 | 313 |
| 543 | 3300048911 | Ga0496108_0010986 | Ga0496108_0010986_5768_6709 | 313 |
| 544 | 3300048912 | Ga0496109_0009764 | Ga0496109_0009764_1499_2440 | 313 |
| 545 | 3300048912 | Ga0496109_0016348 | Ga0496109_0016348_173_1114 | 313 |
| 546 | 3300048913 | Ga0496110_0002430 | Ga0496110_0002430_6510_7451 | 313 |
| 547 | 3300048913 | Ga0496110_0008784 | Ga0496110_0008784_1451_2392 | 313 |
| 548 | 3300048914 | Ga0496111_0003314 | Ga0496111_0003314_6898_7839 | 313 |
| 549 | 3300048915 | Ga0496112_0008924 | Ga0496112_0008924_3022_3963 | 313 |
| 550 | 3300048916 | Ga0496113_0017290 | Ga0496113_0017290_2956_3897 | 313 |
| 551 | 3300050511 | nmdc:mga08y16_63655_c1 | nmdc:mga08y16_63655_c1_341_1294 | 316 |
| 552 | 3300050512 | nmdc:mga0n895_2692_c1 | nmdc:mga0n895_2692_c1_3456_4409 | 316 |
| 553 | 3300050515 | nmdc:mga0a205_2030_c1 | nmdc:mga0a205_2030_c1_12644_13597 | 316 |
| 554 | 3300009101 | Ga0105247_10120013 | Ga0105247_101200132 | 318 |
| 555 | 3300009551 | Ga0105238_10181825 | Ga0105238_101818252 | 318 |
| 556 | 3300014968 | Ga0157379_10432425 | Ga0157379_104324251 | 318 |
| 557 | 3300046459 | Ga0495629_0015321 | Ga0495629_0015321_3723_4688 | 318 |
| 558 | 3300046473 | Ga0495582_0104532 | Ga0495582_0104532_404_1369 | 318 |
| 559 | 3300046663 | Ga0495635_0010039 | Ga0495635_0010039_537_1502 | 318 |
| 560 | 3300047317 | Ga0495604_0193338 | Ga0495604_0193338_114_1079 | 318 |
| 561 | 3300047322 | Ga0495680_0065048 | Ga0495680_0065048_1618_2583 | 318 |
| 562 | 3300047471 | Ga0495684_0045604 | Ga0495684_0045604_1484_2449 | 318 |
| 563 | 3300048911 | Ga0496108_0008895 | Ga0496108_0008895_3126_4082 | 318 |
| 564 | 3300048912 | Ga0496109_0012979 | Ga0496109_0012979_5166_6122 | 318 |
| 565 | 3300048915 | Ga0496112_0016056 | Ga0496112_0016056_5824_6780 | 318 |
| 566 | 3300048916 | Ga0496113_0001663 | Ga0496113_0001663_2505_3461 | 318 |
| 567 | 3300053084 | Ga0495595_0049973 | Ga0495595_0049973_740_1705 | 318 |
| 568 | 3300053085 | Ga0495619_0027682 | Ga0495619_0027682_803_1768 | 318 |
| 569 | 3300028800 | Ga0265338_10074675 | Ga0265338_100746752 | 319 |
| 570 | 3300031595 | Ga0265313_10021626 | Ga0265313_100216263 | 319 |
| 571 | 3300002073 | JGI24745J21846_1008664 | JGI24745J21846_10086641 | 320 |
| 572 | 3300009098 | Ga0105245_10000287 | Ga0105245_1000028719 | 320 |
| 573 | 3300009101 | Ga0105247_10001223 | Ga0105247_100012237 | 320 |
| 574 | 3300009148 | Ga0105243_10000695 | Ga0105243_1000069525 | 320 |
| 575 | 3300009174 | Ga0105241_10002331 | Ga0105241_100023318 | 320 |
| 576 | 3300009176 | Ga0105242_10000792 | Ga0105242_1000079227 | 320 |
| 577 | 3300009177 | Ga0105248_10000535 | Ga0105248_1000053539 | 320 |
| 578 | 3300009545 | Ga0105237_10002795 | Ga0105237_100027955 | 320 |
| 579 | 3300009553 | Ga0105249_10000279 | Ga0105249_1000027921 | 320 |
| 580 | 3300010375 | Ga0105239_10001686 | Ga0105239_1000168624 | 320 |
| 581 | 3300011119 | Ga0105246_10000095 | Ga0105246_1000009515 | 320 |
| 582 | 3300013100 | Ga0157373_10050116 | Ga0157373_100501164 | 320 |
| 583 | 3300013102 | Ga0157371_10148569 | Ga0157371_101485692 | 320 |
| 584 | 3300013296 | Ga0157374_10001348 | Ga0157374_100013489 | 320 |
| 585 | 3300013297 | Ga0157378_10000956 | Ga0157378_1000095620 | 320 |
| 586 | 3300013306 | Ga0163162_10003795 | Ga0163162_1000379517 | 320 |
| 587 | 3300013307 | Ga0157372_10445281 | Ga0157372_104452812 | 320 |
| 588 | 3300013308 | Ga0157375_10001973 | Ga0157375_1000197313 | 320 |
| 589 | 3300014325 | Ga0163163_10055839 | Ga0163163_100558392 | 320 |
| 590 | 3300014326 | Ga0157380_10000052 | Ga0157380_1000005222 | 320 |
| 591 | 3300014326 | Ga0157380_10185834 | Ga0157380_101858342 | 320 |
| 592 | 3300014745 | Ga0157377_10000076 | Ga0157377_100000768 | 320 |
| 593 | 3300014968 | Ga0157379_10000060 | Ga0157379_1000006046 | 320 |
| 594 | 3300014969 | Ga0157376_10000141 | Ga0157376_1000014139 | 320 |
| 595 | 3300034819 | Ga0373958_0000674 | Ga0373958_0000674_634_1596 | 320 |
| 596 | 3300034820 | Ga0373959_0004580 | Ga0373959_0004580_424_1386 | 320 |
| 597 | 3300034957 | Ga0373938_0000687 | Ga0373938_0000687_4110_5072 | 320 |
| 598 | 3300035084 | Ga0373928_0012217 | Ga0373928_0012217_623_1585 | 320 |
| 599 | 3300035085 | Ga0373929_0001530 | Ga0373929_0001530_792_1754 | 320 |
| 600 | 3300035091 | Ga0373951_0006554 | Ga0373951_0006554_596_1558 | 320 |
| 601 | 3300035092 | Ga0373952_0000333 | Ga0373952_0000333_2662_3624 | 320 |
| 602 | 3300035207 | Ga0373942_0001029 | Ga0373942_0001029_5280_6242 | 320 |
| 603 | 3300035691 | Ga0373931_0021889 | Ga0373931_0021889_1828_2790 | 320 |
| 604 | 3300048903 | Ga0496100_0000400 | Ga0496100_0000400_17169_18131 | 320 |
| 605 | 3300048904 | Ga0496101_0000151 | Ga0496101_0000151_37979_38941 | 320 |
| 606 | 3300048905 | Ga0496102_0002633 | Ga0496102_0002633_9070_10032 | 320 |
| 607 | 3300048906 | Ga0496103_0000589 | Ga0496103_0000589_18393_19355 | 320 |
| 608 | 3300048907 | Ga0496104_0039113 | Ga0496104_0039113_1423_2385 | 320 |
| 609 | 3300048909 | Ga0496106_0005428 | Ga0496106_0005428_3821_4783 | 320 |
| 610 | 3300048910 | Ga0496107_0000959 | Ga0496107_0000959_4409_5371 | 320 |
| 611 | 3300048912 | Ga0496109_0000186 | Ga0496109_0000186_59462_60424 | 320 |
| 612 | 3300048913 | Ga0496110_0013927 | Ga0496110_0013927_3501_4463 | 320 |
| 613 | 3300048915 | Ga0496112_0150966 | Ga0496112_0150966_656_1618 | 320 |
| 614 | 3300048916 | Ga0496113_0057454 | Ga0496113_0057454_1869_2831 | 320 |
| 615 | 3300048917 | Ga0496114_0005496 | Ga0496114_0005496_4437_5399 | 320 |
| 616 | 3300048918 | Ga0496115_0002326 | Ga0496115_0002326_8383_9345 | 320 |
| 617 | 3300050494 | nmdc:mga06z11_16197_c1 | nmdc:mga06z11_16197_c1_1151_2113 | 320 |
| 618 | 3300050511 | nmdc:mga08y16_311_c1 | nmdc:mga08y16_311_c1_14088_15050 | 320 |
| 619 | 3300050512 | nmdc:mga0n895_62_c1 | nmdc:mga0n895_62_c1_42368_43330 | 320 |
| 620 | 3300050513 | nmdc:mga0rr50_62367_c1 | nmdc:mga0rr50_62367_c1_1508_2470 | 320 |
| 621 | 3300053084 | Ga0495595_0133903 | Ga0495595_0133903_189_1190 | 320 |
| 622 | 3300009094 | Ga0111539_10001255 | Ga0111539_1000125525 | 321 |
| 623 | 3300009148 | Ga0105243_10053738 | Ga0105243_100537383 | 321 |
| 624 | 3300009553 | Ga0105249_10003839 | Ga0105249_1000383915 | 321 |
| 625 | 3300013306 | Ga0163162_10042395 | Ga0163162_100423953 | 321 |
| 626 | 3300034816 | Ga0373930_0000027 | Ga0373930_0000027_12115_13080 | 321 |
| 627 | 3300034817 | Ga0373948_0000257 | Ga0373948_0000257_1069_2034 | 321 |
| 628 | 3300034818 | Ga0373950_0004090 | Ga0373950_0004090_203_1168 | 321 |
| 629 | 3300034819 | Ga0373958_0000466 | Ga0373958_0000466_1048_2013 | 321 |
| 630 | 3300034820 | Ga0373959_0000673 | Ga0373959_0000673_2806_3771 | 321 |
| 631 | 3300034957 | Ga0373938_0000020 | Ga0373938_0000020_302_1267 | 321 |
| 632 | 3300035084 | Ga0373928_0000298 | Ga0373928_0000298_4668_5633 | 321 |
| 633 | 3300035085 | Ga0373929_0004695 | Ga0373929_0004695_117_1082 | 321 |
| 634 | 3300035088 | Ga0373940_0000080 | Ga0373940_0000080_3341_4306 | 321 |
| 635 | 3300035090 | Ga0373949_0000753 | Ga0373949_0000753_9161_10126 | 321 |
| 636 | 3300035091 | Ga0373951_0001678 | Ga0373951_0001678_553_1518 | 321 |
| 637 | 3300035092 | Ga0373952_0001012 | Ga0373952_0001012_3602_4567 | 321 |
| 638 | 3300035112 | Ga0373932_0000316 | Ga0373932_0000316_10964_11929 | 321 |
| 639 | 3300035115 | Ga0373941_0000521 | Ga0373941_0000521_5922_6887 | 321 |
| 640 | 3300035121 | Ga0373960_0008241 | Ga0373960_0008241_1075_2040 | 321 |
| 641 | 3300035207 | Ga0373942_0000054 | Ga0373942_0000054_19383_20348 | 321 |
| 642 | 3300035241 | Ga0373961_0000807 | Ga0373961_0000807_1070_2035 | 321 |
| 643 | 3300042012 | Ga0439455_0033865 | Ga0439455_0033865_144_1109 | 321 |
| 644 | 3300042461 | Ga0439460_0008569 | Ga0439460_0008569_864_1829 | 321 |
| 645 | 3300042876 | Ga0451577_0055660 | Ga0451577_0055660_1418_2383 | 321 |
| 646 | 3300045051 | Ga0451576_0086931 | Ga0451576_0086931_1571_2536 | 321 |
| 647 | 3300048905 | Ga0496102_0272908 | Ga0496102_0272908_44_1009 | 321 |
| 648 | 3300048909 | Ga0496106_0061643 | Ga0496106_0061643_1014_1979 | 321 |
| 649 | 3300048912 | Ga0496109_0030370 | Ga0496109_0030370_52_1017 | 321 |
| 650 | 3300050511 | nmdc:mga08y16_1219_c1 | nmdc:mga08y16_1219_c1_21771_22736 | 321 |
| 651 | 3300050515 | nmdc:mga0a205_153067_c1 | nmdc:mga0a205_153067_c1_159_1124 | 321 |
| 652 | 2209111006 | 2214745219 | 2213754930 | 323 |
| 653 | 3300000042 | ARSoilYngRDRAFT_c00268 | ARSoilYngRDRAFT_002687 | 323 |
| 654 | 3300000043 | ARcpr5yngRDRAFT_c000083 | ARcpr5yngRDRAFT_00008312 | 323 |
| 655 | 3300000043 | ARcpr5yngRDRAFT_c000130 | ARcpr5yngRDRAFT_00013012 | 323 |
| 656 | 3300000044 | ARSoilOldRDRAFT_c000077 | ARSoilOldRDRAFT_00007712 | 323 |
| 657 | 3300000652 | ARCol0yngRDRAFT_1000003 | ARCol0yngRDRAFT_100000336 | 323 |
| 658 | 3300001990 | JGI24737J22298_10004159 | JGI24737J22298_100041592 | 323 |
| 659 | 3300005277 | Ga0065716_1001562 | Ga0065716_10015627 | 323 |
| 660 | 3300005289 | Ga0065704_10079631 | Ga0065704_100796316 | 323 |
| 661 | 3300005290 | Ga0065712_10000247 | Ga0065712_1000024719 | 323 |
| 662 | 3300005336 | Ga0070680_100105591 | Ga0070680_1001055912 | 323 |
| 663 | 3300005339 | Ga0070660_100084732 | Ga0070660_1000847322 | 323 |
| 664 | 3300005340 | Ga0070689_100002790 | Ga0070689_10000279014 | 323 |
| 665 | 3300005343 | Ga0070687_100017541 | Ga0070687_1000175413 | 323 |
| 666 | 3300005344 | Ga0070661_100230987 | Ga0070661_1002309872 | 323 |
| 667 | 3300005345 | Ga0070692_10003914 | Ga0070692_100039143 | 323 |
| 668 | 3300005347 | Ga0070668_100096942 | Ga0070668_1000969422 | 323 |
| 669 | 3300005365 | Ga0070688_100255013 | Ga0070688_1002550132 | 323 |
| 670 | 3300005366 | Ga0070659_100122428 | Ga0070659_1001224282 | 323 |
| 671 | 3300005438 | Ga0070701_10010531 | Ga0070701_100105313 | 323 |
| 672 | 3300005440 | Ga0070705_100036888 | Ga0070705_1000368882 | 323 |
| 673 | 3300005441 | Ga0070700_100260020 | Ga0070700_1002600202 | 323 |
| 674 | 3300005444 | Ga0070694_100097071 | Ga0070694_1000970712 | 323 |
| 675 | 3300005457 | Ga0070662_100146016 | Ga0070662_1001460162 | 323 |
| 676 | 3300005530 | Ga0070679_100144710 | Ga0070679_1001447102 | 323 |
| 677 | 3300005544 | Ga0070686_100022707 | Ga0070686_1000227075 | 323 |
| 678 | 3300005546 | Ga0070696_100073748 | Ga0070696_1000737483 | 323 |
| 679 | 3300005549 | Ga0070704_100064769 | Ga0070704_1000647693 | 323 |
| 680 | 3300005617 | Ga0068859_100162636 | Ga0068859_1001626363 | 323 |
| 681 | 3300005719 | Ga0068861_100395829 | Ga0068861_1003958292 | 323 |
| 682 | 3300005843 | Ga0068860_100138100 | Ga0068860_1001381002 | 323 |
| 683 | 3300006852 | Ga0075433_10133112 | Ga0075433_101331123 | 323 |
| 684 | 3300006931 | Ga0097620_100162629 | Ga0097620_1001626293 | 323 |
| 685 | 3300025904 | Ga0207647_10037247 | Ga0207647_100372473 | 323 |
| 686 | 3300025912 | Ga0207707_10145090 | Ga0207707_101450902 | 323 |
| 687 | 3300025917 | Ga0207660_10028511 | Ga0207660_100285112 | 323 |
| 688 | 3300025918 | Ga0207662_10036635 | Ga0207662_100366353 | 323 |
| 689 | 3300025919 | Ga0207657_10058352 | Ga0207657_100583522 | 323 |
| 690 | 3300025932 | Ga0207690_10039516 | Ga0207690_100395162 | 323 |
| 691 | 3300025933 | Ga0207706_10004416 | Ga0207706_100044163 | 323 |
| 692 | 3300025945 | Ga0207679_10344975 | Ga0207679_103449751 | 323 |
| 693 | 3300025972 | Ga0207668_10024956 | Ga0207668_100249563 | 323 |
| 694 | 3300026035 | Ga0207703_10165806 | Ga0207703_101658062 | 323 |
| 695 | 3300026041 | Ga0207639_10105661 | Ga0207639_101056613 | 323 |
| 696 | 3300026075 | Ga0207708_10030828 | Ga0207708_100308283 | 323 |
| 697 | 3300026118 | Ga0207675_100092410 | Ga0207675_1000924102 | 323 |
| 698 | 3300027717 | Ga0209998_10004186 | Ga0209998_100041862 | 323 |
| 699 | 3300027907 | Ga0207428_10001468 | Ga0207428_1000146814 | 323 |
| 700 | 3300028380 | Ga0268265_10124096 | Ga0268265_101240962 | 323 |
| 701 | 3300028381 | Ga0268264_10321074 | Ga0268264_103210741 | 323 |
| 702 | 3300035241 | Ga0373961_0019802 | Ga0373961_0019802_92_1120 | 323 |
| 703 | 3300049592 | Ga0501076_0021925 | Ga0501076_0021925_280_1251 | 323 |
| 704 | 3300049593 | Ga0501077_0054567 | Ga0501077_0054567_1407_2378 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l0q-assembly3.cif.gz_C | tandem yvtn beta-propeller and pkd domains from an archaeal surface layer protein | 0.8904 | 21 | 321 |
| 6ah0-assembly1.cif.gz_K | the cryo-em structure of the precusor of human pre-catalytic spliceosome (pre-b complex) | 0.8836 | 48 | 317 |
| 8c6j-assembly1.cif.gz_J | human spliceosomal pm5 c* complex | 0.8768 | 52 | 314 |
| 7znk-assembly1.cif.gz_C | structure of an endogenous human trex complex bound to mrna | 0.8739 | 41 | 316 |
| 5lqw-assembly1.cif.gz_K | yeast activated spliceosome | 0.8729 | 56 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q79FU0_283_386_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.9092 | 96 | 200 | 2.40.10.500 |
| af_Q79FU0_283_386_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.9012 | 96 | 200 | 2.40.10.500 |
| af_Q54TV0_1056_1281_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8945 | 160 | 311 | 2.130.10.10 |
| af_Q79FU2_202_331_2.40.10.500 | Mainly Beta;Beta Barrel;Thrombin, subunit H; | 0.885 | 94 | 207 | 2.40.10.500 |
| 1l0qD01 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8809 | 21 | 321 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537L0Q5-F1-model_v4 | YncE family protein | 0.9934 | 21 | 323 |
|
| AF-A0A537SD20-F1-model_v4 | Surface layer protein | 0.9855 | 59 | 323 |
|
| AF-A0A537L0Q5-F1-model_v4 | YncE family protein | 0.9837 | 21 | 323 |
|
| AF-A0A537SD20-F1-model_v4 | Surface layer protein | 0.9819 | 59 | 323 |
|
| AF-A0A0U3UUZ8-F1-model_v4 | WD40 repeat domain-containing protein | 0.9744 | 21 | 323 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar